F420439

General Info

Members Datasets Scaffolds Average Seq Length
356 219 712 200

Family's Representative Sequence

Representative Sequence 3300005549|Ga0070704_100325459|Ga0070704_1003254592
Length 241
Sequence LRESSTSAFRAKQGAEASKAALSYPSPIDPSPSNRLVRFVRARRGSVFELVFIVVCAIGLALAIQSWAVKPYQIPSASMEPTLDIGQRVLVDRISYRFSDPQIGDIVVFHPPDGADSERCGVPHAGEGTLRACPKPVPQESGTNFIKRIVAGPGDRLYIKDGHPVVNGVMAKEPFINPCGGGPGPPCNMPRSITIPPNEYFVMGDNRGASDDSRFWGPVPRSWIIGEAFATYWPPDRAGFF

Samples

Sample ID Description Type Environment
1 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
45 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
121 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
122 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
123 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
124 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
125 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
126 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
127 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
128 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
129 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
130 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
132 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
133 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
134 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
135 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
136 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
137 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
138 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
139 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
140 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
141 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
142 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
143 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
144 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
145 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
146 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
147 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
148 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
149 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
150 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
151 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
152 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
153 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
154 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
155 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
156 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
157 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
158 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
159 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
160 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
161 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
162 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
163 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
164 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
165 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
166 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
167 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
168 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
169 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
170 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
171 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
172 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
173 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
174 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
175 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
176 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
177 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
178 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
179 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
193 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
194 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
