F420551

General Info

Members Datasets Scaffolds Average Seq Length
356 163 712 438

Family's Representative Sequence

Representative Sequence 3300031995|Ga0307409_100043168|Ga0307409_1000431681
Length 499
Sequence MSCCGGLLYCPRRPQRQGPEPISSIPGGWVGARGDVTIPRGWRTWLRPGMHVKRWAALFLFGTVLTGLAVAMGLVYSYRYVAFPEPVSGLVQVFTLQFLPRELRFLIVLSAGIASMVYGLYRFSRELILPVLAHSKANKDLVQIVAEHRFGLSRPEVNVVAIGGGTGLATLLRGLKRHDVSITAIVTVADDGGSTGKIRSAYDIPAPGDIRNCLVALADDESLVSRLFQYRFSQAGSELDGHSFGNLFITALTKVTGSFERAVIESATVLNIRGRVLPSTLENVRLDAELTNGTLIQGESKIQYKEAPIHRVRLSPDDPAAYRPAVTAILNADLIVLGPGSLYTSIVPNLLVPDIARAVRASSAPKVYVMNVATQKGETDHFTALDHLTVVNEQLGPGELDAVLINSNMASAEAIGPDLPIEPLLPDSWDRLDPRIRVIARDVVSEQNPLRHDPEKLATALFELTNGRWREEDHSAENYGHYDDVSARRHELVAAGAGE

Samples

Sample ID Description Type Environment
1 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
5 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
52 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
53 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
58 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
59 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
60 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
85 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
86 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
87 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
88 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
89 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
90 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
91 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
92 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
93 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
94 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
95 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
96 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
97 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
98 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
99 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
100 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
101 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
102 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
103 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
104 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
105 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
106 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
107 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
108 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
109 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
110 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
111 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
112 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
113 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
114 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
115 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
116 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
117 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
118 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
119 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
120 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
121 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
122 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
123 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
124 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
125 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
126 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
127 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
128 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
142 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
143 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
144 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
145 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
146 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
147 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
