F420608

General Info

Members Datasets Scaffolds Average Seq Length
356 232 335 277

Family's Representative Sequence

Representative Sequence 3300046664|Ga0495659_0078062|Ga0495659_0078062_338_1240
Length 300
Sequence MPRFQRSALLDKFKAIVARGEPIIGGGAGTGLSAKCQEAGGIDLIVIYNSGRYRMAGRGSLAGLLAYGDANQIVVEMAAEVLPVVKRTPVLAGVNGTDPFRLMDVFLDQLKTMGFAGVQNFPTVGIIDGTFRANLEETGMSYGLEVDMIAAAHAKDMLTTPYVFSADEATAMAKAGADIVVCHLGLTTGGSIGAETALKLEDCAAKVDAWAEAALKVRRDIIVLVHGGPVSSPGDASFIISNTRNCHGFYGASSMERLPTEVALTEQTRKFKAIGRQTRVRNETGGRGLAAGLRDWSERK

Samples

Sample ID Description Type Environment
1 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
2 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
3 2643221569 Achromobacter sp. Root565 Isolate Unclassified
4 2643221594 Achromobacter sp. Root170 Isolate Unclassified
5 2643221621 Achromobacter sp. Root83 Isolate Unclassified
6 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
7 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
8 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
9 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
10 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
11 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
12 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
13 2847085930 Erwinia persicina B64 Isolate Bulb
14 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
15 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
16 2858950400 Achromobacter sp. K91 Isolate Unclassified
17 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
18 2941479691
19 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
20 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
21 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
22 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
23 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
55 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
75 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
85 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
87 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
88 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
90 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
127 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
128 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
129 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
130 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
131 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
132 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
133 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
134 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
135 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
136 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
137 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
138 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
139 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
140 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
141 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
142 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
143 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
144 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
145 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
146 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
147 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
148 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
149 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
150 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
151 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
152 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
153 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
154 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
155 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
156 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
157 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
158 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
159 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
160 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
161 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
162 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
163 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
164 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
165 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
166 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
167 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
168 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
169 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
170 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
171 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
172 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
173 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
174 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
175 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
176 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
177 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
192 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
193 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
194 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
195 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
196 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
197 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
198 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
199 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
200 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
201 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
202 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
203 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
204 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
205 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
208 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
209 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
210 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
211 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
212 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
213 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
214 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
215 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
216 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
217 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
218 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
219 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
220 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
221 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
222 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
223 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
224 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
225 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
226 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
227 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
228 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
229 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
230 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
231 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
232 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.1
Metatranscriptomes 0
Isolates 5.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0.28
Endosphere 10.11
Nodule 2.53
Rhizoplane 0.56
Rhizosphere 73.31
Stem 0
Stem Tuber 0
Unclassified 13.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1023557 3300002987 Bacteria 1114
2 JGI25151J46595_10000314 3300003187 Bacteria 52844
3 JGI25151J46595_10000438 3300003187 Bacteria 41211
4 JGI25160J50197_1009698 3300003354 Bacteria 3546
5 JGI25405J52794_10007576 3300003911 Bacteria 2004