195 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
196 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
197 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
198 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
199 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
200 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
201 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
202 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
205 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
206 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
207 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
208 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
209 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
210 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
211 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
212 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
213 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
214 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
215 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
216 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
217 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
218 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
219 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.78
Nodule 0
Rhizoplane 10.39
Rhizosphere 80.62
Stem 0
Stem Tuber 0
Unclassified 2.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070704_100325459 3300005549 Bacteria 1289
2 JGI25407J50210_10047858 3300003373 Bacteria 1086
3 JGI25404J52841_10014923 3300003659 Bacteria 1686
4 Ga0070658_10006969 3300005327 Bacteria 9129
5 Ga0070683_100080980 3300005329 Bacteria 3039
6 Ga0070683_100852554 3300005329 Bacteria 874
7 Ga0070682_100005857 3300005337 Bacteria 6868
8 Ga0070682_100016981 3300005337 Bacteria 4238
9 Ga0068868_100010911 3300005338 Bacteria 6594
10 Ga0070660_100000714 3300005339 Bacteria 21981
11 Ga0070660_100430482 3300005339 Bacteria 1093
12 Ga0070691_10076119 3300005341 Bacteria 1635
13 Ga0070692_10009186 3300005345 Bacteria 4447
14 Ga0070692_10112253 3300005345 Bacteria 1509
15 Ga0070668_100317277 3300005347 Unclassified 1311
16 Ga0070668_100604168 3300005347 Unclassified 960
17 Ga0070675_100058809 3300005354 Bacteria 3171
18 Ga0070674_100005526 3300005356 Bacteria 7309
19 Ga0070674_100031250 3300005356 Bacteria 3527
20 Ga0070673_100127536 3300005364 Bacteria 2131
21 Ga0070673_100305384 3300005364 Bacteria 1402
22 Ga0070659_100000026 3300005366 Bacteria 143542
23 Ga0070659_100002224 3300005366 Bacteria 13793
24 Ga0070667_100477165 3300005367 Bacteria 1141
25 Ga0070714_100015593 3300005435 Bacteria 6114
26 Ga0070714_100147418 3300005435 Bacteria 2118
27 Ga0070701_10501431 3300005438 Bacteria 788
28 Ga0070711_100149994 3300005439 Bacteria 1757
29 Ga0070705_100007653 3300005440 Bacteria 5329
30 Ga0070705_100646565 3300005440 Bacteria 824
31 Ga0070694_100086422 3300005444 Bacteria 2192
32 Ga0070694_100183972 3300005444 Bacteria 1547
33 Ga0070663_100004978 3300005455 Bacteria 7846
34 Ga0070678_100005948 3300005456 Bacteria 7101
35 Ga0070662_100012570 3300005457 Bacteria 5616
36 Ga0068867_100021921 3300005459 Bacteria 4562
37 Ga0068867_100375913 3300005459 Plasmid 1192
38 Ga0070685_10030678 3300005466 Bacteria 2998
39 Ga0070707_100553790 3300005468 Bacteria 1112
40 Ga0070679_101065736 3300005530 Bacteria 753
41 Ga0070684_100006942 3300005535 Bacteria 8793
42 Ga0070684_100739470 3300005535 Unclassified 918
43 Ga0070697_100293850 3300005536 Bacteria 1396
44 Ga0070686_100014002 3300005544 Bacteria 4609
45 Ga0070686_100060606 3300005544 Bacteria 2442
46 Ga0070696_100304861 3300005546 Unclassified 1221
47 Ga0070693_100455152 3300005547 Bacteria 899
48 Ga0070704_100038298 3300005549 Bacteria 3283
49 Ga0068855_100379563 3300005563 Bacteria 1552
50 Ga0070664_100004969 3300005564 Bacteria 10652
51 Ga0068857_100165711 3300005577 Bacteria 2007
52 Ga0068854_100018281 3300005578 Bacteria 4703
53 Ga0068852_100620496 3300005616 Unclassified 1087
54 Ga0068864_100652492 3300005618 Bacteria 1025
55 Ga0068866_10067925 3300005718 Bacteria 1873