148 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
149 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
150 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
151 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
152 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
153 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
154 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
155 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
156 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
158 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
159 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
160 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
161 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
162 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
163 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.63
Metatranscriptomes 3.37
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.28
Nodule 0
Rhizoplane 3.09
Rhizosphere 88.48
Stem 0
Stem Tuber 0
Unclassified 5.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307409_100043168 3300031995 Bacteria 3383
2 rootH1_10077951 3300003316 Bacteria 3970
3 rootL2_10022906 3300003322 Bacteria 3756
4 JGI26129J50193_1001021 3300003349 Bacteria 1852
5 Ga0058863_11260267 3300004799 Bacteria 2147
6 Ga0065704_10082959 3300005289 Bacteria 3528
7 Ga0070658_10001611 3300005327 Bacteria 19091
8 Ga0070658_10023324 3300005327 Bacteria 4967
9 Ga0070658_10046968 3300005327 Bacteria 3494
10 Ga0070691_10000762 3300005341 Bacteria 12749
11 Ga0070661_100027561 3300005344 Bacteria 4092
12 Ga0070674_100038142 3300005356 Bacteria 3236
13 Ga0070714_100000701 3300005435 Bacteria 23697
14 Ga0070714_100007566 3300005435 Bacteria 8458
15 Ga0070714_100044362 3300005435 Bacteria 3764
16 Ga0070714_100143712 3300005435 Bacteria 2144
17 Ga0070714_100149927 3300005435 Bacteria 2101
18 Ga0070713_100054426 3300005436 Bacteria 3320
19 Ga0070713_100162712 3300005436 Bacteria 1993
20 Ga0070705_100024934 3300005440 Bacteria 3235
21 Ga0070700_100049337 3300005441 Bacteria 2613
22 Ga0070694_100023640 3300005444 Bacteria 3956
23 Ga0070708_100006935 3300005445 Bacteria 9040
24 Ga0070708_100010438 3300005445 Bacteria 7529
25 Ga0070708_100150922 3300005445 Bacteria 2161
26 Ga0070663_100033027 3300005455 Bacteria 3572
27 Ga0070662_100101303 3300005457 Bacteria 2180
28 Ga0070681_10006747 3300005458 Bacteria 11174
29 Ga0070706_100000154 3300005467 Bacteria 87592
30 Ga0070706_100000175 3300005467 Bacteria 81146
31 Ga0070706_100092497 3300005467 Bacteria 2806
32 Ga0070707_100000187 3300005468 Bacteria 61460
33 Ga0070707_100001091 3300005468 Bacteria 26848
34 Ga0070707_100009491 3300005468 Bacteria 9037
35 Ga0070707_100018318 3300005468 Bacteria 6589
36 Ga0070707_100020282 3300005468 Bacteria 6269
37 Ga0070707_100056480 3300005468 Bacteria 3765
38 Ga0070707_100120966 3300005468 Bacteria 2542
39 Ga0070707_100190807 3300005468 Bacteria 1998
40 Ga0070707_100205460 3300005468 Bacteria 1920
41 Ga0070698_100001001 3300005471 Bacteria 31112
42 Ga0070698_100005996 3300005471 Bacteria 13242
43 Ga0070698_100029879 3300005471 Bacteria 5654
44 Ga0070698_100038812 3300005471 Bacteria 4906
45 Ga0070698_100152637 3300005471 Bacteria 2256
46 Ga0070699_100000037 3300005518 Bacteria 133738
47 Ga0070699_100097738 3300005518 Bacteria 2572
48 Ga0070679_100008410 3300005530 Bacteria 9712
49 Ga0070684_100132382 3300005535 Bacteria 2250
50 Ga0070697_100000036 3300005536 Bacteria 97783
51 Ga0068853_100237266 3300005539 Unclassified 1670
52 Ga0070695_100007239 3300005545 Bacteria 6577
53 Ga0070696_100026431 3300005546 Bacteria 3948
54 Ga0070696_100033855 3300005546 Bacteria 3513
55 Ga0070704_100020366 3300005549 Bacteria 4275
56 Ga0070704_100065151 3300005549 Bacteria 2622
57 Ga0070704_100109355 3300005549 Unclassified 2100
58 Ga0068855_100001469 3300005563 Bacteria 29457
59 Ga0068855_100026447 3300005563 Bacteria 6941
60 Ga0068855_100046893 3300005563 Bacteria 5107
61 Ga0068854_100001453 3300005578 Bacteria 14339
62 Ga0068854_100051625 3300005578 Bacteria 2946