6 Ga0065712_10107594 3300005290 Bacteria 1892
7 Ga0070683_100008780 3300005329 Bacteria 8593
8 Ga0070683_100050555 3300005329 Bacteria 3848
9 Ga0070670_100079856 3300005331 Bacteria 2811
10 Ga0070670_100472646 3300005331 Bacteria 1113
11 Ga0070677_10004031 3300005333 Bacteria 4770
12 Ga0068869_100011895 3300005334 Bacteria 5724
13 Ga0068868_100005850 3300005338 Bacteria 8670
14 Ga0070660_100268187 3300005339 Bacteria 1395
15 Ga0070691_10006746 3300005341 Bacteria 5255
16 Ga0070661_100052786 3300005344 Bacteria 2975
17 Ga0070692_10013507 3300005345 Bacteria 3808
18 Ga0070668_100432101 3300005347 Bacteria 1129
19 Ga0070668_100436013 3300005347 Bacteria 1124
20 Ga0070675_100060670 3300005354 Bacteria 3122
21 Ga0070674_100008697 3300005356 Bacteria 6055
22 Ga0070659_100002398 3300005366 Bacteria 13311
23 Ga0070700_100001811 3300005441 Bacteria 10784
24 Ga0070700_100097834 3300005441 Bacteria 1928
25 Ga0070694_100019548 3300005444 Bacteria 4309
26 Ga0070663_100004519 3300005455 Bacteria 8194
27 Ga0070662_100030800 3300005457 Bacteria 3759
28 Ga0070679_100244558 3300005530 Bacteria 1751
29 Ga0070684_100010667 3300005535 Bacteria 7287
30 Ga0070672_100102251 3300005543 Bacteria 2326
31 Ga0070695_100007461 3300005545 Bacteria 6480
32 Ga0070664_100009832 3300005564 Bacteria 7750
33 Ga0068857_100063230 3300005577 Bacteria 3290
34 Ga0068854_100222741 3300005578 Bacteria 1493
35 Ga0068852_100273316 3300005616 Bacteria 1627
36 Ga0068864_100014721 3300005618 Bacteria 6497
37 Ga0068858_100077577 3300005842 Bacteria 3086
38 Ga0068860_100006700 3300005843 Bacteria 11560
39 Ga0068862_100005722 3300005844 Bacteria 10371
40 Ga0081455_10001465 3300005937 Bacteria 29231
41 Ga0081455_10002502 3300005937 Bacteria 21812
42 Ga0081455_10006203 3300005937 Bacteria 12890
43 Ga0081455_10015370 3300005937 Bacteria 7441
44 Ga0081538_10012224 3300005981 Bacteria 6895
45 Ga0081540_1000214 3300005983 Bacteria 61107
46 Ga0081539_10129129 3300005985 Bacteria 1244
47 Ga0075365_10001561 3300006038 Bacteria 10495
48 Ga0075365_10023140 3300006038 Bacteria 3904
49 Ga0075363_100013984 3300006048 Bacteria 3908
50 Ga0075364_10013738 3300006051 Bacteria 4986
51 Ga0070715_10020891 3300006163 Bacteria 2531
52 Ga0075367_10036475 3300006178 Bacteria 2851
53 Ga0075428_100001969 3300006844 Bacteria 22114
54 Ga0075428_100050883 3300006844 Bacteria 4542
55 Ga0075428_100069012 3300006844 Bacteria 3867
56 Ga0075428_100187552 3300006844 Bacteria 2237
57 Ga0075428_100241504 3300006844 Bacteria 1948
58 Ga0075430_100092707 3300006846 Bacteria 2525
59 Ga0075431_100000174 3300006847 Bacteria 45531
60 Ga0075431_100015703 3300006847 Bacteria 7679
61 Ga0075431_100060480 3300006847 Bacteria 3909
62 Ga0075434_100217497 3300006871 Bacteria 1930
63 Ga0075429_100238896 3300006880 Bacteria 1591
64 Ga0075429_100307775 3300006880 Bacteria 1387
65 Ga0075429_100426850 3300006880 Bacteria 1161
66 Ga0105240_10008886 3300009093 Bacteria 14298
67 Ga0111539_10000421 3300009094 Bacteria 53088
68 Ga0111539_10003541 3300009094 Bacteria 20585
69 Ga0111539_10004612 3300009094 Bacteria 18003
70 Ga0111539_10019930 3300009094 Bacteria 8261
71 Ga0111539_10019982 3300009094 Bacteria 8251
72 Ga0111539_10027010 3300009094 Bacteria 7011
73 Ga0105247_10051741 3300009101 Bacteria 2531
74 Ga0114129_10000648 3300009147 Bacteria 43494
75 Ga0114129_10013376 3300009147 Bacteria 11694
76 Ga0114129_10110795 3300009147 Bacteria 3789
77 Ga0114129_10528755 3300009147 Bacteria 1536
78 Ga0105248_10451686 3300009177 Bacteria 1448
79 Ga0105237_10013270 3300009545 Bacteria 8642
80 Ga0105249_10222932 3300009553 Bacteria 1856
81 Ga0105249_10666358 3300009553 Bacteria 1099
82 Ga0123341_1038204 3300009765 Bacteria 3235
83 Ga0099796_10043156 3300010159 Bacteria 1535
84 Ga0105239_10001345 3300010375 Bacteria 33134
85 Ga0157371_10014495 3300013102 Bacteria 5947
86 Ga0157374_10148587 3300013296 Bacteria 2277
87 Ga0157375_10420792 3300013308 Bacteria 1502
88 Ga0157380_10228522 3300014326 Bacteria 1669
89 Ga0163161_10116403 3300017792 Bacteria 2004
90 Ga0209148_1001837 3300025254 Bacteria 8902
91 Ga0209455_1000196 3300025272 Bacteria 88682
92 Ga0209130_1000300 3300025284 Bacteria 60286
93 Ga0209130_1001262 3300025284 Bacteria 17603
94 Ga0209676_1001853 3300025292 Bacteria 17427
95 Ga0209025_1000084 3300025294 Bacteria 263812
96 Ga0209025_1000456 3300025294 Bacteria 79848
97 Ga0209025_1001455 3300025294 Bacteria 30992
98 Ga0209758_1003129 3300025297 Bacteria 15617
99 Ga0209050_1001393 3300025298 Bacteria 26261
100 Ga0207426_1000088 3300025302 Bacteria 287526
101 Ga0207426_1000311 3300025302 Bacteria 95578
102 Ga0209051_1050702 3300025303 Bacteria 1388
103 Ga0207656_10071982 3300025321 Bacteria 1538
104 Ga0207682_10001679 3300025893 Bacteria 10145
105 Ga0207685_10063034 3300025905 Bacteria 1475
106 Ga0207645_10166539 3300025907 Bacteria 1443
107 Ga0207695_10022561 3300025913 Bacteria 7140
108 Ga0207671_10008060 3300025914 Bacteria 9002
109 Ga0207662_10169447 3300025918 Bacteria 1399
110 Ga0207657_10039009 3300025919 Bacteria 4223
111 Ga0207649_10030764 3300025920 Bacteria 3183
112 Ga0207652_10256999 3300025921 Bacteria 1576
113 Ga0207646_10581037 3300025922 Bacteria 1006
114 Ga0207681_10313261 3300025923 Bacteria 1245
115 Ga0207694_10009781 3300025924 Bacteria 7237
116 Ga0207650_10038809 3300025925 Bacteria 3480
117 Ga0207659_10133381 3300025926 Bacteria 1920
118 Ga0207687_10016373 3300025927 Bacteria 4869
119 Ga0207687_10234516 3300025927 Bacteria 1451
120 Ga0207690_10016795 3300025932 Bacteria 4460
121 Ga0207709_10090547 3300025935 Bacteria 1998
122 Ga0207691_10069279 3300025940 Bacteria 3187
123 Ga0207689_10039343 3300025942 Bacteria 3915
124 Ga0207689_10270672 3300025942 Bacteria 1406
125 Ga0207661_10016973 3300025944 Bacteria 5378
126 Ga0207679_10024522 3300025945 Bacteria 4136
127 Ga0207679_10048819 3300025945 Bacteria 3084
128 Ga0207712_10039050 3300025961 Bacteria 3250
129 Ga0207712_10226662 3300025961 Bacteria 1497
130 Ga0207668_10234644 3300025972 Bacteria 1481
131 Ga0207639_10121224 3300026041 Bacteria 2149
132 Ga0207678_10006511 3300026067 Bacteria 10365
133 Ga0207708_10012193 3300026075 Bacteria 6412
134 Ga0207708_10017826 3300026075 Bacteria 5343
135 Ga0207641_10457577 3300026088 Bacteria 1234
136 Ga0207674_10077599 3300026116 Bacteria 3327
137 Ga0207683_10016755 3300026121 Bacteria 6238
138 Ga0207683_10180263 3300026121 Bacteria 1915
139 Ga0207698_10306930 3300026142 Bacteria 1480
140 Ga0209371_1000641 3300027312 Bacteria 30869
141 Ga0207428_10020069 3300027907 Bacteria 5686
142 Ga0207428_10061516 3300027907 Bacteria 2972
143 Ga0268265_10013514 3300028380 Bacteria 5549
144 Ga0268265_10063805 3300028380 Bacteria 2835
145 Ga0268264_10000065 3300028381 Bacteria 298403
146 Ga0265318_10008944 3300028577 Bacteria 4434
147 Ga0307517_10000647 3300028786 Bacteria 59721
148 Ga0307515_10031808 3300028794 Bacteria 8769
149 Ga0307512_10143959 3300030522 Bacteria 1449
150 Ga0265327_10091125 3300031251 Bacteria 1486
151 Ga0307513_10268241 3300031456 Bacteria 1492
152 Ga0307508_10065256 3300031616 Bacteria 3208
153 Ga0307405_10238388 3300031731 Bacteria 1346
154 Ga0307406_10063621 3300031901 Bacteria 2391
155 Ga0307412_10004051 3300031911 Bacteria 8165
156 Ga0307416_100144303 3300032002 Bacteria 2170
157 Ga0307510_10032459 3300033180 Bacteria 5882
158 Ga0307510_10124212 3300033180 Bacteria 2276
159 Ga0373959_0047613 3300034820 Bacteria 917
160 Ga0373938_0004913 3300034957 Bacteria 2252
161 Ga0373940_0001250 3300035088 Bacteria 4508
162 Ga0373949_0004111 3300035090 Bacteria 3367
163 Ga0373939_0005271 3300035114 Bacteria 3075
164 Ga0373939_0093875 3300035114 Bacteria 1018
165 Ga0373960_0003277 3300035121 Bacteria 3661
166 Ga0373961_0026834 3300035241 Bacteria 1577
167 Ga0373962_0001494 3300035242 Bacteria 5544
168 Ga0316574_0005163 3300035398 Bacteria 6944
169 Ga0316574_0108066 3300035398 Bacteria 1783
170 Ga0316574_0138908 3300035398 Bacteria 1565