56 Ga0068861_100147241 3300005719 Bacteria 1928
57 Ga0068858_100091526 3300005842 Bacteria 2831
58 Ga0081455_10001214 3300005937 Bacteria 32286
59 Ga0081455_10011379 3300005937 Bacteria 8944
60 Ga0081455_10017819 3300005937 Bacteria 6790
61 Ga0081538_10001077 3300005981 Bacteria 29016
62 Ga0081538_10021417 3300005981 Bacteria 4719
63 Ga0081538_10086705 3300005981 Bacteria 1638
64 Ga0081540_1000210 3300005983 Bacteria 61367
65 Ga0081540_1001577 3300005983 Bacteria 19486
66 Ga0081540_1162536 3300005983 Bacteria 864
67 Ga0081539_10004833 3300005985 Bacteria 14442
68 Ga0081539_10009885 3300005985 Bacteria 7868
69 Ga0081539_10013497 3300005985 Bacteria 6149
70 Ga0070717_10000004 3300006028 Bacteria 365525
71 Ga0075365_10000776 3300006038 Bacteria 13018
72 Ga0075365_10002071 3300006038 Bacteria 9569
73 Ga0075365_10096271 3300006038 Bacteria 2022
74 Ga0075365_10096289 3300006038 Bacteria 2022
75 Ga0075365_10279255 3300006038 Bacteria 1175
76 Ga0075363_100009053 3300006048 Bacteria 4671
77 Ga0075364_10067989 3300006051 Bacteria 2343
78 Ga0075364_10190505 3300006051 Bacteria 1389
79 Ga0075364_10563660 3300006051 Bacteria 778
80 Ga0070712_100035055 3300006175 Bacteria 3404
81 Ga0075367_10265050 3300006178 Bacteria 1079
82 Ga0075428_100227349 3300006844 Bacteria 2014
83 Ga0075428_100806491 3300006844 Bacteria 998
84 Ga0075430_100015795 3300006846 Bacteria 6429
85 Ga0075431_100050002 3300006847 Bacteria 4310
86 Ga0075433_10077443 3300006852 Bacteria 2929
87 Ga0075433_10393420 3300006852 Bacteria 1223
88 Ga0075433_10719201 3300006852 Bacteria 874
89 Ga0075434_100021980 3300006871 Bacteria 6209
90 Ga0075434_100135393 3300006871 Bacteria 2483
91 Ga0075429_100003389 3300006880 Bacteria 13589
92 Ga0075429_100050759 3300006880 Bacteria 3609
93 Ga0068865_100004299 3300006881 Bacteria 8599
94 Ga0068865_100331044 3300006881 Bacteria 1228
95 Ga0075436_100360221 3300006914 Bacteria 1049
96 Ga0105240_10137475 3300009093 Bacteria 2925
97 Ga0105245_10007888 3300009098 Bacteria 9311
98 Ga0105245_10008770 3300009098 Bacteria 8820
99 Ga0105245_10728960 3300009098 Bacteria 1026
100 Ga0114129_10005552 3300009147 Bacteria 17840
101 Ga0114129_10114072 3300009147 Bacteria 3726
102 Ga0105243_10002090 3300009148 Bacteria 16915
103 Ga0105243_10032226 3300009148 Bacteria 4048
104 Ga0105243_10114058 3300009148 Bacteria 2267
105 Ga0105242_10151548 3300009176 Bacteria 2022
106 Ga0105248_10152790 3300009177 Bacteria 2605
107 Ga0105248_11965072 3300009177 Bacteria 664
108 Ga0105237_10182912 3300009545 Bacteria 2096
109 Ga0105237_10604611 3300009545 Bacteria 1103
110 Ga0105238_11569219 3300009551 Bacteria 688
111 Ga0105249_10007516 3300009553 Bacteria 9505
112 Ga0105249_11287946 3300009553 Bacteria 802
113 Ga0105239_10037505 3300010375 Bacteria 5311
114 Ga0105239_10056534 3300010375 Bacteria 4304
115 Ga0105239_10081309 3300010375 Bacteria 3566
116 Ga0105239_10860617 3300010375 Unclassified 1040
117 Ga0105246_10036422 3300011119 Bacteria 3296
118 Ga0157374_10869234 3300013296 Bacteria 919
119 Ga0157378_10476956 3300013297 Bacteria 1242
120 Ga0157378_10981046 3300013297 Bacteria 878
121 Ga0163162_10717784 3300013306 Bacteria 1120
122 Ga0163162_11012665 3300013306 Bacteria 939
123 Ga0157372_10421913 3300013307 Unclassified 1555
124 Ga0157372_10551833 3300013307 Bacteria 1343
125 Ga0157375_10031787 3300013308 Bacteria 4997
126 Ga0157375_10046568 3300013308 Bacteria 4230
127 Ga0163163_10014590 3300014325 Bacteria 7227
128 Ga0163163_10748598 3300014325 Bacteria 1041
129 Ga0157377_10017459 3300014745 Bacteria 3712
130 Ga0157379_10085420 3300014968 Bacteria 2828
131 Ga0157376_10040238 3300014969 Bacteria 3819
132 Ga0157376_10141405 3300014969 Bacteria 2160
133 Ga0163161_10276101 3300017792 Bacteria 1317
134 Ga0207656_10071793 3300025321 Bacteria 1540
135 Ga0207642_10060762 3300025899 Bacteria 1754
136 Ga0207688_10008092 3300025901 Bacteria 5718
137 Ga0207688_10009177 3300025901 Bacteria 5388
138 Ga0207645_10493310 3300025907 Bacteria 829
139 Ga0207684_10233198 3300025910 Bacteria 1588
140 Ga0207707_10132919 3300025912 Bacteria 2176
141 Ga0207693_10002026 3300025915 Bacteria 17777