63 Ga0068852_100019149 3300005616 Bacteria 5410
64 Ga0068859_100191783 3300005617 Unclassified 2128
65 Ga0068858_100078999 3300005842 Bacteria 3057
66 Ga0081539_10021402 3300005985 Bacteria 4323
67 Ga0070717_10000271 3300006028 Bacteria 35408
68 Ga0070717_10000391 3300006028 Bacteria 27987
69 Ga0070717_10001308 3300006028 Bacteria 17047
70 Ga0070716_100058805 3300006173 Unclassified 2213
71 Ga0070716_100072346 3300006173 Unclassified 2030
72 Ga0075434_100140706 3300006871 Bacteria 2432
73 Ga0097620_100191774 3300006931 Unclassified 2128
74 Ga0105240_10065318 3300009093 Bacteria 4517
75 Ga0105240_10069722 3300009093 Bacteria 4350
76 Ga0111539_10061942 3300009094 Bacteria 4430
77 Ga0111539_10172900 3300009094 Bacteria 2524
78 Ga0111539_10232659 3300009094 Bacteria 2146
79 Ga0114129_10002316 3300009147 Bacteria 26429
80 Ga0114129_10052053 3300009147 Bacteria 5747
81 Ga0114129_10105351 3300009147 Unclassified 3898
82 Ga0114129_10125944 3300009147 Bacteria 3522
83 Ga0105237_10000024 3300009545 Bacteria 223776
84 Ga0105238_10009420 3300009551 Bacteria 9779
85 Ga0105238_10066946 3300009551 Bacteria 3593
86 Ga0105238_10278392 3300009551 Bacteria 1654
87 Ga0105239_10004901 3300010375 Bacteria 15831
88 Ga0105239_10019836 3300010375 Bacteria 7419
89 Ga0105239_10089538 3300010375 Bacteria 3393
90 Ga0157326_1000160 3300012513 Bacteria 7412
91 Ga0157374_10001596 3300013296 Unclassified 19042
92 Ga0157372_10097461 3300013307 Bacteria 3354
93 Ga0157372_10299917 3300013307 Bacteria 1869
94 Ga0163163_10069283 3300014325 Bacteria 3512
95 Ga0163163_10285614 3300014325 Bacteria 1702
96 Ga0157376_10041477 3300014969 Unclassified 3768
97 Ga0157376_10163715 3300014969 Bacteria 2019
98 Ga0163161_10117005 3300017792 Bacteria 1999
99 Ga0206356_10649002 3300020070 Bacteria 7911
100 Ga0206349_1915144 3300020075 Unclassified 2474
101 Ga0206351_10446154 3300020077 Bacteria 1922
102 Ga0206350_10016567 3300020080 Bacteria 1998
103 Ga0206350_10061372 3300020080 Bacteria 1941
104 Ga0206350_10215050 3300020080 Bacteria 1780
105 Ga0206350_10418322 3300020080 Bacteria 7625
106 Ga0154015_1163128 3300020610 Bacteria 3539
107 Ga0213872_10035463 3300021361 Bacteria 2281
108 Ga0213875_10000001 3300021388 Bacteria 2793540
109 Ga0213875_10000276 3300021388 Bacteria 50734
110 Ga0213875_10001408 3300021388 Bacteria 15656
111 Ga0213875_10002329 3300021388 Bacteria 11491
112 Ga0213875_10050012 3300021388 Bacteria 1959
113 Ga0224712_10007376 3300022467 Bacteria 3200
114 Ga0224712_10018277 3300022467 Bacteria 2340
115 Ga0224712_10023090 3300022467 Bacteria 2155
116 Ga0207688_10054086 3300025901 Bacteria 2252
117 Ga0207705_10001175 3300025909 Bacteria 21261
118 Ga0207705_10110459 3300025909 Bacteria 2031
119 Ga0207684_10000191 3300025910 Bacteria 97670
120 Ga0207684_10000863 3300025910 Bacteria 34662
121 Ga0207707_10037031 3300025912 Bacteria 4263
122 Ga0207695_10071060 3300025913 Bacteria 3555
123 Ga0207671_10000051 3300025914 Bacteria 189023
124 Ga0207660_10057525 3300025917 Bacteria 2785
125 Ga0207646_10000124 3300025922 Bacteria 104800
126 Ga0207646_10000539 3300025922 Bacteria 50068
127 Ga0207646_10005779 3300025922 Bacteria 12951
128 Ga0207646_10006092 3300025922 Bacteria 12563
129 Ga0207646_10065307 3300025922 Unclassified 3249
130 Ga0207646_10103980 3300025922 Bacteria 2547
131 Ga0207646_10117324 3300025922 Bacteria 2390
132 Ga0207646_10125716 3300025922 Bacteria 2306
133 Ga0207694_10020232 3300025924 Bacteria 5032
134 Ga0207694_10166876 3300025924 Bacteria 1781
135 Ga0207687_10071991 3300025927 Bacteria 2471
136 Ga0207700_10042581 3300025928 Bacteria 3330
137 Ga0207700_10104255 3300025928 Bacteria 2269
138 Ga0207664_10000385 3300025929 Bacteria 31939
139 Ga0207664_10000641 3300025929 Bacteria 24306
140 Ga0207664_10006843 3300025929 Bacteria 7879
141 Ga0207664_10151925 3300025929 Bacteria 1968
142 Ga0207670_10083577 3300025936 Unclassified 2240
143 Ga0207669_10062046 3300025937 Bacteria 2300
144 Ga0207665_10001608 3300025939 Bacteria 15233
145 Ga0207665_10073790 3300025939 Bacteria 2334
146 Ga0207667_10001481 3300025949 Bacteria 29471