171 Ga0316574_0159521 3300035398 Bacteria 1453
172 Ga0373931_0001972 3300035691 Bacteria 9028
173 Ga0373931_0002804 3300035691 Bacteria 7759
174 Ga0395900_0302318 3300037418 Bacteria 1586
175 Ga0436364_0928272 3300037853 Bacteria 1292
176 Ga0400483_049342 3300039062 Bacteria 2286
177 Ga0400483_111665 3300039062 Bacteria 2421
178 Ga0400483_177699 3300039062 Bacteria 13083
179 Ga0439438_001616 3300041405 Bacteria 9891
180 Ga0439447_012760 3300041407 Bacteria 2404
181 Ga0439453_0009513 3300041408 Bacteria 1584
182 Ga0439432_023265 3300042006 Bacteria 2042
183 Ga0450907_012749 3300042146 Bacteria 1400
184 Ga0439435_0000301 3300042436 Bacteria 7350
185 Ga0439435_0015864 3300042436 Bacteria 1881
186 Ga0466963_0172305 3300044694 Bacteria 1509
187 Ga0453684_0179830 3300044712 Bacteria 2484
188 Ga0451576_0000647 3300045051 Bacteria 71894
189 Ga0451576_0223595 3300045051 Bacteria 1966
190 Ga0495638_0063785 3300046460 Bacteria 2270
191 Ga0495656_0018918 3300046615 Bacteria 2652
192 Ga0495625_0183971 3300046660 Bacteria 1388
193 Ga0495625_0270792 3300046660 Bacteria 1096
194 Ga0495659_0078062 3300046664 Bacteria 1252
195 Ga0496113_0158073 3300048916 Bacteria 1791
196 Ga0496114_0210609 3300048917 Bacteria 1705
197 Ga0496116_0092009 3300048919 Bacteria 1840
198 Ga0496117_0013931 3300048920 Bacteria 6970
199 Ga0496117_0015046 3300048920 Bacteria 6628
200 Ga0496117_0182117 3300048920 Bacteria 1206
201 Ga0496118_0007345 3300048921 Bacteria 11718
202 Ga0496118_0022136 3300048921 Bacteria 5568
203 Ga0496119_0002441 3300048922 Bacteria 20413
204 Ga0496119_0026179 3300048922 Bacteria 4050
205 Ga0496119_0062652 3300048922 Bacteria 2215
206 Ga0496120_0002273 3300048923 Bacteria 19972
207 Ga0496120_0002913 3300048923 Bacteria 16344
208 Ga0496121_0002696 3300048924 Bacteria 26537
209 Ga0496121_0348973 3300048924 Bacteria 986
210 Ga0496122_0000350 3300048925 Bacteria 99606
211 Ga0496122_0010645 3300048925 Bacteria 9446
212 Ga0496122_0030340 3300048925 Bacteria 4532
213 Ga0496124_0000269 3300048927 Bacteria 100125
214 Ga0496124_0129002 3300048927 Bacteria 2011
215 Ga0496124_0202238 3300048927 Bacteria 1509
216 Ga0496125_0000105 3300048928 Bacteria 200717
217 Ga0496125_0015328 3300048928 Bacteria 7419
218 Ga0496125_0028051 3300048928 Bacteria 5091
219 Ga0496126_0001639 3300048929 Bacteria 33856
220 Ga0496126_0057559 3300048929 Bacteria 3508
221 Ga0496126_0307287 3300048929 Bacteria 1306
222 Ga0501292_003397 3300049515 Bacteria 2126
223 Ga0501032_0007131 3300049569 Bacteria 8185
224 Ga0501032_0074535 3300049569 Bacteria 2261
225 Ga0501033_0007269 3300049570 Bacteria 8636
226 Ga0501034_0215186 3300049571 Bacteria 1875
227 Ga0501034_0323561 3300049571 Bacteria 1474
228 Ga0501036_0009337 3300049572 Bacteria 8065
229 Ga0501036_0033465 3300049572 Bacteria 4347
230 Ga0501036_0050403 3300049572 Bacteria 3525
231 Ga0501036_0229009 3300049572 Bacteria 1560
232 Ga0501036_0481715 3300049572 Bacteria 1033
233 Ga0501037_0133550 3300049573 Bacteria 1778
234 Ga0501038_0013242 3300049574 Bacteria 7522
235 Ga0501038_0027113 3300049574 Bacteria 5099
236 Ga0501038_0212685 3300049574 Bacteria 1546
237 Ga0501039_0003742 3300049575 Bacteria 11433
238 Ga0501039_0022037 3300049575 Bacteria 4889
239 Ga0501039_0187838 3300049575 Bacteria 1625
240 Ga0501040_0362678 3300049576 Bacteria 1038
241 Ga0501041_0121969 3300049577 Bacteria 1620
242 Ga0501042_0005755 3300049578 Bacteria 8008
243 Ga0501043_0011216 3300049579 Bacteria 7019
244 Ga0501043_0011784 3300049579 Bacteria 6847
245 Ga0501046_0005940 3300049580 Bacteria 10872
246 Ga0501046_0030020 3300049580 Bacteria 4416
247 Ga0501046_0048606 3300049580 Bacteria 3358
248 Ga0501047_0063219 3300049581 Bacteria 3570
249 Ga0501047_0065038 3300049581 Bacteria 3516
250 Ga0501047_0203854 3300049581 Bacteria 1838
251 Ga0501047_0245078 3300049581 Bacteria 1641
252 Ga0501048_0139928 3300049582 Bacteria 1711
253 Ga0501067_0017543 3300049583 Bacteria 3961
254 Ga0501067_0059388 3300049583 Bacteria 2117
255 Ga0501068_0002028 3300049584 Bacteria 10785
256 Ga0501068_0028340 3300049584 Bacteria 3311
257 Ga0501068_0168089 3300049584 Bacteria 1383
258 Ga0501069_0000489 3300049585 Bacteria 18086
259 Ga0501070_0020144 3300049586 Bacteria 5595
260 Ga0501070_0032761 3300049586 Bacteria 4347
261 Ga0501071_0002859 3300049587 Bacteria 10643
262 Ga0501071_0062797 3300049587 Bacteria 2692
263 Ga0501071_0122202 3300049587 Bacteria 1930
264 Ga0501071_0284986 3300049587 Bacteria 1250
265 Ga0501073_0023930 3300049589 Bacteria 4385
266 Ga0501073_0090571 3300049589 Bacteria 2125
267 Ga0501074_0002409 3300049590 Bacteria 13041
268 Ga0501075_0012849 3300049591 Bacteria 5962
269 Ga0501076_0075961 3300049592 Bacteria 2694
270 Ga0501076_0138320 3300049592 Bacteria 1978
271 Ga0501076_0251022 3300049592 Bacteria 1448
272 Ga0501076_0667334 3300049592 Bacteria 858
273 Ga0501077_0103149 3300049593 Bacteria 1807
274 Ga0501077_0318010 3300049593 Bacteria 992
275 Ga0501079_0005846 3300049741 Bacteria 9201
276 Ga0501079_0024364 3300049741 Bacteria 4642
277 Ga0501079_0065623 3300049741 Bacteria 2800
278 Ga0501080_0044413 3300049742 Bacteria 4136
279 Ga0501080_0085446 3300049742 Bacteria 2932
280 Ga0501080_0160720 3300049742 Bacteria 2074
281 Ga0501081_0004314 3300049743 Bacteria 9115
282 Ga0501083_0039643 3300049744 Bacteria 3198
283 Ga0501083_0105504 3300049744 Bacteria 1855
284 Ga0501035_0008272 3300049822 Bacteria 9694
285 Ga0501035_0022146 3300049822 Bacteria 5836
286 Ga0501035_0061346 3300049822 Bacteria 3346
287 Ga0501044_0122867 3300049823 Bacteria 2595
288 Ga0501044_0140202 3300049823 Bacteria 2407
289 Ga0501045_0003775 3300049824 Bacteria 10414
290 Ga0501045_0007487 3300049824 Bacteria 7583
291 Ga0501045_0009076 3300049824 Bacteria 6948
292 Ga0501045_0032556 3300049824 Bacteria 3778
293 nmdc:mga03683_4957_c1 3300050489 Bacteria 4455
294 nmdc:mga03n38_218873_c1 3300050490 Bacteria 993
295 nmdc:mga03n38_48462_c1 3300050490 Bacteria 1885
296 nmdc:mga00v17_9277_c1 3300050491 Bacteria 5319
297 nmdc:mga0yw44_25239_c1 3300050492 Bacteria 3376
298 nmdc:mga0k408_4641_c1 3300050493 Bacteria 7279
299 nmdc:mga05p37_134432_c1 3300050507 Bacteria 3034
300 nmdc:mga05p37_1359_c1 3300050507 Bacteria 28454
301 nmdc:mga05p37_624340_c1 3300050507 Bacteria 1212
302 nmdc:mga09592_218133_c1 3300050508 Bacteria 1653
303 nmdc:mga09592_258004_c1 3300050508 Bacteria 1511
304 nmdc:mga09592_492782_c1 3300050508 Bacteria 1055
305 nmdc:mga0qj67_30150_c1 3300050509 Bacteria 4219
306 nmdc:mga0qj67_84578_c1 3300050509 Bacteria 2544
307 nmdc:mga06r32_204420_c1 3300050510 Bacteria 1963
308 nmdc:mga06r32_206_c1 3300050510 Bacteria 47440
309 nmdc:mga06r32_246478_c1 3300050510 Bacteria 1774
310 nmdc:mga06r32_34167_c1 3300050510 Bacteria 4794
311 nmdc:mga08y16_23090_c1 3300050511 Bacteria 6568
312 nmdc:mga08y16_358_c1 3300050511 Bacteria 41117
313 nmdc:mga08y16_43264_c1 3300050511 Bacteria 4719
314 nmdc:mga08y16_465607_c1 3300050511 Bacteria 1288
315 nmdc:mga08y16_5261_c1 3300050511 Bacteria 13517
316 nmdc:mga08y16_934906_c1 3300050511 Bacteria 851
317 nmdc:mga0n895_23164_c1 3300050512 Bacteria 5833
318 nmdc:mga0a205_156676_c1 3300050515 Bacteria 2176
319 Ga0500610_0175044 3300053079 Bacteria 1056
320 Ga0500646_0004437 3300053090 Bacteria 3556
321 Ga0500641_0001944 3300053096 Bacteria 7332
322 Ga0500642_0000253 3300053130 Bacteria 20092
323 Ga0500658_0146436 3300053134 Bacteria 1062
324 Ga0500568_0005052 3300053139 Bacteria 6910
325 Ga0500616_0002300 3300053153 Bacteria 16151
326 Ga0500609_001794 3300053731 Bacteria 3115
327 Ga0501084_0018713 3300054114 Bacteria 5767
328 Ga0501084_0046872 3300054114 Bacteria 3620
329 Ga0501084_0102709 3300054114 Bacteria 2401
330 Ga0501084_0173768 3300054114 Unclassified 1818
331 Ga0501084_0206878 3300054114 Bacteria 1656
332 Ga0501082_0038050 3300060353 Bacteria 4149
333 Ga0501082_0300197 3300060353 Bacteria 1398
334 Ga0530510_0039951 3300061734 Bacteria 3386
335 Ga0530510_0045061 3300061734 Bacteria 3187