142 Ga0207663_10100012 3300025916 Bacteria 1945
143 Ga0207657_10001043 3300025919 Bacteria 29329
144 Ga0207657_10067305 3300025919 Bacteria 3046
145 Ga0207649_10522080 3300025920 Bacteria 905
146 Ga0207646_10390409 3300025922 Bacteria 1257
147 Ga0207687_10020712 3300025927 Bacteria 4363
148 Ga0207687_10037550 3300025927 Bacteria 3305
149 Ga0207664_10015840 3300025929 Bacteria 5487
150 Ga0207664_10057678 3300025929 Bacteria 3087
151 Ga0207644_10125922 3300025931 Bacteria 1956
152 Ga0207690_10000098 3300025932 Bacteria 71853
153 Ga0207690_10124068 3300025932 Bacteria 1880
154 Ga0207706_10047311 3300025933 Bacteria 3806
155 Ga0207706_10455677 3300025933 Bacteria 1106
156 Ga0207709_10035821 3300025935 Bacteria 2937
157 Ga0207709_10091509 3300025935 Bacteria 1989
158 Ga0207709_10129166 3300025935 Bacteria 1719
159 Ga0207670_10021246 3300025936 Bacteria 4002
160 Ga0207669_10003891 3300025937 Bacteria 6514
161 Ga0207669_10006622 3300025937 Bacteria 5310
162 Ga0207704_10015525 3300025938 Bacteria 3883
163 Ga0207704_10361471 3300025938 Bacteria 1133
164 Ga0207665_10026653 3300025939 Bacteria 3816
165 Ga0207691_10034029 3300025940 Bacteria 4742
166 Ga0207711_10696915 3300025941 Bacteria 947
167 Ga0207661_10016043 3300025944 Bacteria 5522
168 Ga0207661_10710393 3300025944 Bacteria 925
169 Ga0207679_10075028 3300025945 Bacteria 2565
170 Ga0207651_10121032 3300025960 Bacteria 1985
171 Ga0207651_10233291 3300025960 Bacteria 1495
172 Ga0207712_10011354 3300025961 Bacteria 5674
173 Ga0207712_10060793 3300025961 Bacteria 2679
174 Ga0207668_10056623 3300025972 Bacteria 2731
175 Ga0207640_10072431 3300025981 Bacteria 2324
176 Ga0207677_10056038 3300026023 Bacteria 2698
177 Ga0207703_10102969 3300026035 Bacteria 2423
178 Ga0207703_10220058 3300026035 Bacteria 1697
179 Ga0207678_10003425 3300026067 Bacteria 14285
180 Ga0207702_10404861 3300026078 Bacteria 1316
181 Ga0207702_10521203 3300026078 Bacteria 1160
182 Ga0207648_10426161 3300026089 Plasmid 1205
183 Ga0207676_10364763 3300026095 Bacteria 1340
184 Ga0207674_10370329 3300026116 Bacteria 1385
185 Ga0207675_100670702 3300026118 Bacteria 1044
186 Ga0207683_10031184 3300026121 Bacteria 4626
187 Ga0207428_10123064 3300027907 Bacteria 1988
188 Ga0265319_1000118 3300028563 Bacteria 60393
189 Ga0307408_100273411 3300031548 Bacteria 1404
190 Ga0307410_10532084 3300031852 Bacteria 971
191 Ga0307410_10549127 3300031852 Bacteria 957
192 Ga0307406_10052281 3300031901 Bacteria 2598
193 Ga0307406_10529573 3300031901 Bacteria 960
194 Ga0307409_100039958 3300031995 Bacteria 3487
195 Ga0307409_100504578 3300031995 Bacteria 1179
196 Ga0307409_100550065 3300031995 Bacteria 1133
197 Ga0307416_100074034 3300032002 Bacteria 2843
198 Ga0307415_100004401 3300032126 Bacteria 7304
199 Ga0373932_0158643 3300035112 Bacteria 781
200 Ga0373943_0049213 3300035170 Bacteria 2068
201 Ga0373925_0102328 3300037068 Bacteria 2204
202 Ga0373925_0255329 3300037068 Bacteria 1407
203 Ga0395899_0022463 3300037312 Bacteria 4784
204 Ga0395899_0024311 3300037312 Bacteria 4581
205 Ga0395900_0011671 3300037418 Bacteria 8987
206 Ga0395900_0016193 3300037418 Bacteria 7596
207 Ga0395900_0487020 3300037418 Bacteria 1185
208 Ga0395898_0035778 3300037466 Bacteria 4934
209 Ga0395898_0038329 3300037466 Bacteria 4751
210 Ga0395898_0111555 3300037466 Bacteria 2621
211 Ga0395898_0234485 3300037466 Bacteria 1750
212 Ga0395905_0009844 3300037471 Bacteria 9318
213 Ga0395905_0167388 3300037471 Bacteria 2065
214 Ga0395901_0003980 3300038443 Bacteria 14867
215 Ga0395901_0031091 3300038443 Bacteria 5504
216 Ga0466967_0316578 3300045976 Bacteria 1504
217 Ga0495603_0048653 3300046455 Bacteria 2525
218 Ga0495590_0039319 3300046457 Bacteria 1650
219 Ga0495641_0030838 3300046461 Bacteria 2566
220 Ga0495584_0093773 3300046491 Bacteria 1515
221 Ga0495584_0126079 3300046491 Bacteria 1298
222 Ga0495585_0308544 3300046492 Bacteria 776
223 Ga0495596_0051727 3300046500 Bacteria 1609
224 Ga0495607_0227373 3300046501 Bacteria 909
225 Ga0495620_0059367 3300046515 Bacteria 1599
226 Ga0495644_0029751 3300046523 Bacteria 2063
227 Ga0495633_0256134 3300046558 Bacteria 798