147 Ga0207667_10003776 3300025949 Bacteria 18657
148 Ga0207667_10004216 3300025949 Bacteria 17647
149 Ga0207667_10026644 3300025949 Bacteria 6309
150 Ga0207667_10178881 3300025949 Bacteria 2179
151 Ga0207640_10002961 3300025981 Bacteria 9144
152 Ga0207703_10061226 3300026035 Bacteria 3081
153 Ga0207678_10051308 3300026067 Bacteria 3561
154 Ga0207708_10078512 3300026075 Bacteria 2535
155 Ga0207683_10198776 3300026121 Bacteria 1822
156 Ga0209998_10000032 3300027717 Bacteria 60084
157 Ga0209974_10005111 3300027876 Bacteria 4633
158 Ga0209974_10038714 3300027876 Bacteria 1585
159 Ga0265356_1000108 3300028017 Bacteria 14178
160 Ga0265326_10013651 3300028558 Unclassified 2372
161 Ga0307515_10000033 3300028794 Bacteria 357826
162 Ga0265338_10003054 3300028800 Bacteria 24069
163 Ga0265338_10165613 3300028800 Unclassified 1702
164 Ga0265330_10016988 3300031235 Bacteria 3355
165 Ga0265332_10005651 3300031238 Bacteria 5749
166 Ga0265325_10000796 3300031241 Bacteria 22783
167 Ga0265329_10015204 3300031242 Bacteria 2693
168 Ga0265339_10006821 3300031249 Bacteria 7444
169 Ga0265339_10007026 3300031249 Bacteria 7309
170 Ga0265316_10000667 3300031344 Bacteria 38241
171 Ga0265316_10001085 3300031344 Bacteria 29460
172 Ga0265316_10011496 3300031344 Bacteria 7977
173 Ga0265316_10015454 3300031344 Bacteria 6675
174 Ga0265313_10000605 3300031595 Bacteria 37349
175 Ga0265313_10001773 3300031595 Bacteria 19769
176 Ga0265342_10002000 3300031712 Bacteria 18159
177 Ga0265342_10013212 3300031712 Bacteria 5552
178 Ga0265342_10015780 3300031712 Bacteria 4958
179 Ga0265342_10043174 3300031712 Bacteria 2722
180 Ga0307413_10108674 3300031824 Bacteria 1852
181 Ga0307413_10121826 3300031824 Bacteria 1768
182 Ga0307416_100024004 3300032002 Bacteria 4440
183 Ga0373931_0002236 3300035691 Bacteria 8557
184 Ga0395900_0020481 3300037418 Bacteria 6751
185 Ga0395900_0031297 3300037418 Bacteria 5466
186 Ga0395900_0041010 3300037418 Unclassified 4773
187 Ga0395898_0004198 3300037466 Bacteria 15795
188 Ga0395898_0008613 3300037466 Bacteria 10764
189 Ga0395905_0001309 3300037471 Bacteria 30592
190 Ga0316581_0006447 3300037588 Bacteria 3109
191 Ga0436364_0028473 3300037853 Bacteria 2331
192 Ga0436364_0079644 3300037853 Bacteria 315114
193 Ga0436364_0156981 3300037853 Bacteria 2069
194 Ga0436364_0206790 3300037853 Bacteria 49437
195 Ga0436364_0273345 3300037853 Bacteria 2794207
196 Ga0436364_0443990 3300037853 Bacteria 8562
197 Ga0436364_0572086 3300037853 Bacteria 20710
198 Ga0436364_0788756 3300037853 Bacteria 5787
199 Ga0436364_1157552 3300037853 Bacteria 4878
200 Ga0436364_1275866 3300037853 Bacteria 11166
201 Ga0400483_054896 3300039062 Bacteria 3614
202 Ga0400483_234863 3300039062 Bacteria 12666
203 Ga0400489_15814 3300039093 Bacteria 16312
204 Ga0436365_0416451 3300039437 Unclassified 2509
205 Ga0436365_0528453 3300039437 Bacteria 6710
206 Ga0436360_0178329 3300039438 Bacteria 4355
207 Ga0436360_0214742 3300039438 Bacteria 9338
208 Ga0436360_0672628 3300039438 Bacteria 7837
209 Ga0436361_0069434 3300039447 Bacteria 5332
210 Ga0436361_0686581 3300039447 Bacteria 65096
211 Ga0436361_0713791 3300039447 Bacteria 2721
212 Ga0436361_0866108 3300039447 Bacteria 2602
213 Ga0436361_0969032 3300039447 Bacteria 3494
214 Ga0436363_0834800 3300039450 Bacteria 9955
215 Ga0436363_0963621 3300039450 Bacteria 1852
216 Ga0436363_1216696 3300039450 Bacteria 4557
217 Ga0436363_1251493 3300039450 Bacteria 2774
218 Ga0436363_1552734 3300039450 Bacteria 35712
219 Ga0436362_0007049 3300039453 Bacteria 1955
220 Ga0436362_0126509 3300039453 Bacteria 12988
221 Ga0436362_0324898 3300039453 Bacteria 2108
222 Ga0436362_1018870 3300039453 Bacteria 1712
223 Ga0436362_1051393 3300039453 Bacteria 4046
224 Ga0450910_006659 3300042147 Bacteria 1600
225 Ga0451577_0050249 3300042876 Bacteria 3723
226 Ga0466966_0014404 3300044684 Bacteria 5235
227 Ga0453684_0002086 3300044712 Bacteria 50721
228 Ga0453684_0019395 3300044712 Bacteria 10356
229 Ga0453684_0022065 3300044712 Bacteria 9469
230 Ga0453684_0038321 3300044712 Bacteria 6556
