F420309

General Info

Members Datasets Scaffolds Average Seq Length
355 184 710 139

Family's Representative Sequence

Representative Sequence 3300050507|nmdc:mga05p37_217444_c1|nmdc:mga05p37_217444_c1_99_581
Length 160
Sequence MEDWRNGGMRKNLQPSNLLGGTMIVSHEFHLSTQGYCDIHNITEAVAGAVRASSLSHGIATVFTPSATSAITTLEYESGMLADFKDFFERVASQAWEYKHNERWHDGNGFSHIRAALLGPSLSVPFINRQLTLGTWQQIVFLDFDNRHRSRKVIVQIIGD

Samples

Sample ID Description Type Environment
1 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
115 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
118 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
119 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
120 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
121 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
122 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
123 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
124 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
125 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
126 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
127 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
128 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
129 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
130 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
135 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
136 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
137 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
138 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
139 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
140 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
141 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
142 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
143 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
144 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
145 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
146 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
147 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
148 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
149 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
150 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
151 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
152 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
153 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
154 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
155 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
156 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
165 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
166 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
167 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
168 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
169 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
170 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
171 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
172 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
173 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
174 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
175 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
176 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
177 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
178 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
179 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
180 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
181 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
182 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
183 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
184 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.87
Metatranscriptomes 1.13
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.85
Nodule 0
Rhizoplane 6.2
Rhizosphere 92.96
Stem 0
Stem Tuber 0
Unclassified 20.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga05p37_217444_c1 3300050507 Bacteria 2307
2 SwRhRL2b_contig_2482732 2162886007 Bacteria 5207
3 Ga0065704_10071841 3300005289 Bacteria 9778
4 Ga0065715_10012268 3300005293 Bacteria 2001
5 Ga0065715_10040936 3300005293 Bacteria 1372
6 Ga0065715_10128716 3300005293 Bacteria 2060
7 Ga0065707_10084289 3300005295 Bacteria 7388
8 Ga0065707_10104250 3300005295 Bacteria 2690
9 Ga0065707_10320975 3300005295 Bacteria 966
10 Ga0070676_10017784 3300005328 Bacteria 3936
11 Ga0070683_100002606 3300005329 Bacteria 14417
12 Ga0070690_100139832 3300005330 Bacteria 1642
13 Ga0070670_100002622 3300005331 Bacteria 14852
14 Ga0070670_100051946 3300005331 Bacteria 3520
15 Ga0068869_100221357 3300005334 Bacteria 1500
16 Ga0070682_100120948 3300005337 Bacteria 1758
17 Ga0070682_100361881 3300005337 Unclassified 1085
18 Ga0070660_101130743 3300005339 Bacteria 663
19 Ga0070689_100296940 3300005340 Bacteria 1344
20 Ga0070689_101510098 3300005340 Bacteria 609
21 Ga0070661_100176774 3300005344 Bacteria 1623
22 Ga0070661_100623280 3300005344 Bacteria 874
23 Ga0070668_100334706 3300005347 Bacteria 1278
24 Ga0070669_100004983 3300005353 Bacteria 9594
25 Ga0070669_100009456 3300005353 Bacteria 6942
26 Ga0070675_100175153 3300005354 Bacteria 1852
27 Ga0070671_100094461 3300005355 Bacteria 2506
28 Ga0070671_100140030 3300005355 Bacteria 2041
29 Ga0070674_100080295 3300005356 Unclassified 2328
30 Ga0070673_100012884 3300005364 Bacteria 5759
31 Ga0070688_100356194 3300005365 Bacteria 1072
32 Ga0070659_100089070 3300005366 Bacteria 2472
33 Ga0070659_100200595 3300005366 Bacteria 1642
34 Ga0070659_101546635 3300005366 Bacteria 592
35 Ga0070667_101151819 3300005367 Bacteria 725
36 Ga0070703_10215572 3300005406 Unclassified 761
37 Ga0070705_100288715 3300005440 Bacteria 1170
38 Ga0070700_100109789 3300005441 Bacteria 1832
39 Ga0070708_101416760 3300005445 Bacteria 648
40 Ga0070663_100466548 3300005455 Bacteria 1043
41 Ga0070662_100302533 3300005457 Unclassified 1300
42 Ga0070662_100357479 3300005457 Bacteria 1198
43 Ga0070662_101404065 3300005457 Bacteria 602
44 Ga0070681_10139666 3300005458 Bacteria 2353
45 Ga0070706_100362451 3300005467 Bacteria 1351
46 Ga0070698_100105652 3300005471 Bacteria 2785
47 Ga0070699_100094397 3300005518 Bacteria 2619
48 Ga0070699_100161888 3300005518 Bacteria 1981
49 Ga0070699_100203358 3300005518 Bacteria 1762
50 Ga0070684_100000370 3300005535 Bacteria 31010
51 Ga0070684_100159365 3300005535 Bacteria 2047
52 Ga0070684_101197001 3300005535 Bacteria 715
53 Ga0070697_101030657 3300005536 Bacteria 732
54 Ga0070672_100174586 3300005543 Bacteria 1788
55 Ga0070672_100298249 3300005543 Unclassified 1366
56 Ga0070672_100320885 3300005543 Unclassified 1317
57 Ga0070672_100398974 3300005543 Bacteria 1179
58 Ga0070686_100225456 3300005544 Bacteria 1357
59 Ga0070686_100372652 3300005544 Bacteria 1078