228 Ga0495656_0232054 3300046615 Bacteria 926
229 Ga0495661_0271107 3300046665 Bacteria 859
230 Ga0495658_0441776 3300046683 Bacteria 831
231 Ga0495613_0645268 3300046689 Bacteria 701
232 Ga0495670_0123692 3300046691 Bacteria 1345
233 Ga0495671_0312713 3300046692 Bacteria 755
234 Ga0495676_0121346 3300047321 Bacteria 1901
235 Ga0495593_0156695 3300047673 Bacteria 1151
236 Ga0496100_0271494 3300048903 Bacteria 1261
237 Ga0496101_0018154 3300048904 Bacteria 4778
238 Ga0496101_0330684 3300048904 Bacteria 1196
239 Ga0496102_0014308 3300048905 Bacteria 6895
240 Ga0496102_0048688 3300048905 Bacteria 3854
241 Ga0496102_0059076 3300048905 Bacteria 3506
242 Ga0496102_0094947 3300048905 Bacteria 2763
243 Ga0496102_0157013 3300048905 Bacteria 2139
244 Ga0496103_0007253 3300048906 Bacteria 6606
245 Ga0496104_0033090 3300048907 Bacteria 4812
246 Ga0496104_0115872 3300048907 Bacteria 2571
247 Ga0496105_0001633 3300048908 Bacteria 15956
248 Ga0496105_0048992 3300048908 Bacteria 3487
249 Ga0496106_0003611 3300048909 Bacteria 11535
250 Ga0496106_0583973 3300048909 Bacteria 895
251 Ga0496107_0000817 3300048910 Bacteria 18083
252 Ga0496107_0174755 3300048910 Bacteria 1594
253 Ga0496108_0006235 3300048911 Bacteria 9657
254 Ga0496108_0014991 3300048911 Bacteria 6327
255 Ga0496108_0094550 3300048911 Bacteria 2544
256 Ga0496108_0298592 3300048911 Bacteria 1403
257 Ga0496109_0012085 3300048912 Bacteria 7441
258 Ga0496109_0068869 3300048912 Bacteria 3244
259 Ga0496109_0094637 3300048912 Bacteria 2765
260 Ga0496109_0140588 3300048912 Bacteria 2257
261 Ga0496110_0049063 3300048913 Bacteria 3702
262 Ga0496110_0468923 3300048913 Bacteria 1147
263 Ga0496111_0067961 3300048914 Bacteria 2589
264 Ga0496111_0280547 3300048914 Bacteria 1235
265 Ga0496112_0032533 3300048915 Bacteria 5065
266 Ga0496112_0248220 3300048915 Bacteria 1732
267 Ga0496112_0535283 3300048915 Bacteria 1106
268 Ga0496113_0125950 3300048916 Bacteria 2006
269 Ga0496113_0140120 3300048916 Bacteria 1902
270 Ga0496114_0017276 3300048917 Bacteria 5821
271 Ga0496114_0345327 3300048917 Bacteria 1316
272 Ga0496115_0002149 3300048918 Bacteria 14092
273 Ga0496116_0000223 3300048919 Bacteria 106176
274 Ga0496117_0002489 3300048920 Bacteria 23114
275 Ga0496117_0052753 3300048920 Bacteria 2862
276 Ga0496118_0000128 3300048921 Bacteria 134661
277 Ga0496118_0050244 3300048921 Bacteria 3203
278 Ga0496118_0298304 3300048921 Bacteria 886
279 Ga0496119_0000137 3300048922 Bacteria 103451
280 Ga0496119_0010426 3300048922 Bacteria 7821
281 Ga0496119_0042383 3300048922 Bacteria 2886
282 Ga0496120_0021273 3300048923 Bacteria 4101
283 Ga0496121_0018497 3300048924 Bacteria 7022
284 Ga0496125_0077157 3300048928 Bacteria 2570
285 Ga0496125_0139527 3300048928 Bacteria 1688
286 Ga0496126_0029057 3300048929 Bacteria 5256
287 Ga0496126_0252619 3300048929 Bacteria 1469
288 Ga0501032_0003714 3300049569 Bacteria 11587
289 Ga0501033_0000508 3300049570 Bacteria 36638
290 Ga0501034_0002505 3300049571 Bacteria 22050
291 Ga0501036_0004717 3300049572 Bacteria 10999
292 Ga0501037_0002248 3300049573 Bacteria 13961
293 Ga0501038_0006257 3300049574 Bacteria 11004
294 Ga0501039_0028415 3300049575 Bacteria 4305
295 Ga0501040_0060161 3300049576 Bacteria 2610
296 Ga0501042_0292536 3300049578 Bacteria 1176
297 Ga0501043_0000703 3300049579 Bacteria 29643
298 Ga0501046_0000245 3300049580 Bacteria 55502
299 Ga0501047_0000452 3300049581 Bacteria 45366
300 Ga0501047_0067982 3300049581 Bacteria 3432
301 Ga0501048_0004145 3300049582 Bacteria 11047
302 Ga0501068_0023675 3300049584 Bacteria 3601
303 Ga0501068_0285983 3300049584 Bacteria 1054
304 Ga0501068_0536235 3300049584 Bacteria 760
305 Ga0501068_0571913 3300049584 Bacteria 735
306 Ga0501069_0015394 3300049585 Bacteria 4098
307 Ga0501069_0024343 3300049585 Bacteria 3301
308 Ga0501070_0000309 3300049586 Bacteria 44629
309 Ga0501070_0053830 3300049586 Bacteria 3337
310 Ga0501070_0074230 3300049586 Bacteria 2815
311 Ga0501070_0115727 3300049586 Bacteria 2214
312 Ga0501072_0121422 3300049588 Bacteria 2082
313 Ga0501072_0144368 3300049588 Bacteria 1898
314 Ga0501072_0198839 3300049588 Bacteria 1598