231 Ga0453684_0114766 3300044712 Bacteria 3265
232 Ga0453684_0246707 3300044712 Bacteria 2053
233 Ga0453684_0351457 3300044712 Bacteria 1662
234 Ga0466957_0009420 3300044842 Bacteria 5577
235 Ga0451576_0008024 3300045051 Bacteria 12464
236 Ga0466958_0012772 3300045836 Unclassified 4764
237 Ga0466967_0004507 3300045976 Bacteria 9413
238 Ga0495604_0053238 3300047317 Bacteria 3130
239 Ga0496102_0176525 3300048905 Bacteria 2012
240 Ga0496104_0091986 3300048907 Bacteria 2900
241 Ga0496104_0111377 3300048907 Bacteria 2624
242 Ga0496104_0290004 3300048907 Bacteria 1549
243 Ga0496109_0052850 3300048912 Bacteria 3704
244 Ga0496109_0251244 3300048912 Bacteria 1665
245 Ga0496110_0078755 3300048913 Bacteria 2934
246 Ga0496111_0055022 3300048914 Bacteria 2878
247 Ga0496113_0096429 3300048916 Bacteria 2287
248 Ga0496114_0023716 3300048917 Bacteria 5008
249 Ga0496114_0084956 3300048917 Bacteria 2680
250 Ga0496126_0000126 3300048929 Bacteria 178383
251 Ga0501031_0002897 3300049568 Bacteria 10965
252 Ga0501033_0036689 3300049570 Bacteria 3672
253 Ga0501034_0080303 3300049571 Bacteria 3265
254 Ga0501034_0143014 3300049571 Bacteria 2371
255 Ga0501036_0002192 3300049572 Bacteria 15255
256 Ga0501036_0004280 3300049572 Bacteria 11525
257 Ga0501036_0021691 3300049572 Bacteria 5399
258 Ga0501036_0180115 3300049572 Unclassified 1779
259 Ga0501037_0065194 3300049573 Bacteria 2654
260 Ga0501038_0097910 3300049574 Bacteria 2446
261 Ga0501039_0000892 3300049575 Bacteria 21736
262 Ga0501039_0023456 3300049575 Bacteria 4736
263 Ga0501039_0029615 3300049575 Bacteria 4216
264 Ga0501040_0000925 3300049576 Bacteria 18442
265 Ga0501040_0001165 3300049576 Bacteria 16711
266 Ga0501040_0006920 3300049576 Bacteria 7343
267 Ga0501040_0009048 3300049576 Bacteria 6479
268 Ga0501041_0002209 3300049577 Bacteria 10998
269 Ga0501041_0003375 3300049577 Bacteria 9186
270 Ga0501041_0034612 3300049577 Bacteria 3058
271 Ga0501041_0056011 3300049577 Bacteria 2408
272 Ga0501042_0004641 3300049578 Bacteria 8768
273 Ga0501042_0014604 3300049578 Bacteria 5363
274 Ga0501042_0027705 3300049578 Bacteria 3985
275 Ga0501043_0031139 3300049579 Bacteria 4195
276 Ga0501046_0012974 3300049580 Bacteria 7079
277 Ga0501046_0033242 3300049580 Bacteria 4169
278 Ga0501048_0000788 3300049582 Bacteria 23220
279 Ga0501048_0018028 3300049582 Bacteria 5195
280 Ga0501048_0030238 3300049582 Bacteria 3918
281 Ga0501067_0002614 3300049583 Bacteria 9970
282 Ga0501068_0005791 3300049584 Bacteria 6778
283 Ga0501068_0061035 3300049584 Bacteria 2290
284 Ga0501069_0009373 3300049585 Bacteria 5168
285 Ga0501069_0027770 3300049585 Bacteria 3102
286 Ga0501069_0101346 3300049585 Bacteria 1635
287 Ga0501070_0137751 3300049586 Bacteria 2015
288 Ga0501070_0177798 3300049586 Bacteria 1752
289 Ga0501071_0000274 3300049587 Bacteria 24408
290 Ga0501071_0002462 3300049587 Bacteria 11243
291 Ga0501071_0003973 3300049587 Bacteria 9329
292 Ga0501071_0149024 3300049587 Bacteria 1745
293 Ga0501072_0002441 3300049588 Bacteria 13924
294 Ga0501072_0003420 3300049588 Bacteria 11957
295 Ga0501072_0014251 3300049588 Bacteria 6091
296 Ga0501072_0021061 3300049588 Bacteria 5057
297 Ga0501072_0216854 3300049588 Bacteria 1525
298 Ga0501073_0006874 3300049589 Bacteria 8464
299 Ga0501073_0038734 3300049589 Bacteria 3380
300 Ga0501074_0001964 3300049590 Bacteria 14131
301 Ga0501074_0009629 3300049590 Bacteria 7012
302 Ga0501074_0010170 3300049590 Bacteria 6829
303 Ga0501074_0033610 3300049590 Bacteria 3717
304 Ga0501075_0001162 3300049591 Bacteria 17032
305 Ga0501075_0006675 3300049591 Bacteria 7959
306 Ga0501075_0007830 3300049591 Bacteria 7420
307 Ga0501075_0009484 3300049591 Bacteria 6810
308 Ga0501075_0067241 3300049591 Bacteria 2706
309 Ga0501075_0157437 3300049591 Bacteria 1732
310 Ga0501076_0002861 3300049592 Bacteria 11943
311 Ga0501076_0007556 3300049592 Bacteria 7912
312 Ga0501076_0008316 3300049592 Bacteria 7604
313 Ga0501076_0079221 3300049592 Bacteria 2637
314 Ga0501076_0113569 3300049592 Bacteria 2191
315 Ga0501077_0001107 3300049593 Bacteria 16259
316 Ga0501077_0006213 3300049593 Bacteria 7299