60 Ga0070693_100030805 3300005547 Bacteria 2936
61 Ga0070665_100224834 3300005548 Unclassified 1877
62 Ga0070665_100745269 3300005548 Bacteria 993
63 Ga0070704_101046608 3300005549 Bacteria 740
64 Ga0068857_100086708 3300005577 Bacteria 2800
65 Ga0068857_100979781 3300005577 Bacteria 813
66 Ga0068854_100013396 3300005578 Bacteria 5381
67 Ga0070702_100301567 3300005615 Bacteria 1108
68 Ga0070702_100553419 3300005615 Bacteria 854
69 Ga0070702_101177310 3300005615 Bacteria 617
70 Ga0068852_100820842 3300005616 Bacteria 945
71 Ga0068859_100120635 3300005617 Unclassified 2689
72 Ga0068859_100302260 3300005617 Bacteria 1693
73 Ga0068864_100137277 3300005618 Bacteria 2203
74 Ga0068861_100238868 3300005719 Bacteria 1545
75 Ga0068851_10095842 3300005834 Bacteria 1568
76 Ga0068858_100179669 3300005842 Bacteria 1998
77 Ga0068860_100123502 3300005843 Bacteria 2481
78 Ga0068860_100141994 3300005843 Bacteria 2309
79 Ga0068862_100029958 3300005844 Bacteria 4585
80 Ga0068862_100106002 3300005844 Bacteria 2464
81 Ga0081539_10019003 3300005985 Unclassified 4730
82 Ga0075367_10064526 3300006178 Bacteria 2191
83 Ga0075366_10030103 3300006195 Bacteria 3190
84 Ga0075428_100013110 3300006844 Bacteria 9219
85 Ga0075428_100100419 3300006844 Bacteria 3155
86 Ga0075428_100733078 3300006844 Unclassified 1052
87 Ga0075428_100770809 3300006844 Bacteria 1023
88 Ga0075430_100199090 3300006846 Bacteria 1664
89 Ga0075431_100094469 3300006847 Bacteria 3086
90 Ga0075431_100304013 3300006847 Unclassified 1611
91 Ga0075433_10005780 3300006852 Bacteria 9736
92 Ga0075433_10437663 3300006852 Archaea 1153
93 Ga0075434_100084557 3300006871 Bacteria 3172
94 Ga0075434_100203045 3300006871 Unclassified 2002
95 Ga0075434_100269490 3300006871 Unclassified 1722
96 Ga0075434_100473046 3300006871 Unclassified 1274
97 Ga0075434_100682275 3300006871 Bacteria 1045
98 Ga0075429_100006256 3300006880 Bacteria 10306
99 Ga0075429_100097782 3300006880 Bacteria 2561
100 Ga0075429_100360127 3300006880 Bacteria 1274
101 Ga0068865_100966486 3300006881 Bacteria 744
102 Ga0068865_101077991 3300006881 Bacteria 707
103 Ga0097620_100120635 3300006931 Unclassified 2689
104 Ga0097620_100302286 3300006931 Bacteria 1693
105 Ga0075435_100013933 3300007076 Bacteria 5996
106 Ga0075435_100019633 3300007076 Bacteria 5168
107 Ga0105240_10658814 3300009093 Bacteria 1147
108 Ga0111539_10011270 3300009094 Bacteria 11231
109 Ga0111539_10070958 3300009094 Unclassified 4111
110 Ga0111539_10079693 3300009094 Bacteria 3852
111 Ga0111539_10115004 3300009094 Unclassified 3155
112 Ga0111539_10420758 3300009094 Bacteria 1556
113 Ga0111539_11860890 3300009094 Bacteria 698
114 Ga0105245_11073336 3300009098 Unclassified 851
115 Ga0105245_12450508 3300009098 Bacteria 575
116 Ga0105245_13075001 3300009098 Bacteria 517
117 Ga0114129_10002437 3300009147 Bacteria 25820
118 Ga0114129_10003803 3300009147 Bacteria 21274
119 Ga0114129_10019688 3300009147 Bacteria 9607
120 Ga0114129_10106968 3300009147 Bacteria 3864
121 Ga0114129_10248192 3300009147 Unclassified 2390
122 Ga0114129_10604721 3300009147 Bacteria 1420
123 Ga0114129_10958967 3300009147 Bacteria 1080
124 Ga0105243_10876688 3300009148 Bacteria 891
125 Ga0105243_10909016 3300009148 Bacteria 876
126 Ga0105242_10032641 3300009176 Bacteria 4164
127 Ga0105248_10003818 3300009177 Bacteria 16710
128 Ga0105248_10036824 3300009177 Bacteria 5472
129 Ga0105248_10118262 3300009177 Bacteria 2989