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049576 Ga0501040_0362678 Ga0501040_0362678_11_760 245
2 3300049592 Ga0501076_0667334 Ga0501076_0667334_59_838 257
3 3300005937 Ga0081455_10006203 Ga0081455_100062039 261
4 3300005981 Ga0081538_10012224 Ga0081538_100122245 261
5 3300006038 Ga0075365_10001561 Ga0075365_100015614 261
6 3300006847 Ga0075431_100060480 Ga0075431_1000604802 261
7 3300009553 Ga0105249_10222932 Ga0105249_102229322 261
8 3300025254 Ga0209148_1001837 Ga0209148_10018377 261
9 3300025972 Ga0207668_10234644 Ga0207668_102346443 261
10 3300042436 Ga0439435_0015864 Ga0439435_0015864_228_1013 261
11 3300046660 Ga0495625_0270792 Ga0495625_0270792_15_803 261
12 3300049572 Ga0501036_0229009 Ga0501036_0229009_464_1255 261
13 3300049575 Ga0501039_0022037 Ga0501039_0022037_1120_1908 261
14 3300049575 Ga0501039_0187838 Ga0501039_0187838_752_1543 261
15 3300049577 Ga0501041_0121969 Ga0501041_0121969_811_1599 261
16 3300049587 Ga0501071_0062797 Ga0501071_0062797_803_1594 261
17 3300049587 Ga0501071_0122202 Ga0501071_0122202_1084_1872 261
18 3300049587 Ga0501071_0284986 Ga0501071_0284986_415_1233 261
19 3300049591 Ga0501075_0012849 Ga0501075_0012849_2651_3442 261
20 3300049592 Ga0501076_0138320 Ga0501076_0138320_934_1722 261
21 3300049592 Ga0501076_0251022 Ga0501076_0251022_468_1259 261
22 3300049593 Ga0501077_0103149 Ga0501077_0103149_403_1191 261
23 3300049743 Ga0501081_0004314 Ga0501081_0004314_5319_6107 261
24 3300049824 Ga0501045_0007487 Ga0501045_0007487_2706_3497 261
25 3300049824 Ga0501045_0032556 Ga0501045_0032556_2722_3510 261
26 3300050490 nmdc:mga03n38_48462_c1 nmdc:mga03n38_48462_c1_272_1057 261
27 3300050510 nmdc:mga06r32_246478_c1 nmdc:mga06r32_246478_c1_169_957 261
28 3300050511 nmdc:mga08y16_934906_c1 nmdc:mga08y16_934906_c1_46_840 261
29 3300054114 Ga0501084_0102709 Ga0501084_0102709_1454_2245 261
30 3300054114 Ga0501084_0206878 Ga0501084_0206878_587_1375 261
31 3300061734 Ga0530510_0039951 Ga0530510_0039951_231_1019 261
32 3300061734 Ga0530510_0045061 Ga0530510_0045061_1807_2598 261
33 3300053090 Ga0500646_0004437 Ga0500646_0004437_583_1422 262
34 3300039062 Ga0400483_049342 Ga0400483_049342_1211_2020 267
35 3300044712 Ga0453684_0179830 Ga0453684_0179830_377_1186 267
36 3300053079 Ga0500610_0175044 Ga0500610_0175044_10_816 267
37 3300053134 Ga0500658_0146436 Ga0500658_0146436_245_1051 267
38 3300009765 Ga0123341_1038204 Ga0123341_10382044 268
39 3300044694 Ga0466963_0172305 Ga0466963_0172305_585_1400 269
40 3300049569 Ga0501032_0074535 Ga0501032_0074535_449_1264 269
41 3300049570 Ga0501033_0007269 Ga0501033_0007269_3915_4730 269
42 3300049571 Ga0501034_0215186 Ga0501034_0215186_556_1371 269
43 3300049572 Ga0501036_0033465 Ga0501036_0033465_2260_3075 269
44 3300049573 Ga0501037_0133550 Ga0501037_0133550_124_939 269
45 3300049574 Ga0501038_0013242 Ga0501038_0013242_4549_5364 269
46 3300049578 Ga0501042_0005755 Ga0501042_0005755_6292_7107 269
47 3300049580 Ga0501046_0048606 Ga0501046_0048606_961_1776 269
48 3300049581 Ga0501047_0245078 Ga0501047_0245078_377_1192 269
49 3300049583 Ga0501067_0059388 Ga0501067_0059388_968_1783 269
50 3300049584 Ga0501068_0168089 Ga0501068_0168089_296_1111 269
51 3300049592 Ga0501076_0075961 Ga0501076_0075961_1529_2344 269
52 3300049741 Ga0501079_0024364 Ga0501079_0024364_2831_3646 269
53 3300049742 Ga0501080_0160720 Ga0501080_0160720_263_1078 269
54 3300049822 Ga0501035_0008272 Ga0501035_0008272_1125_1940 269
55 3300049823 Ga0501044_0122867 Ga0501044_0122867_1769_2584 269
56 3300054114 Ga0501084_0018713 Ga0501084_0018713_2828_3643 269
57 3300060353 Ga0501082_0038050 Ga0501082_0038050_377_1192 269
58 3300049744 Ga0501083_0105504 Ga0501083_0105504_973_1800 270
59 3300054114 Ga0501084_0046872 Ga0501084_0046872_2309_3136 270
60 iso_pu_bacteria 8055632911 8055637800 270
61 3300025922 Ga0207646_10581037 Ga0207646_105810371 271
62 3300025942 Ga0207689_10270672 Ga0207689_102706722 272
63 iso_pu_bacteria 2643221569 2643860513 272
64 iso_pu_bacteria 2643221594 2643981625 272
65 iso_pu_bacteria 2643221621 2644119760 272
66 iso_pu_bacteria 2808606395 2809035533 272
67 iso_pu_bacteria 2821443989 2821446328 272
68 iso_pu_bacteria 2841911363 2841916107 272
69 iso_pu_bacteria 2841917233 2841921224 272
70 iso_pu_bacteria 2847085930 2847090618 272
71 iso_pu_bacteria 2857537821 2857539188 272
72 iso_pu_bacteria 2858950400 2858955971 272
73 iso_pu_bacteria 2883354860 2883358997 272
74 iso_pu_bacteria 2941479691 2941483761 272
75 3300005329 Ga0070683_100008780 Ga0070683_1000087805 273
76 3300005329 Ga0070683_100050555 Ga0070683_1000505556 273
77 3300005331 Ga0070670_100079856 Ga0070670_1000798562 273
78 3300005334 Ga0068869_100011895 Ga0068869_1000118954 273
79 3300005338 Ga0068868_100005850 Ga0068868_1000058506 273
80 3300005339 Ga0070660_100268187 Ga0070660_1002681871 273
81 3300005344 Ga0070661_100052786 Ga0070661_1000527862 273
82 3300005345 Ga0070692_10013507 Ga0070692_100135074 273
83 3300005366 Ga0070659_100002398 Ga0070659_1000023985 273
84 3300005441 Ga0070700_100001811 Ga0070700_1000018117 273
85 3300005455 Ga0070663_100004519 Ga0070663_1000045194 273
86 3300005457 Ga0070662_100030800 Ga0070662_1000308005 273
87 3300005530 Ga0070679_100244558 Ga0070679_1002445582 273
88 3300005535 Ga0070684_100010667 Ga0070684_1000106674 273
89 3300005564 Ga0070664_100009832 Ga0070664_1000098322 273
90 3300005577 Ga0068857_100063230 Ga0068857_1000632303 273
91 3300005578 Ga0068854_100222741 Ga0068854_1002227412 273