317 Ga0501077_0011957 3300049593 Bacteria 5430
318 Ga0501079_0002761 3300049741 Bacteria 12803
319 Ga0501079_0004253 3300049741 Bacteria 10618
320 Ga0501080_0013864 3300049742 Bacteria 7419
321 Ga0501080_0037531 3300049742 Bacteria 4526
322 Ga0501080_0082766 3300049742 Bacteria 2981
323 Ga0501081_0001873 3300049743 Bacteria 13074
324 Ga0501081_0001905 3300049743 Bacteria 12941
325 Ga0501081_0003900 3300049743 Bacteria 9553
326 Ga0501081_0008555 3300049743 Bacteria 6650
327 Ga0501081_0028363 3300049743 Bacteria 3778
328 Ga0501083_0029048 3300049744 Bacteria 3807
329 Ga0501035_0007516 3300049822 Bacteria 10181
330 Ga0501035_0011901 3300049822 Bacteria 8052
331 Ga0501045_0001054 3300049824 Bacteria 18166
332 Ga0501045_0002135 3300049824 Bacteria 13392
333 Ga0501045_0008937 3300049824 Bacteria 6997
334 Ga0501045_0046145 3300049824 Bacteria 3173
335 nmdc:mga05p37_140549_c1 3300050507 Unclassified 2958
336 nmdc:mga05p37_339582_c1 3300050507 Bacteria 1771
337 nmdc:mga05p37_536843_c1 3300050507 Bacteria 1334
338 nmdc:mga05p37_7284_c1 3300050507 Bacteria 13052
339 Ga0495595_0030459 3300053084 Bacteria 2421
340 Ga0500608_001576 3300053122 Bacteria 8181
341 Ga0501084_0005650 3300054114 Bacteria 10268
342 Ga0501084_0009945 3300054114 Bacteria 7863
343 Ga0501084_0012044 3300054114 Bacteria 7162
344 Ga0501084_0013948 3300054114 Bacteria 6651
345 Ga0501084_0017185 3300054114 Bacteria 6010
346 Ga0501082_0004219 3300060353 Bacteria 12558
347 Ga0501082_0008875 3300060353 Bacteria 8671
348 Ga0501082_0122055 3300060353 Bacteria 2259
349 Ga0501082_0139036 3300060353 Bacteria 2108
350 Ga0530510_0000701 3300061734 Bacteria 21725
351 Ga0530510_0002987 3300061734 Bacteria 11597
352 Ga0530510_0005660 3300061734 Bacteria 8661
353 Ga0530510_0015352 3300061734 Bacteria 5412
354 Ga0530510_0041557 3300061734 Bacteria 3320
355 Ga0530510_0062049 3300061734 Bacteria 2706
356 Ga0530510_0208532 3300061734 Bacteria 1452
357 Ga0307409_100043168
358 rootH1_10077951
359 rootL2_10022906
360 JGI26129J50193_1001021
361 Ga0058863_11260267
362 Ga0065704_10082959
363 Ga0070658_10001611
364 Ga0070658_10023324
365 Ga0070658_10046968
366 Ga0070691_10000762
367 Ga0070661_100027561
368 Ga0070674_100038142
369 Ga0070714_100000701
370 Ga0070714_100007566
371 Ga0070714_100044362
372 Ga0070714_100143712
373 Ga0070714_100149927
374 Ga0070713_100054426
375 Ga0070713_100162712
376 Ga0070705_100024934
377 Ga0070700_100049337
378 Ga0070694_100023640
379 Ga0070708_100006935
380 Ga0070708_100010438
381 Ga0070708_100150922
382 Ga0070663_100033027
383 Ga0070662_100101303
384 Ga0070681_10006747
385 Ga0070706_100000154
386 Ga0070706_100000175
387 Ga0070706_100092497
388 Ga0070707_100000187
389 Ga0070707_100001091
390 Ga0070707_100009491
391 Ga0070707_100018318
392 Ga0070707_100020282
393 Ga0070707_100056480
394 Ga0070707_100120966
395 Ga0070707_100190807
396 Ga0070707_100205460
397 Ga0070698_100001001
398 Ga0070698_100005996
399 Ga0070698_100029879
400 Ga0070698_100038812
401 Ga0070698_100152637
402 Ga0070699_100000037
403 Ga0070699_100097738
404 Ga0070679_100008410
405 Ga0070684_100132382
406 Ga0070697_100000036
407 Ga0068853_100237266
408 Ga0070695_100007239
409 Ga0070696_100026431
410 Ga0070696_100033855
411 Ga0070704_100020366
412 Ga0070704_100065151
413 Ga0070704_100109355
414 Ga0068855_100001469
415 Ga0068855_100026447
416 Ga0068855_100046893
417 Ga0068854_100001453
418 Ga0068854_100051625
419 Ga0068852_100019149
420 Ga0068859_100191783
421 Ga0068858_100078999
422 Ga0081539_10021402
423 Ga0070717_10000271
424 Ga0070717_10000391
425 Ga0070717_10001308
426 Ga0070716_100058805
427 Ga0070716_100072346
428 Ga0075434_100140706
429 Ga0097620_100191774
430 Ga0105240_10065318
431 Ga0105240_10069722
432 Ga0111539_10061942
433 Ga0111539_10172900
434 Ga0111539_10232659
435 Ga0114129_10002316
436 Ga0114129_10052053
437 Ga0114129_10105351
438 Ga0114129_10125944
439 Ga0105237_10000024
440 Ga0105238_10009420
441 Ga0105238_10066946
442 Ga0105238_10278392
443 Ga0105239_10004901
444 Ga0105239_10019836
445 Ga0105239_10089538
446 Ga0157326_1000160