130 Ga0105238_10359432 3300009551 Bacteria 1445
131 Ga0105249_10008041 3300009553 Bacteria 9193
132 Ga0105249_10456285 3300009553 Bacteria 1317
133 Ga0105249_10569907 3300009553 Bacteria 1184
134 Ga0105246_10085049 3300011119 Bacteria 2264
135 Ga0105246_10113246 3300011119 Bacteria 1997
136 Ga0163162_10127056 3300013306 Bacteria 2656
137 Ga0163162_11342094 3300013306 Unclassified 813
138 Ga0157375_10351381 3300013308 Bacteria 1640
139 Ga0163163_10102574 3300014325 Unclassified 2885
140 Ga0157380_10432613 3300014326 Unclassified 1258
141 Ga0157377_10207754 3300014745 Bacteria 1247
142 Ga0157377_10256470 3300014745 Unclassified 1136
143 Ga0157377_10409940 3300014745 Unclassified 925
144 Ga0157379_10176094 3300014968 Bacteria 1931
145 Ga0207697_10005475 3300025315 Bacteria 5899
146 Ga0207653_10144674 3300025885 Bacteria 871
147 Ga0207680_10010869 3300025903 Unclassified 4574
148 Ga0207645_10009238 3300025907 Bacteria 6830
149 Ga0207657_10706446 3300025919 Bacteria 783
150 Ga0207649_10190482 3300025920 Bacteria 1442
151 Ga0207649_10242413 3300025920 Bacteria 1294
152 Ga0207681_10008059 3300025923 Bacteria 6445
153 Ga0207681_10009959 3300025923 Bacteria 5818
154 Ga0207650_10231218 3300025925 Unclassified 1491
155 Ga0207659_10066037 3300025926 Unclassified 2624
156 Ga0207687_10314325 3300025927 Bacteria 1266
157 Ga0207644_10539950 3300025931 Bacteria 964
158 Ga0207644_10692168 3300025931 Bacteria 850
159 Ga0207690_10152576 3300025932 Bacteria 1714
160 Ga0207690_11419433 3300025932 Bacteria 580
161 Ga0207706_10165102 3300025933 Bacteria 1946
162 Ga0207706_10281234 3300025933 Unclassified 1451
163 Ga0207686_10018002 3300025934 Bacteria 3993
164 Ga0207709_10140603 3300025935 Bacteria 1659
165 Ga0207670_10093001 3300025936 Bacteria 2136
166 Ga0207670_10208904 3300025936 Bacteria 1487
167 Ga0207704_10110534 3300025938 Bacteria 1857
168 Ga0207691_10052177 3300025940 Bacteria 3735
169 Ga0207691_10187186 3300025940 Unclassified 1807
170 Ga0207691_10284976 3300025940 Bacteria 1421
171 Ga0207691_10300458 3300025940 Unclassified 1379
172 Ga0207711_10009966 3300025941 Bacteria 7897
173 Ga0207711_10057097 3300025941 Bacteria 3356
174 Ga0207711_10148929 3300025941 Bacteria 2111
175 Ga0207661_11786869 3300025944 Bacteria 560
176 Ga0207679_10731570 3300025945 Unclassified 899
177 Ga0207679_11161748 3300025945 Bacteria 708
178 Ga0207651_10571089 3300025960 Bacteria 985
179 Ga0207712_10231699 3300025961 Bacteria 1483
180 Ga0207712_10640252 3300025961 Bacteria 923
181 Ga0207668_10684147 3300025972 Bacteria 900
182 Ga0207640_10129576 3300025981 Bacteria 1821
183 Ga0207658_10464779 3300025986 Bacteria 1122
184 Ga0207703_10052122 3300026035 Bacteria 3320
185 Ga0207703_10264637 3300026035 Bacteria 1555
186 Ga0207678_10097994 3300026067 Bacteria 2505
187 Ga0207678_10469025 3300026067 Bacteria 1096
188 Ga0207641_11456061 3300026088 Bacteria 686
189 Ga0207648_10005031 3300026089 Bacteria 13417
190 Ga0207676_10111259 3300026095 Bacteria 2292
191 Ga0207674_10087385 3300026116 Unclassified 3111
192 Ga0207674_10448486 3300026116 Bacteria 1247
193 Ga0207675_100033201 3300026118 Unclassified 4809
194 Ga0207675_100155344 3300026118 Bacteria 2180
195 Ga0207675_101175001 3300026118 Bacteria 787
196 Ga0207683_10771929 3300026121 Bacteria 892
197 Ga0209813_10069610 3300027866 Unclassified 1141
198 Ga0207428_10054848 3300027907 Bacteria 3172
199 Ga0207428_10302184 3300027907 Bacteria 1184