92 3300005616 Ga0068852_100273316 Ga0068852_1002733162 273
93 3300005842 Ga0068858_100077577 Ga0068858_1000775772 273
94 3300005844 Ga0068862_100005722 Ga0068862_1000057228 273
95 3300006880 Ga0075429_100426850 Ga0075429_1004268502 273
96 3300009094 Ga0111539_10003541 Ga0111539_1000354116 273
97 3300009094 Ga0111539_10019930 Ga0111539_100199306 273
98 3300009147 Ga0114129_10528755 Ga0114129_105287552 273
99 3300009553 Ga0105249_10666358 Ga0105249_106663581 273
100 3300013296 Ga0157374_10148587 Ga0157374_101485871 273
101 3300014326 Ga0157380_10228522 Ga0157380_102285222 273
102 3300025294 Ga0209025_1001455 Ga0209025_100145534 273
103 3300025919 Ga0207657_10039009 Ga0207657_100390093 273
104 3300025920 Ga0207649_10030764 Ga0207649_100307645 273
105 3300025921 Ga0207652_10256999 Ga0207652_102569992 273
106 3300025925 Ga0207650_10038809 Ga0207650_100388092 273
107 3300025927 Ga0207687_10016373 Ga0207687_100163735 273
108 3300025932 Ga0207690_10016795 Ga0207690_100167955 273
109 3300025942 Ga0207689_10039343 Ga0207689_100393435 273
110 3300025944 Ga0207661_10016973 Ga0207661_100169734 273
111 3300025945 Ga0207679_10024522 Ga0207679_100245223 273
112 3300025945 Ga0207679_10048819 Ga0207679_100488194 273
113 3300025961 Ga0207712_10039050 Ga0207712_100390504 273
114 3300026067 Ga0207678_10006511 Ga0207678_100065117 273
115 3300026075 Ga0207708_10012193 Ga0207708_100121936 273
116 3300026121 Ga0207683_10180263 Ga0207683_101802631 273
117 3300026142 Ga0207698_10306930 Ga0207698_103069302 273
118 3300027907 Ga0207428_10061516 Ga0207428_100615165 273
119 3300028380 Ga0268265_10013514 Ga0268265_100135144 273
120 3300031901 Ga0307406_10063621 Ga0307406_100636212 273
121 3300048928 Ga0496125_0015328 Ga0496125_0015328_4902_5729 273
122 3300050507 nmdc:mga05p37_624340_c1 nmdc:mga05p37_624340_c1_166_987 273
123 3300050511 nmdc:mga08y16_43264_c1 nmdc:mga08y16_43264_c1_1022_1855 273
124 3300050511 nmdc:mga08y16_5261_c1 nmdc:mga08y16_5261_c1_5475_6314 273
125 3300005347 Ga0070668_100432101 Ga0070668_1004321011 274
126 3300005937 Ga0081455_10015370 Ga0081455_100153707 274
127 3300006038 Ga0075365_10023140 Ga0075365_100231402 274
128 3300006844 Ga0075428_100069012 Ga0075428_1000690122 274
129 3300006847 Ga0075431_100015703 Ga0075431_1000157033 274
130 3300006880 Ga0075429_100307775 Ga0075429_1003077751 274
131 3300009094 Ga0111539_10019982 Ga0111539_100199825 274
132 3300009147 Ga0114129_10110795 Ga0114129_101107952 274
133 3300013308 Ga0157375_10420792 Ga0157375_104207922 274
134 3300025292 Ga0209676_1001853 Ga0209676_100185316 274
135 3300025923 Ga0207681_10313261 Ga0207681_103132612 274
136 3300026041 Ga0207639_10121224 Ga0207639_101212243 274
137 3300035398 Ga0316574_0005163 Ga0316574_0005163_3809_4639 274
138 3300035398 Ga0316574_0108066 Ga0316574_0108066_179_1003 274
139 3300035398 Ga0316574_0138908 Ga0316574_0138908_352_1182 274
140 3300035398 Ga0316574_0159521 Ga0316574_0159521_26_856 274
141 3300048920 Ga0496117_0015046 Ga0496117_0015046_3414_4244 274
142 3300048922 Ga0496119_0026179 Ga0496119_0026179_2964_3794 274
143 3300048923 Ga0496120_0002273 Ga0496120_0002273_1152_1982 274
144 3300048925 Ga0496122_0010645 Ga0496122_0010645_7871_8701 274
145 3300048927 Ga0496124_0000269 Ga0496124_0000269_92951_93781 274
146 3300048929 Ga0496126_0001639 Ga0496126_0001639_13248_14078 274
147 3300049569 Ga0501032_0007131 Ga0501032_0007131_6276_7106 274
148 3300049571 Ga0501034_0323561 Ga0501034_0323561_483_1313 274
149 3300049572 Ga0501036_0009337 Ga0501036_0009337_1088_1918 274
150 3300049572 Ga0501036_0050403 Ga0501036_0050403_1027_1857 274
151 3300049574 Ga0501038_0027113 Ga0501038_0027113_96_926 274
152 3300049575 Ga0501039_0003742 Ga0501039_0003742_9667_10497 274
153 3300049579 Ga0501043_0011216 Ga0501043_0011216_1126_1956 274
154 3300049579 Ga0501043_0011784 Ga0501043_0011784_3883_4713 274
155 3300049580 Ga0501046_0005940 Ga0501046_0005940_1093_1923 274
156 3300049580 Ga0501046_0030020 Ga0501046_0030020_2781_3611 274
157 3300049581 Ga0501047_0063219 Ga0501047_0063219_469_1299 274
158 3300049581 Ga0501047_0065038 Ga0501047_0065038_34_864 274
159 3300049582 Ga0501048_0139928 Ga0501048_0139928_796_1626 274
160 3300049583 Ga0501067_0017543 Ga0501067_0017543_1152_1982 274
161 3300049584 Ga0501068_0002028 Ga0501068_0002028_963_1793 274
162 3300049584 Ga0501068_0028340 Ga0501068_0028340_1946_2776 274
163 3300049585 Ga0501069_0000489 Ga0501069_0000489_1029_1859 274
164 3300049586 Ga0501070_0032761 Ga0501070_0032761_2572_3402 274
165 3300049587 Ga0501071_0002859 Ga0501071_0002859_8614_9444 274
166 3300049589 Ga0501073_0023930 Ga0501073_0023930_1064_1894 274
167 3300049589 Ga0501073_0090571 Ga0501073_0090571_920_1750 274
168 3300049590 Ga0501074_0002409 Ga0501074_0002409_8587_9417 274
169 3300049741 Ga0501079_0005846 Ga0501079_0005846_1123_1953 274
170 3300049741 Ga0501079_0065623 Ga0501079_0065623_937_1767 274
171 3300049742 Ga0501080_0044413 Ga0501080_0044413_2297_3127 274
172 3300049744 Ga0501083_0039643 Ga0501083_0039643_1989_2819 274
173 3300049822 Ga0501035_0022146 Ga0501035_0022146_229_1059 274
174 3300049822 Ga0501035_0061346 Ga0501035_0061346_245_1075 274
175 3300049824 Ga0501045_0003775 Ga0501045_0003775_8574_9404 274
176 3300049824 Ga0501045_0009076 Ga0501045_0009076_5903_6733 274
177 3300050492 nmdc:mga0yw44_25239_c1 nmdc:mga0yw44_25239_c1_2441_3277 274
178 3300050507 nmdc:mga05p37_134432_c1 nmdc:mga05p37_134432_c1_1300_2154 274
179 3300050508 nmdc:mga09592_218133_c1 nmdc:mga09592_218133_c1_734_1588 274