315 Ga0501072_0464214 3300049588 Bacteria 1002
316 Ga0501073_0023564 3300049589 Bacteria 4419
317 Ga0501073_0071210 3300049589 Bacteria 2423
318 Ga0501074_0006236 3300049590 Bacteria 8608
319 Ga0501074_0042140 3300049590 Bacteria 3303
320 Ga0501075_0057490 3300049591 Bacteria 2929
321 Ga0501079_0007191 3300049741 Bacteria 8405
322 Ga0501079_0017060 3300049741 Bacteria 5545
323 Ga0501080_0028622 3300049742 Bacteria 5186
324 Ga0501080_0101772 3300049742 Bacteria 2665
325 Ga0501080_0163375 3300049742 Bacteria 2056
326 Ga0501080_0432487 3300049742 Bacteria 1181
327 Ga0501083_0005849 3300049744 Bacteria 8709
328 Ga0501083_0013016 3300049744 Bacteria 5813
329 Ga0501035_0000251 3300049822 Bacteria 64622
330 Ga0501044_0001776 3300049823 Bacteria 25227
331 Ga0501044_0038702 3300049823 Bacteria 4979
332 Ga0501045_0047976 3300049824 Bacteria 3112
333 Ga0501045_0181855 3300049824 Bacteria 1566
334 nmdc:mga03n38_2453_c1 3300050490 Bacteria 5735
335 nmdc:mga03n38_370958_c1 3300050490 Bacteria 782
336 nmdc:mga00v17_14470_c1 3300050491 Bacteria 4403
337 nmdc:mga00v17_187392_c1 3300050491 Bacteria 1336
338 nmdc:mga0yw44_321101_c1 3300050492 Unclassified 1040
339 nmdc:mga0yw44_5273_c1 3300050492 Bacteria 6069
340 nmdc:mga05p37_221878_c1 3300050507 Bacteria 2281
341 nmdc:mga05p37_3348_c1 3300050507 Bacteria 18690
342 nmdc:mga05p37_41329_c1 3300050507 Bacteria 5660
343 nmdc:mga09592_22700_c1 3300050508 Bacteria 5178
344 nmdc:mga0qj67_79087_c1 3300050509 Bacteria 2633
345 nmdc:mga06r32_275587_c1 3300050510 Bacteria 1670
346 nmdc:mga08y16_129699_c1 3300050511 Bacteria 2623
347 nmdc:mga0n895_353571_c1 3300050512 Bacteria 1488
348 nmdc:mga0n895_46957_c1 3300050512 Bacteria 4221
349 nmdc:mga08x19_286219_c1 3300050514 Bacteria 1143
350 nmdc:mga0a205_16347_c1 3300050515 Bacteria 2430
351 nmdc:mga0a205_498213_c1 3300050515 Bacteria 1075
352 nmdc:mga0a205_55628_c1 3300050515 Bacteria 3821
353 Ga0495655_0060585 3300053083 Bacteria 1031
354 Ga0500595_049522 3300053119 Bacteria 1308
355 Ga0501082_0010290 3300060353 Bacteria 8052
356 Ga0530510_0252629 3300061734 Bacteria 1314
357 Ga0070704_100325459
358 JGI25407J50210_10047858
359 JGI25404J52841_10014923
360 Ga0070658_10006969
361 Ga0070683_100080980
362 Ga0070683_100852554
363 Ga0070682_100005857
364 Ga0070682_100016981
365 Ga0068868_100010911
366 Ga0070660_100000714
367 Ga0070660_100430482
368 Ga0070691_10076119
369 Ga0070692_10009186
370 Ga0070692_10112253
371 Ga0070668_100317277
372 Ga0070668_100604168
373 Ga0070675_100058809
374 Ga0070674_100005526
375 Ga0070674_100031250
376 Ga0070673_100127536
377 Ga0070673_100305384
378 Ga0070659_100000026
379 Ga0070659_100002224
380 Ga0070667_100477165
381 Ga0070714_100015593
382 Ga0070714_100147418
383 Ga0070701_10501431
384 Ga0070711_100149994
385 Ga0070705_100007653
386 Ga0070705_100646565
387 Ga0070694_100086422
388 Ga0070694_100183972
389 Ga0070663_100004978
390 Ga0070678_100005948
391 Ga0070662_100012570
392 Ga0068867_100021921
393 Ga0068867_100375913
394 Ga0070685_10030678
395 Ga0070707_100553790
396 Ga0070679_101065736
397 Ga0070684_100006942
398 Ga0070684_100739470
399 Ga0070697_100293850
400 Ga0070686_100014002
401 Ga0070686_100060606
402 Ga0070696_100304861
403 Ga0070693_100455152
404 Ga0070704_100038298
405 Ga0068855_100379563
406 Ga0070664_100004969
407 Ga0068857_100165711
408 Ga0068854_100018281
409 Ga0068852_100620496
410 Ga0068864_100652492
411 Ga0068866_10067925
412 Ga0068861_100147241
413 Ga0068858_100091526
414 Ga0081455_10001214
415 Ga0081455_10011379
416 Ga0081455_10017819
417 Ga0081538_10001077
418 Ga0081538_10021417
419 Ga0081538_10086705
420 Ga0081540_1000210
421 Ga0081540_1001577
422 Ga0081540_1162536
423 Ga0081539_10004833
424 Ga0081539_10009885
425 Ga0081539_10013497
426 Ga0070717_10000004
427 Ga0075365_10000776
428 Ga0075365_10002071
429 Ga0075365_10096271
430 Ga0075365_10096289
431 Ga0075365_10279255
432 Ga0075363_100009053
433 Ga0075364_10067989
434 Ga0075364_10190505
435 Ga0075364_10563660
436 Ga0070712_100035055
437 Ga0075367_10265050
438 Ga0075428_100227349
439 Ga0075428_100806491
440 Ga0075430_100015795
441 Ga0075431_100050002
442 Ga0075433_10077443