447 Ga0157374_10001596
448 Ga0157372_10097461
449 Ga0157372_10299917
450 Ga0163163_10069283
451 Ga0163163_10285614
452 Ga0157376_10041477
453 Ga0157376_10163715
454 Ga0163161_10117005
455 Ga0206356_10649002
456 Ga0206349_1915144
457 Ga0206351_10446154
458 Ga0206350_10016567
459 Ga0206350_10061372
460 Ga0206350_10215050
461 Ga0206350_10418322
462 Ga0154015_1163128
463 Ga0213872_10035463
464 Ga0213875_10000001
465 Ga0213875_10000276
466 Ga0213875_10001408
467 Ga0213875_10002329
468 Ga0213875_10050012
469 Ga0224712_10007376
470 Ga0224712_10018277
471 Ga0224712_10023090
472 Ga0207688_10054086
473 Ga0207705_10001175
474 Ga0207705_10110459
475 Ga0207684_10000191
476 Ga0207684_10000863
477 Ga0207707_10037031
478 Ga0207695_10071060
479 Ga0207671_10000051
480 Ga0207660_10057525
481 Ga0207646_10000124
482 Ga0207646_10000539
483 Ga0207646_10005779
484 Ga0207646_10006092
485 Ga0207646_10065307
486 Ga0207646_10103980
487 Ga0207646_10117324
488 Ga0207646_10125716
489 Ga0207694_10020232
490 Ga0207694_10166876
491 Ga0207687_10071991
492 Ga0207700_10042581
493 Ga0207700_10104255
494 Ga0207664_10000385
495 Ga0207664_10000641
496 Ga0207664_10006843
497 Ga0207664_10151925
498 Ga0207670_10083577
499 Ga0207669_10062046
500 Ga0207665_10001608
501 Ga0207665_10073790
502 Ga0207667_10001481
503 Ga0207667_10003776
504 Ga0207667_10004216
505 Ga0207667_10026644
506 Ga0207667_10178881
507 Ga0207640_10002961
508 Ga0207703_10061226
509 Ga0207678_10051308
510 Ga0207708_10078512
511 Ga0207683_10198776
512 Ga0209998_10000032
513 Ga0209974_10005111
514 Ga0209974_10038714
515 Ga0265356_1000108
516 Ga0265326_10013651
517 Ga0307515_10000033
518 Ga0265338_10003054
519 Ga0265338_10165613
520 Ga0265330_10016988
521 Ga0265332_10005651
522 Ga0265325_10000796
523 Ga0265329_10015204
524 Ga0265339_10006821
525 Ga0265339_10007026
526 Ga0265316_10000667
527 Ga0265316_10001085
528 Ga0265316_10011496
529 Ga0265316_10015454
530 Ga0265313_10000605
531 Ga0265313_10001773
532 Ga0265342_10002000
533 Ga0265342_10013212
534 Ga0265342_10015780
535 Ga0265342_10043174
536 Ga0307413_10108674
537 Ga0307413_10121826
538 Ga0307416_100024004
539 Ga0373931_0002236
540 Ga0395900_0020481
541 Ga0395900_0031297
542 Ga0395900_0041010
543 Ga0395898_0004198
544 Ga0395898_0008613
545 Ga0395905_0001309
546 Ga0316581_0006447
547 Ga0436364_0028473
548 Ga0436364_0079644
549 Ga0436364_0156981
550 Ga0436364_0206790
551 Ga0436364_0273345
552 Ga0436364_0443990
553 Ga0436364_0572086
554 Ga0436364_0788756
555 Ga0436364_1157552
556 Ga0436364_1275866
557 Ga0400483_054896
558 Ga0400483_234863
559 Ga0400489_15814
560 Ga0436365_0416451
561 Ga0436365_0528453
562 Ga0436360_0178329
563 Ga0436360_0214742
564 Ga0436360_0672628
565 Ga0436361_0069434
566 Ga0436361_0686581
567 Ga0436361_0713791
568 Ga0436361_0866108
569 Ga0436361_0969032
570 Ga0436363_0834800
571 Ga0436363_0963621
572 Ga0436363_1216696
573 Ga0436363_1251493
574 Ga0436363_1552734
575 Ga0436362_0007049
576 Ga0436362_0126509
577 Ga0436362_0324898
578 Ga0436362_1018870
579 Ga0436362_1051393
580 Ga0450910_006659
581 Ga0451577_0050249
582 Ga0466966_0014404
583 Ga0453684_0002086
584 Ga0453684_0019395
585 Ga0453684_0022065
586 Ga0453684_0038321
587 Ga0453684_0114766
588 Ga0453684_0246707
589 Ga0453684_0351457
590 Ga0466957_0009420
591 Ga0451576_0008024
592 Ga0466958_0012772
593 Ga0466967_0004507
594 Ga0495604_0053238
595 Ga0496102_0176525
596 Ga0496104_0091986
597 Ga0496104_0111377
598 Ga0496104_0290004
599 Ga0496109_0052850
600 Ga0496109_0251244
601 Ga0496110_0078755
602 Ga0496111_0055022
603 Ga0496113_0096429
604 Ga0496114_0023716
605 Ga0496114_0084956
606 Ga0496126_0000126
607 Ga0501031_0002897
608 Ga0501033_0036689
609 Ga0501034_0080303
610 Ga0501034_0143014
611 Ga0501036_0002192
612 Ga0501036_0004280
613 Ga0501036_0021691
614 Ga0501036_0180115
615 Ga0501037_0065194
616 Ga0501038_0097910
617 Ga0501039_0000892
618 Ga0501039_0023456
619 Ga0501039_0029615
620 Ga0501040_0000925
621 Ga0501040_0001165
622 Ga0501040_0006920
623 Ga0501040_0009048
624 Ga0501041_0002209
625 Ga0501041_0003375
626 Ga0501041_0034612