180 3300050510 nmdc:mga06r32_34167_c1 nmdc:mga06r32_34167_c1_2254_3108 274
181 3300054114 Ga0501084_0173768 Ga0501084_0173768_674_1504 274
182 3300060353 Ga0501082_0300197 Ga0501082_0300197_324_1154 274
183 3300005331 Ga0070670_100472646 Ga0070670_1004726461 275
184 3300005333 Ga0070677_10004031 Ga0070677_100040312 275
185 3300005354 Ga0070675_100060670 Ga0070675_1000606702 275
186 3300005356 Ga0070674_100008697 Ga0070674_1000086975 275
187 3300005543 Ga0070672_100102251 Ga0070672_1001022512 275
188 3300005618 Ga0068864_100014721 Ga0068864_1000147215 275
189 3300006048 Ga0075363_100013984 Ga0075363_1000139842 275
190 3300006051 Ga0075364_10013738 Ga0075364_100137384 275
191 3300006178 Ga0075367_10036475 Ga0075367_100364752 275
192 3300006844 Ga0075428_100001969 Ga0075428_1000019698 275
193 3300006846 Ga0075430_100092707 Ga0075430_1000927072 275
194 3300006847 Ga0075431_100000174 Ga0075431_10000017432 275
195 3300009094 Ga0111539_10000421 Ga0111539_1000042129 275
196 3300009147 Ga0114129_10000648 Ga0114129_1000064832 275
197 3300009177 Ga0105248_10451686 Ga0105248_104516862 275
198 3300017792 Ga0163161_10116403 Ga0163161_101164032 275
199 3300025893 Ga0207682_10001679 Ga0207682_100016796 275
200 3300025918 Ga0207662_10169447 Ga0207662_101694471 275
201 3300025926 Ga0207659_10133381 Ga0207659_101333812 275
202 3300025927 Ga0207687_10234516 Ga0207687_102345162 275
203 3300025935 Ga0207709_10090547 Ga0207709_100905472 275
204 3300025940 Ga0207691_10069279 Ga0207691_100692792 275
205 3300026088 Ga0207641_10457577 Ga0207641_104575772 275
206 3300026116 Ga0207674_10077599 Ga0207674_100775991 275
207 3300026121 Ga0207683_10016755 Ga0207683_100167555 275
208 3300027312 Ga0209371_1000641 Ga0209371_100064128 275
209 3300028577 Ga0265318_10008944 Ga0265318_100089445 275
210 3300041405 Ga0439438_001616 Ga0439438_001616_3060_3887 275
211 3300041407 Ga0439447_012760 Ga0439447_012760_240_1067 275
212 3300041408 Ga0439453_0009513 Ga0439453_0009513_115_945 275
213 3300042006 Ga0439432_023265 Ga0439432_023265_497_1324 275
214 3300042436 Ga0439435_0000301 Ga0439435_0000301_6402_7232 275
215 3300046460 Ga0495638_0063785 Ga0495638_0063785_863_1693 275
216 3300048917 Ga0496114_0210609 Ga0496114_0210609_692_1519 275
217 3300050489 nmdc:mga03683_4957_c1 nmdc:mga03683_4957_c1_2119_2949 275
218 3300050490 nmdc:mga03n38_218873_c1 nmdc:mga03n38_218873_c1_77_907 275
219 3300050491 nmdc:mga00v17_9277_c1 nmdc:mga00v17_9277_c1_2664_3494 275
220 3300050493 nmdc:mga0k408_4641_c1 nmdc:mga0k408_4641_c1_2830_3660 275
221 3300050507 nmdc:mga05p37_1359_c1 nmdc:mga05p37_1359_c1_2598_3428 275
222 3300050508 nmdc:mga09592_492782_c1 nmdc:mga09592_492782_c1_24_854 275
223 3300050509 nmdc:mga0qj67_84578_c1 nmdc:mga0qj67_84578_c1_731_1561 275
224 3300050510 nmdc:mga06r32_206_c1 nmdc:mga06r32_206_c1_23336_24166 275
225 3300050511 nmdc:mga08y16_358_c1 nmdc:mga08y16_358_c1_17070_17900 275
226 3300002987 JGI25159J45721_1023557 JGI25159J45721_10235571 276
227 3300003187 JGI25151J46595_10000314 JGI25151J46595_1000031442 276
228 3300003187 JGI25151J46595_10000438 JGI25151J46595_100004386 276
229 3300003354 JGI25160J50197_1009698 JGI25160J50197_10096983 276
230 3300003911 JGI25405J52794_10007576 JGI25405J52794_100075762 276
231 3300005290 Ga0065712_10107594 Ga0065712_101075942 276
232 3300005341 Ga0070691_10006746 Ga0070691_100067462 276
233 3300005347 Ga0070668_100436013 Ga0070668_1004360131 276
234 3300005441 Ga0070700_100097834 Ga0070700_1000978342 276
235 3300005444 Ga0070694_100019548 Ga0070694_1000195482 276
236 3300005545 Ga0070695_100007461 Ga0070695_1000074615 276
237 3300005843 Ga0068860_100006700 Ga0068860_1000067009 276
238 3300005937 Ga0081455_10001465 Ga0081455_1000146518 276
239 3300005937 Ga0081455_10002502 Ga0081455_1000250214 276
240 3300005983 Ga0081540_1000214 Ga0081540_100021460 276
241 3300005985 Ga0081539_10129129 Ga0081539_101291292 276
242 3300006163 Ga0070715_10020891 Ga0070715_100208912 276
243 3300006844 Ga0075428_100050883 Ga0075428_1000508832 276
244 3300006844 Ga0075428_100187552 Ga0075428_1001875522 276
245 3300006844 Ga0075428_100241504 Ga0075428_1002415042 276
246 3300006871 Ga0075434_100217497 Ga0075434_1002174972 276
247 3300006880 Ga0075429_100238896 Ga0075429_1002388962 276
248 3300009093 Ga0105240_10008886 Ga0105240_100088863 276
249 3300009094 Ga0111539_10004612 Ga0111539_1000461216 276
250 3300009094 Ga0111539_10027010 Ga0111539_100270105 276
251 3300009101 Ga0105247_10051741 Ga0105247_100517412 276
252 3300009147 Ga0114129_10013376 Ga0114129_100133768 276
253 3300009545 Ga0105237_10013270 Ga0105237_100132705 276
254 3300010159 Ga0099796_10043156 Ga0099796_100431562 276
255 3300010375 Ga0105239_10001345 Ga0105239_1000134513 276
256 3300013102 Ga0157371_10014495 Ga0157371_100144954 276
257 3300025272 Ga0209455_1000196 Ga0209455_100019612 276
258 3300025284 Ga0209130_1000300 Ga0209130_100030036 276
259 3300025284 Ga0209130_1001262 Ga0209130_100126210 276
260 3300025294 Ga0209025_1000084 Ga0209025_100008447 276
261 3300025294 Ga0209025_1000456 Ga0209025_100045638 276
262 3300025297 Ga0209758_1003129 Ga0209758_100312916 276
263 3300025298 Ga0209050_1001393 Ga0209050_100139312 276
264 3300025302 Ga0207426_1000088 Ga0207426_1000088238 276
265 3300025302 Ga0207426_1000311 Ga0207426_100031157 276
266 3300025303 Ga0209051_1050702 Ga0209051_10507022 276
267 3300025321 Ga0207656_10071982 Ga0207656_100719822 276
268 3300025905 Ga0207685_10063034 Ga0207685_100630342 276