443 Ga0075433_10393420
444 Ga0075433_10719201
445 Ga0075434_100021980
446 Ga0075434_100135393
447 Ga0075429_100003389
448 Ga0075429_100050759
449 Ga0068865_100004299
450 Ga0068865_100331044
451 Ga0075436_100360221
452 Ga0105240_10137475
453 Ga0105245_10007888
454 Ga0105245_10008770
455 Ga0105245_10728960
456 Ga0114129_10005552
457 Ga0114129_10114072
458 Ga0105243_10002090
459 Ga0105243_10032226
460 Ga0105243_10114058
461 Ga0105242_10151548
462 Ga0105248_10152790
463 Ga0105248_11965072
464 Ga0105237_10182912
465 Ga0105237_10604611
466 Ga0105238_11569219
467 Ga0105249_10007516
468 Ga0105249_11287946
469 Ga0105239_10037505
470 Ga0105239_10056534
471 Ga0105239_10081309
472 Ga0105239_10860617
473 Ga0105246_10036422
474 Ga0157374_10869234
475 Ga0157378_10476956
476 Ga0157378_10981046
477 Ga0163162_10717784
478 Ga0163162_11012665
479 Ga0157372_10421913
480 Ga0157372_10551833
481 Ga0157375_10031787
482 Ga0157375_10046568
483 Ga0163163_10014590
484 Ga0163163_10748598
485 Ga0157377_10017459
486 Ga0157379_10085420
487 Ga0157376_10040238
488 Ga0157376_10141405
489 Ga0163161_10276101
490 Ga0207656_10071793
491 Ga0207642_10060762
492 Ga0207688_10008092
493 Ga0207688_10009177
494 Ga0207645_10493310
495 Ga0207684_10233198
496 Ga0207707_10132919
497 Ga0207693_10002026
498 Ga0207663_10100012
499 Ga0207657_10001043
500 Ga0207657_10067305
501 Ga0207649_10522080
502 Ga0207646_10390409
503 Ga0207687_10020712
504 Ga0207687_10037550
505 Ga0207664_10015840
506 Ga0207664_10057678
507 Ga0207644_10125922
508 Ga0207690_10000098
509 Ga0207690_10124068
510 Ga0207706_10047311
511 Ga0207706_10455677
512 Ga0207709_10035821
513 Ga0207709_10091509
514 Ga0207709_10129166
515 Ga0207670_10021246
516 Ga0207669_10003891
517 Ga0207669_10006622
518 Ga0207704_10015525
519 Ga0207704_10361471
520 Ga0207665_10026653
521 Ga0207691_10034029
522 Ga0207711_10696915
523 Ga0207661_10016043
524 Ga0207661_10710393
525 Ga0207679_10075028
526 Ga0207651_10121032
527 Ga0207651_10233291
528 Ga0207712_10011354
529 Ga0207712_10060793
530 Ga0207668_10056623
531 Ga0207640_10072431
532 Ga0207677_10056038
533 Ga0207703_10102969
534 Ga0207703_10220058
535 Ga0207678_10003425
536 Ga0207702_10404861
537 Ga0207702_10521203
538 Ga0207648_10426161
539 Ga0207676_10364763
540 Ga0207674_10370329
541 Ga0207675_100670702
542 Ga0207683_10031184
543 Ga0207428_10123064
544 Ga0265319_1000118
545 Ga0307408_100273411
546 Ga0307410_10532084
547 Ga0307410_10549127
548 Ga0307406_10052281
549 Ga0307406_10529573
550 Ga0307409_100039958
551 Ga0307409_100504578
552 Ga0307409_100550065
553 Ga0307416_100074034
554 Ga0307415_100004401
555 Ga0373932_0158643
556 Ga0373943_0049213
557 Ga0373925_0102328
558 Ga0373925_0255329
559 Ga0395899_0022463
560 Ga0395899_0024311
561 Ga0395900_0011671
562 Ga0395900_0016193
563 Ga0395900_0487020
564 Ga0395898_0035778
565 Ga0395898_0038329
566 Ga0395898_0111555
567 Ga0395898_0234485
568 Ga0395905_0009844
569 Ga0395905_0167388
570 Ga0395901_0003980
571 Ga0395901_0031091
572 Ga0466967_0316578
573 Ga0495603_0048653
574 Ga0495590_0039319
575 Ga0495641_0030838
576 Ga0495584_0093773
577 Ga0495584_0126079
578 Ga0495585_0308544
579 Ga0495596_0051727
580 Ga0495607_0227373
581 Ga0495620_0059367
582 Ga0495644_0029751
583 Ga0495633_0256134
584 Ga0495656_0232054
585 Ga0495661_0271107
586 Ga0495658_0441776
587 Ga0495613_0645268
588 Ga0495670_0123692
589 Ga0495671_0312713
590 Ga0495676_0121346
591 Ga0495593_0156695
592 Ga0496100_0271494
593 Ga0496101_0018154
594 Ga0496101_0330684
595 Ga0496102_0014308
596 Ga0496102_0048688
597 Ga0496102_0059076
598 Ga0496102_0094947
599 Ga0496102_0157013
600 Ga0496103_0007253
601 Ga0496104_0033090
602 Ga0496104_0115872
603 Ga0496105_0001633
604 Ga0496105_0048992
605 Ga0496106_0003611
606 Ga0496106_0583973
607 Ga0496107_0000817
608 Ga0496107_0174755
609 Ga0496108_0006235
610 Ga0496108_0014991
611 Ga0496108_0094550
612 Ga0496108_0298592
613 Ga0496109_0012085
614 Ga0496109_0068869
615 Ga0496109_0094637
616 Ga0496109_0140588
617 Ga0496110_0049063
618 Ga0496110_0468923
619 Ga0496111_0067961
620 Ga0496111_0280547
621 Ga0496112_0032533
622 Ga0496112_0248220
623 Ga0496112_0535283