200 Ga0207428_10728410 3300027907 Unclassified 708
201 Ga0268264_10317266 3300028381 Bacteria 1472
202 Ga0307408_100579050 3300031548 Unclassified 994
203 Ga0307408_101019139 3300031548 Unclassified 764
204 Ga0316579_10141060 3300031691 Unclassified 1161
205 Ga0316576_10047659 3300031727 Bacteria 3106
206 Ga0316576_10098990 3300031727 Bacteria 2177
207 Ga0316576_10163266 3300031727 Bacteria 1680
208 Ga0316576_10509492 3300031727 Unclassified 885
209 Ga0316576_10962693 3300031727 Unclassified 609
210 Ga0316578_10004644 3300031728 Bacteria 6514
211 Ga0316578_10222530 3300031728 Unclassified 1134
212 Ga0316578_10268526 3300031728 Bacteria 1022
213 Ga0316577_10004065 3300031733 Bacteria 7496
214 Ga0316577_10007037 3300031733 Bacteria 5981
215 Ga0316577_10018214 3300031733 Bacteria 3883
216 Ga0316577_10021631 3300031733 Bacteria 3569
217 Ga0307410_11343567 3300031852 Bacteria 626
218 Ga0307412_11574118 3300031911 Unclassified 599
219 Ga0307416_100433443 3300032002 Unclassified 1362
220 Ga0307416_100688984 3300032002 Bacteria 1110
221 Ga0307411_10182505 3300032005 Bacteria 1594
222 Ga0307411_10677467 3300032005 Unclassified 896
223 Ga0307415_100129110 3300032126 Bacteria 1910
224 Ga0316583_10010086 3300032133 Bacteria 3403
225 Ga0316583_10061263 3300032133 Bacteria 1319
226 Ga0316585_10000190 3300032137 Bacteria 12581
227 Ga0316585_10048391 3300032137 Bacteria 1362
228 Ga0316580_10002800 3300032139 Bacteria 4862
229 Ga0316580_10019935 3300032139 Bacteria 2063
230 Ga0316593_10036381 3300032168 Unclassified 1623
231 Ga0316592_1010026 3300033524 Bacteria 1903
232 Ga0316588_1023892 3300033528 Bacteria 1404
233 Ga0316596_1013587 3300033541 Bacteria 2013
234 Ga0373950_0119939 3300034818 Bacteria 581
235 Ga0373942_0163805 3300035207 Bacteria 720
236 Ga0316574_0000768 3300035398 Bacteria 13822
237 Ga0316574_0468041 3300035398 Bacteria 788
238 Ga0316582_0006235 3300036647 Bacteria 6237
239 Ga0316582_0007419 3300036647 Bacteria 5834
240 Ga0316582_0074841 3300036647 Bacteria 2199
241 Ga0316582_0083533 3300036647 Bacteria 2090
242 Ga0316584_0012525 3300036712 Bacteria 5982
243 Ga0316584_0026465 3300036712 Unclassified 4264
244 Ga0316584_0029312 3300036712 Bacteria 4062
245 Ga0316584_0049011 3300036712 Bacteria 3156
246 Ga0316584_0265367 3300036712 Bacteria 1251
247 Ga0316581_0001977 3300037588 Bacteria 4805
248 Ga0316581_0037739 3300037588 Unclassified 1468
249 Ga0316581_0083520 3300037588 Bacteria 982
250 Ga0451577_0001582 3300042876 Bacteria 29709
251 Ga0451577_0007390 3300042876 Bacteria 10786
252 Ga0453683_0267051 3300044673 Bacteria 1092
253 Ga0453684_0005530 3300044712 Bacteria 24938
254 Ga0453684_0185086 3300044712 Bacteria 2442
255 Ga0453684_0243123 3300044712 Bacteria 2071
256 Ga0453684_0267223 3300044712 Bacteria 1956
257 Ga0453684_0363082 3300044712 Bacteria 1630
258 Ga0453684_1120276 3300044712 Unclassified 830
259 Ga0451576_0014297 3300045051 Bacteria 8838
260 Ga0451576_1754799 3300045051 Bacteria 642
261 Ga0496102_0799564 3300048905 Bacteria 865
262 Ga0496103_0416152 3300048906 Bacteria 863
263 Ga0496104_0002583 3300048907 Bacteria 15617
264 Ga0496104_0435676 3300048907 Bacteria 1223
265 Ga0496104_0975858 3300048907 Bacteria 752
266 Ga0496105_0022020 3300048908 Bacteria 5160
267 Ga0496106_0552401 3300048909 Unclassified 924
268 Ga0496106_0556844 3300048909 Bacteria 920
269 Ga0496107_0633853 3300048910 Bacteria 789