269 3300025907 Ga0207645_10166539 Ga0207645_101665392 276
270 3300025913 Ga0207695_10022561 Ga0207695_100225614 276
271 3300025914 Ga0207671_10008060 Ga0207671_100080605 276
272 3300025924 Ga0207694_10009781 Ga0207694_100097813 276
273 3300025961 Ga0207712_10226662 Ga0207712_102266622 276
274 3300026075 Ga0207708_10017826 Ga0207708_100178262 276
275 3300027907 Ga0207428_10020069 Ga0207428_100200693 276
276 3300028380 Ga0268265_10063805 Ga0268265_100638052 276
277 3300028381 Ga0268264_10000065 Ga0268264_1000006549 276
278 3300028786 Ga0307517_10000647 Ga0307517_1000064721 276
279 3300028794 Ga0307515_10031808 Ga0307515_100318088 276
280 3300030522 Ga0307512_10143959 Ga0307512_101439591 276
281 3300031251 Ga0265327_10091125 Ga0265327_100911252 276
282 3300031456 Ga0307513_10268241 Ga0307513_102682412 276
283 3300031616 Ga0307508_10065256 Ga0307508_100652562 276
284 3300031731 Ga0307405_10238388 Ga0307405_102383882 276
285 3300031911 Ga0307412_10004051 Ga0307412_100040515 276
286 3300032002 Ga0307416_100144303 Ga0307416_1001443032 276
287 3300033180 Ga0307510_10032459 Ga0307510_100324595 276
288 3300033180 Ga0307510_10124212 Ga0307510_101242122 276
289 3300034820 Ga0373959_0047613 Ga0373959_0047613_64_903 276
290 3300034957 Ga0373938_0004913 Ga0373938_0004913_517_1356 276
291 3300035088 Ga0373940_0001250 Ga0373940_0001250_1864_2703 276
292 3300035090 Ga0373949_0004111 Ga0373949_0004111_1640_2479 276
293 3300035114 Ga0373939_0005271 Ga0373939_0005271_64_903 276
294 3300035114 Ga0373939_0093875 Ga0373939_0093875_132_971 276
295 3300035121 Ga0373960_0003277 Ga0373960_0003277_715_1554 276
296 3300035241 Ga0373961_0026834 Ga0373961_0026834_137_976 276
297 3300035242 Ga0373962_0001494 Ga0373962_0001494_3285_4124 276
298 3300035691 Ga0373931_0001972 Ga0373931_0001972_1680_2519 276
299 3300035691 Ga0373931_0002804 Ga0373931_0002804_2954_3793 276
300 3300037418 Ga0395900_0302318 Ga0395900_0302318_171_1004 276
301 3300037853 Ga0436364_0928272 Ga0436364_0928272_381_1211 276
302 3300039062 Ga0400483_111665 Ga0400483_111665_521_1357 276
303 3300039062 Ga0400483_177699 Ga0400483_177699_679_1515 276
304 3300042146 Ga0450907_012749 Ga0450907_012749_462_1292 276
305 3300045051 Ga0451576_0000647 Ga0451576_0000647_48700_49539 276
306 3300045051 Ga0451576_0223595 Ga0451576_0223595_439_1272 276
307 3300046615 Ga0495656_0018918 Ga0495656_0018918_622_1461 276
308 3300046660 Ga0495625_0183971 Ga0495625_0183971_166_999 276
309 3300046664 Ga0495659_0078062 Ga0495659_0078062_338_1240 276
310 3300048916 Ga0496113_0158073 Ga0496113_0158073_888_1718 276
311 3300048919 Ga0496116_0092009 Ga0496116_0092009_498_1328 276
312 3300048920 Ga0496117_0013931 Ga0496117_0013931_5172_6002 276
313 3300048920 Ga0496117_0182117 Ga0496117_0182117_90_920 276
314 3300048921 Ga0496118_0007345 Ga0496118_0007345_5480_6310 276
315 3300048921 Ga0496118_0022136 Ga0496118_0022136_898_1728 276
316 3300048922 Ga0496119_0002441 Ga0496119_0002441_4246_5076 276
317 3300048922 Ga0496119_0062652 Ga0496119_0062652_22_852 276
318 3300048923 Ga0496120_0002913 Ga0496120_0002913_3170_4000 276
319 3300048924 Ga0496121_0002696 Ga0496121_0002696_14078_14908 276
320 3300048924 Ga0496121_0348973 Ga0496121_0348973_22_852 276
321 3300048925 Ga0496122_0000350 Ga0496122_0000350_36403_37233 276
322 3300048925 Ga0496122_0030340 Ga0496122_0030340_1671_2501 276
323 3300048927 Ga0496124_0129002 Ga0496124_0129002_1054_1884 276
324 3300048927 Ga0496124_0202238 Ga0496124_0202238_593_1423 276
325 3300048928 Ga0496125_0000105 Ga0496125_0000105_144873_145703 276
326 3300048928 Ga0496125_0028051 Ga0496125_0028051_718_1548 276
327 3300048929 Ga0496126_0057559 Ga0496126_0057559_540_1370 276
328 3300048929 Ga0496126_0307287 Ga0496126_0307287_253_1086 276
329 3300049515 Ga0501292_003397 Ga0501292_003397_1007_1837 276
330 3300049572 Ga0501036_0481715 Ga0501036_0481715_184_1017 276
331 3300049574 Ga0501038_0212685 Ga0501038_0212685_633_1466 276
332 3300049581 Ga0501047_0203854 Ga0501047_0203854_530_1363 276
333 3300049586 Ga0501070_0020144 Ga0501070_0020144_2428_3261 276
334 3300049593 Ga0501077_0318010 Ga0501077_0318010_102_935 276
335 3300049742 Ga0501080_0085446 Ga0501080_0085446_611_1480 276
336 3300049823 Ga0501044_0140202 Ga0501044_0140202_1525_2358 276
337 3300050508 nmdc:mga09592_258004_c1 nmdc:mga09592_258004_c1_217_1056 276
338 3300050509 nmdc:mga0qj67_30150_c1 nmdc:mga0qj67_30150_c1_41_880 276
339 3300050510 nmdc:mga06r32_204420_c1 nmdc:mga06r32_204420_c1_701_1540 276
340 3300050511 nmdc:mga08y16_23090_c1 nmdc:mga08y16_23090_c1_3762_4601 276
341 3300050511 nmdc:mga08y16_465607_c1 nmdc:mga08y16_465607_c1_31_870 276
342 3300050512 nmdc:mga0n895_23164_c1 nmdc:mga0n895_23164_c1_4171_5010 276
343 3300050515 nmdc:mga0a205_156676_c1 nmdc:mga0a205_156676_c1_1057_1896 276
344 3300053096 Ga0500641_0001944 Ga0500641_0001944_2266_3099 276
345 3300053130 Ga0500642_0000253 Ga0500642_0000253_4893_5726 276
346 3300053139 Ga0500568_0005052 Ga0500568_0005052_2608_3441 276
347 3300053153 Ga0500616_0002300 Ga0500616_0002300_685_1518 276
348 3300053731 Ga0500609_001794 Ga0500609_001794_1854_2687 276
349 iso_pu_bacteria 2513237088 2513597496 276
350 iso_pu_bacteria 2513237159 2514000621 276
351 iso_pu_bacteria 2791355094 2792642369 276
352 iso_pu_bacteria 2838661181 2838666684 276
353 iso_pu_bacteria 2838661181 2838666728 276
354 iso_pu_bacteria 2842521101 2842526712 276
355 iso_pu_bacteria 2850079185 2850083746 276
356 iso_pu_bacteria 637000159 637080439 276