627 Ga0501041_0056011
628 Ga0501042_0004641
629 Ga0501042_0014604
630 Ga0501042_0027705
631 Ga0501043_0031139
632 Ga0501046_0012974
633 Ga0501046_0033242
634 Ga0501048_0000788
635 Ga0501048_0018028
636 Ga0501048_0030238
637 Ga0501067_0002614
638 Ga0501068_0005791
639 Ga0501068_0061035
640 Ga0501069_0009373
641 Ga0501069_0027770
642 Ga0501069_0101346
643 Ga0501070_0137751
644 Ga0501070_0177798
645 Ga0501071_0000274
646 Ga0501071_0002462
647 Ga0501071_0003973
648 Ga0501071_0149024
649 Ga0501072_0002441
650 Ga0501072_0003420
651 Ga0501072_0014251
652 Ga0501072_0021061
653 Ga0501072_0216854
654 Ga0501073_0006874
655 Ga0501073_0038734
656 Ga0501074_0001964
657 Ga0501074_0009629
658 Ga0501074_0010170
659 Ga0501074_0033610
660 Ga0501075_0001162
661 Ga0501075_0006675
662 Ga0501075_0007830
663 Ga0501075_0009484
664 Ga0501075_0067241
665 Ga0501075_0157437
666 Ga0501076_0002861
667 Ga0501076_0007556
668 Ga0501076_0008316
669 Ga0501076_0079221
670 Ga0501076_0113569
671 Ga0501077_0001107
672 Ga0501077_0006213
673 Ga0501077_0011957
674 Ga0501079_0002761
675 Ga0501079_0004253
676 Ga0501080_0013864
677 Ga0501080_0037531
678 Ga0501080_0082766
679 Ga0501081_0001873
680 Ga0501081_0001905
681 Ga0501081_0003900
682 Ga0501081_0008555
683 Ga0501081_0028363
684 Ga0501083_0029048
685 Ga0501035_0007516
686 Ga0501035_0011901
687 Ga0501045_0001054
688 Ga0501045_0002135
689 Ga0501045_0008937
690 Ga0501045_0046145
691 nmdc:mga05p37_140549_c1
692 nmdc:mga05p37_339582_c1
693 nmdc:mga05p37_536843_c1
694 nmdc:mga05p37_7284_c1
695 Ga0495595_0030459
696 Ga0500608_001576
697 Ga0501084_0005650
698 Ga0501084_0009945
699 Ga0501084_0012044
700 Ga0501084_0013948
701 Ga0501084_0017185
702 Ga0501082_0004219
703 Ga0501082_0008875
704 Ga0501082_0122055
705 Ga0501082_0139036
706 Ga0530510_0000701
707 Ga0530510_0002987
708 Ga0530510_0005660
709 Ga0530510_0015352
710 Ga0530510_0041557
711 Ga0530510_0062049
712 Ga0530510_0208532

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01933

CofD

2-phospho-L-lactate transferase CofD

159

444

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2o2z-assembly1.cif.gz_B crystal structure of a protein member of the upf0052 family (bh3568) from bacillus halodurans at 2.60 a resolution 0.9325 112 413
2o2z-assembly2.cif.gz_C crystal structure of a protein member of the upf0052 family (bh3568) from bacillus halodurans at 2.60 a resolution 0.9311 112 413
2o2z-assembly1.cif.gz_A crystal structure of a protein member of the upf0052 family (bh3568) from bacillus halodurans at 2.60 a resolution 0.9304 111 413
2o2z-assembly2.cif.gz_D crystal structure of a protein member of the upf0052 family (bh3568) from bacillus halodurans at 2.60 a resolution 0.9259 112 413
2hzb-assembly2.cif.gz_D x-ray crystal structure of protein bh3568 from bacillus halodurans. northeast structural genomics consortium bhr60. 0.9233 111 413
ID Description Score Start End Superfamily
af_P75767_9_300_3.40.50.10680 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;CofD-like domains 0.92 111 417 3.40.50.10680
af_P75767_9_300_3.40.50.10680 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;CofD-like domains 0.911 111 417 3.40.50.10680
af_P9WMU5_2_314_3.40.50.10680 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;CofD-like domains 0.9059 111 416 3.40.50.10680
2ppvA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;CofD-like domains 0.8931 111 418 3.40.50.10680
af_P9WMU5_2_314_3.40.50.10680 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;CofD-like domains 0.8834 111 416 3.40.50.10680
ID Description Score Start End GO Terms
AF-A0A7V9ZKT8-F1-model_v4 YvcK family protein 0.9713 112 358 GO:0005737
GO:0043743
AF-A0A800F734-F1-model_v4 YvcK family protein 0.9682 110 356 GO:0005737
GO:0043743
AF-A0A2V9ZHH1-F1-model_v4 YvcK family protein 0.9682 111 361 GO:0005737
GO:0043743
AF-A0A5N9CAI1-F1-model_v4 Putative gluconeogenesis factor 0.9664 109 420 GO:0005737
GO:0008360
GO:0043743
AF-A0A2G6R5D0-F1-model_v4 Uridine diphosphate-N-acetylglucosamine-binding protein YvcK 0.9657 108 330 GO:0005737
GO:0043743

Map