270 Ga0496108_0013109 3300048911 Bacteria 6757
271 Ga0496108_0381476 3300048911 Bacteria 1231
272 Ga0496108_0463520 3300048911 Bacteria 1107
273 Ga0496108_0731082 3300048911 Unclassified 857
274 Ga0496109_0324293 3300048912 Bacteria 1454
275 Ga0496109_1390070 3300048912 Bacteria 637
276 Ga0496110_0000061 3300048913 Bacteria 53551
277 Ga0496110_0237640 3300048913 Bacteria 1658
278 Ga0496111_0079584 3300048914 Unclassified 2391
279 Ga0496111_0230751 3300048914 Bacteria 1375
280 Ga0496112_0040572 3300048915 Unclassified 4551
281 Ga0496113_0111277 3300048916 Bacteria 2132
282 Ga0496113_0208991 3300048916 Unclassified 1553
283 Ga0501031_0304548 3300049568 Bacteria 1033
284 Ga0501036_0887912 3300049572 Bacteria 732
285 Ga0501037_0503792 3300049573 Bacteria 821
286 Ga0501038_0237056 3300049574 Bacteria 1450
287 Ga0501038_0294481 3300049574 Bacteria 1275
288 Ga0501040_0164372 3300049576 Bacteria 1570
289 Ga0501041_0175035 3300049577 Bacteria 1343
290 Ga0501041_0313613 3300049577 Bacteria 989
291 Ga0501041_0644626 3300049577 Bacteria 677
292 Ga0501042_0341727 3300049578 Bacteria 1082
293 Ga0501042_1001394 3300049578 Unclassified 609
294 Ga0501043_0983207 3300049579 Bacteria 601
295 Ga0501069_0149381 3300049585 Bacteria 1342
296 Ga0501071_0123563 3300049587 Bacteria 1920
297 Ga0501071_0647745 3300049587 Bacteria 813
298 Ga0501072_0449666 3300049588 Unclassified 1020
299 Ga0501072_0493479 3300049588 Bacteria 969
300 Ga0501075_0235625 3300049591 Bacteria 1395
301 Ga0501075_0263853 3300049591 Bacteria 1313
302 Ga0501076_0106366 3300049592 Bacteria 2265
303 Ga0501076_0498920 3300049592 Bacteria 1003
304 Ga0501076_0980020 3300049592 Unclassified 696
305 Ga0501077_0643779 3300049593 Unclassified 681
306 Ga0501235_115944 3300049669 Unclassified 666
307 Ga0501079_0223191 3300049741 Bacteria 1472
308 Ga0501080_0549171 3300049742 Unclassified 1029
309 Ga0501081_0250189 3300049743 Bacteria 1294
310 Ga0501081_0591797 3300049743 Unclassified 830
311 Ga0501081_0750052 3300049743 Unclassified 734
312 Ga0501081_1440043 3300049743 Bacteria 523
313 Ga0501045_0279520 3300049824 Bacteria 1243
314 Ga0501045_0718096 3300049824 Bacteria 737
315 Ga0501045_1062917 3300049824 Bacteria 593
316 nmdc:mga05p37_141508_c1 3300050507 Unclassified 2947
317 nmdc:mga05p37_1593_c1 3300050507 Bacteria 26336
318 nmdc:mga05p37_1596577_c1 3300050507 Viruses 643
319 nmdc:mga05p37_316230_c1 3300050507 Bacteria 1849
320 nmdc:mga05p37_347090_c1 3300050507 Bacteria 1748
321 nmdc:mga05p37_36541_c1 3300050507 Bacteria 6026
322 nmdc:mga05p37_833824_c1 3300050507 Bacteria 1004
323 nmdc:mga05p37_87957_c1 3300050507 Bacteria 3830
324 nmdc:mga09592_201150_c1 3300050508 Bacteria 1725
325 nmdc:mga09592_35686_c1 3300050508 Bacteria 4163
326 nmdc:mga09592_395608_c1 3300050508 Bacteria 1194
327 nmdc:mga09592_5896_c1 3300050508 Bacteria 9992
328 nmdc:mga09592_769439_c1 3300050508 Unclassified 816
329 nmdc:mga09592_99893_c1 3300050508 Bacteria 2484
330 nmdc:mga0qj67_107144_c1 3300050509 Bacteria 2254
331 nmdc:mga06r32_291963_c1 3300050510 Unclassified 1617
332 nmdc:mga06r32_933287_c1 3300050510 Unclassified 823
333 nmdc:mga08y16_1153383_c1 3300050511 Unclassified 748
334 nmdc:mga08y16_19185_c1 3300050511 Bacteria 7205
335 nmdc:mga08y16_283487_c1 3300050511 Unclassified 1708
336 nmdc:mga08y16_46146_c1 3300050511 Bacteria 4563
337 nmdc:mga08y16_678925_c1 3300050511 Bacteria 1032
338 nmdc:mga08y16_95572_c1 3300050511 Bacteria 3095