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09370

PEP_hydrolase

Phosphoenolpyruvate hydrolase-like

8

274

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2p10-assembly1.cif.gz_E crystal structure of a putative phosphonopyruvate hydrolase (mll9387) from mesorhizobium loti maff303099 at 2.15 a resolution 0.9304 3 276
2p10-assembly1.cif.gz_F crystal structure of a putative phosphonopyruvate hydrolase (mll9387) from mesorhizobium loti maff303099 at 2.15 a resolution 0.9296 3 276
2p10-assembly1.cif.gz_D crystal structure of a putative phosphonopyruvate hydrolase (mll9387) from mesorhizobium loti maff303099 at 2.15 a resolution 0.9281 3 276
2p10-assembly1.cif.gz_E crystal structure of a putative phosphonopyruvate hydrolase (mll9387) from mesorhizobium loti maff303099 at 2.15 a resolution 0.9236 3 276
2p10-assembly1.cif.gz_F crystal structure of a putative phosphonopyruvate hydrolase (mll9387) from mesorhizobium loti maff303099 at 2.15 a resolution 0.9227 3 276
ID Description Score Start End Superfamily
2p10E01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9226 3 252 3.20.20.70
2p10E01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9188 3 252 3.20.20.70
af_A0A1D6FD56_1_198_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8982 55 252 3.20.20.70
af_A0A1D6FD56_1_198_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8938 55 252 3.20.20.70
af_A0A1D6MLW1_1_166_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8768 55 218 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A529ZEC0-F1-model_v4 Phosphoenolpyruvate hydrolase family protein 0.9881 71 174 GO:0016787
AF-A0A2N2LLS6-F1-model_v4 TIM-barrel domain-containing protein 0.9659 80 276 GO:0003824
AF-A0A1R0WQ96-F1-model_v4 deleted 0.9622 129 276
AF-A0A3M1H8E0-F1-model_v4 Phosphoenolpyruvate hydrolase family protein 0.9614 88 276 GO:0016787
AF-A0A2N2LLS6-F1-model_v4 TIM-barrel domain-containing protein 0.9611 80 276 GO:0003824

Feature Viewer

pLDDT pTM Quality
85.71 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map