624 Ga0496113_0125950
625 Ga0496113_0140120
626 Ga0496114_0017276
627 Ga0496114_0345327
628 Ga0496115_0002149
629 Ga0496116_0000223
630 Ga0496117_0002489
631 Ga0496117_0052753
632 Ga0496118_0000128
633 Ga0496118_0050244
634 Ga0496118_0298304
635 Ga0496119_0000137
636 Ga0496119_0010426
637 Ga0496119_0042383
638 Ga0496120_0021273
639 Ga0496121_0018497
640 Ga0496125_0077157
641 Ga0496125_0139527
642 Ga0496126_0029057
643 Ga0496126_0252619
644 Ga0501032_0003714
645 Ga0501033_0000508
646 Ga0501034_0002505
647 Ga0501036_0004717
648 Ga0501037_0002248
649 Ga0501038_0006257
650 Ga0501039_0028415
651 Ga0501040_0060161
652 Ga0501042_0292536
653 Ga0501043_0000703
654 Ga0501046_0000245
655 Ga0501047_0000452
656 Ga0501047_0067982
657 Ga0501048_0004145
658 Ga0501068_0023675
659 Ga0501068_0285983
660 Ga0501068_0536235
661 Ga0501068_0571913
662 Ga0501069_0015394
663 Ga0501069_0024343
664 Ga0501070_0000309
665 Ga0501070_0053830
666 Ga0501070_0074230
667 Ga0501070_0115727
668 Ga0501072_0121422
669 Ga0501072_0144368
670 Ga0501072_0198839
671 Ga0501072_0464214
672 Ga0501073_0023564
673 Ga0501073_0071210
674 Ga0501074_0006236
675 Ga0501074_0042140
676 Ga0501075_0057490
677 Ga0501079_0007191
678 Ga0501079_0017060
679 Ga0501080_0028622
680 Ga0501080_0101772
681 Ga0501080_0163375
682 Ga0501080_0432487
683 Ga0501083_0005849
684 Ga0501083_0013016
685 Ga0501035_0000251
686 Ga0501044_0001776
687 Ga0501044_0038702
688 Ga0501045_0047976
689 Ga0501045_0181855
690 nmdc:mga03n38_2453_c1
691 nmdc:mga03n38_370958_c1
692 nmdc:mga00v17_14470_c1
693 nmdc:mga00v17_187392_c1
694 nmdc:mga0yw44_321101_c1
695 nmdc:mga0yw44_5273_c1
696 nmdc:mga05p37_221878_c1
697 nmdc:mga05p37_3348_c1
698 nmdc:mga05p37_41329_c1
699 nmdc:mga09592_22700_c1
700 nmdc:mga0qj67_79087_c1
701 nmdc:mga06r32_275587_c1
702 nmdc:mga08y16_129699_c1
703 nmdc:mga0n895_353571_c1
704 nmdc:mga0n895_46957_c1
705 nmdc:mga08x19_286219_c1
706 nmdc:mga0a205_16347_c1
707 nmdc:mga0a205_498213_c1
708 nmdc:mga0a205_55628_c1
709 Ga0495655_0060585
710 Ga0500595_049522
711 Ga0501082_0010290
712 Ga0530510_0252629

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10502

Peptidase_S26

Signal peptidase, peptidase S26

47

233

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4n31-assembly1.cif.gz_B structure and activity of streptococcus pyogenes sipa: a signal peptidase homologue essential for pilus polymerisation 0.7936 36 199
4n31-assembly1.cif.gz_A structure and activity of streptococcus pyogenes sipa: a signal peptidase homologue essential for pilus polymerisation 0.7805 35 199
4n31-assembly1.cif.gz_B structure and activity of streptococcus pyogenes sipa: a signal peptidase homologue essential for pilus polymerisation 0.777 36 199
4k8w-assembly1.cif.gz_A-2 an arm-swapped dimer of the s. pyogenes pilin specific assembly factor sipa 0.7503 66 189
4n31-assembly1.cif.gz_A structure and activity of streptococcus pyogenes sipa: a signal peptidase homologue essential for pilus polymerisation 0.7445 35 199
ID Description Score Start End Superfamily
1kn9D01 Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A 0.9112 36 194 2.10.109.10
1b12C01 Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A 0.9031 37 190 2.10.109.10
af_O04348_174_312_2.10.109.10 Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A 0.8812 35 189 2.10.109.10
af_O04348_174_312_2.10.109.10 Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A 0.8694 35 189 2.10.109.10
af_A0A1D6EFB1_25_139_2.10.109.10 Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A 0.8572 35 196 2.10.109.10
ID Description Score Start End GO Terms
AF-A0A537XAD5-F1-model_v4 Signal peptidase I (EC 3.4.21.89) 0.9452 24 203 GO:0004252
GO:0006465
GO:0016020
AF-A0A538KHC3-F1-model_v4 Signal peptidase I (EC 3.4.21.89) 0.9416 3 203 GO:0004252
GO:0006465
GO:0016020
AF-A0A7V8VKG4-F1-model_v4 Signal peptidase I (EC 3.4.21.89) 0.9414 38 192 GO:0004252
GO:0006465
GO:0016020
AF-A0A7V9RIZ8-F1-model_v4 Signal peptidase I (EC 3.4.21.89) 0.941 35 191 GO:0004252
GO:0006465
GO:0016020
AF-A0A538KHC3-F1-model_v4 Signal peptidase I (EC 3.4.21.89) 0.937 3 203 GO:0004252
GO:0006465
GO:0016020

Map