339 nmdc:mga0n895_1525977_c1 3300050512 Bacteria 634
340 nmdc:mga0n895_349144_c1 3300050512 Bacteria 1498
341 nmdc:mga0n895_526720_c1 3300050512 Unclassified 1189
342 nmdc:mga0n895_71542_c1 3300050512 Unclassified 3439
343 nmdc:mga0rr50_11661_c1 3300050513 Bacteria 5639
344 nmdc:mga0rr50_44727_c1 3300050513 Bacteria 3250
345 nmdc:mga0a205_1207212_c1 3300050515 Bacteria 604
346 nmdc:mga0a205_16326_c1 3300050515 Bacteria 6953
347 nmdc:mga0a205_177459_c1 3300050515 Bacteria 2025
348 nmdc:mga0a205_374820_c1 3300050515 Bacteria 1289
349 nmdc:mga0a205_68091_c1 3300050515 Bacteria 3438
350 Ga0501084_0091767 3300054114 Unclassified 2550
351 Ga0501084_1028725 3300054114 Bacteria 692
352 Ga0501084_1473863 3300054114 Unclassified 570
353 Ga0501082_1484275 3300060353 Unclassified 592
354 Ga0530510_0042463 3300061734 Unclassified 3286
355 Ga0530510_1130663 3300061734 Bacteria 600
356 nmdc:mga05p37_217444_c1
357 SwRhRL2b_contig_2482732
358 Ga0065704_10071841
359 Ga0065715_10012268
360 Ga0065715_10040936
361 Ga0065715_10128716
362 Ga0065707_10084289
363 Ga0065707_10104250
364 Ga0065707_10320975
365 Ga0070676_10017784
366 Ga0070683_100002606
367 Ga0070690_100139832
368 Ga0070670_100002622
369 Ga0070670_100051946
370 Ga0068869_100221357
371 Ga0070682_100120948
372 Ga0070682_100361881
373 Ga0070660_101130743
374 Ga0070689_100296940
375 Ga0070689_101510098
376 Ga0070661_100176774
377 Ga0070661_100623280
378 Ga0070668_100334706
379 Ga0070669_100004983
380 Ga0070669_100009456
381 Ga0070675_100175153
382 Ga0070671_100094461
383 Ga0070671_100140030
384 Ga0070674_100080295
385 Ga0070673_100012884
386 Ga0070688_100356194
387 Ga0070659_100089070
388 Ga0070659_100200595
389 Ga0070659_101546635
390 Ga0070667_101151819
391 Ga0070703_10215572
392 Ga0070705_100288715
393 Ga0070700_100109789
394 Ga0070708_101416760
395 Ga0070663_100466548
396 Ga0070662_100302533
397 Ga0070662_100357479
398 Ga0070662_101404065
399 Ga0070681_10139666
400 Ga0070706_100362451
401 Ga0070698_100105652
402 Ga0070699_100094397
403 Ga0070699_100161888
404 Ga0070699_100203358
405 Ga0070684_100000370
406 Ga0070684_100159365
407 Ga0070684_101197001
408 Ga0070697_101030657
409 Ga0070672_100174586
410 Ga0070672_100298249
411 Ga0070672_100320885
412 Ga0070672_100398974
413 Ga0070686_100225456
414 Ga0070686_100372652
415 Ga0070693_100030805
416 Ga0070665_100224834
417 Ga0070665_100745269
418 Ga0070704_101046608
419 Ga0068857_100086708
420 Ga0068857_100979781
421 Ga0068854_100013396
422 Ga0070702_100301567
423 Ga0070702_100553419
424 Ga0070702_101177310
425 Ga0068852_100820842
426 Ga0068859_100120635
427 Ga0068859_100302260
428 Ga0068864_100137277
429 Ga0068861_100238868
430 Ga0068851_10095842
431 Ga0068858_100179669
432 Ga0068860_100123502
433 Ga0068860_100141994
434 Ga0068862_100029958
435 Ga0068862_100106002
436 Ga0081539_10019003
437 Ga0075367_10064526
438 Ga0075366_10030103
439 Ga0075428_100013110
440 Ga0075428_100100419
441 Ga0075428_100733078
442 Ga0075428_100770809
443 Ga0075430_100199090
444 Ga0075431_100094469
445 Ga0075431_100304013
446 Ga0075433_10005780
447 Ga0075433_10437663
448 Ga0075434_100084557
449 Ga0075434_100203045
450 Ga0075434_100269490
451 Ga0075434_100473046
452 Ga0075434_100682275
453 Ga0075429_100006256
454 Ga0075429_100097782
455 Ga0075429_100360127
456 Ga0068865_100966486
457 Ga0068865_101077991
458 Ga0097620_100120635
459 Ga0097620_100302286
460 Ga0075435_100013933
461 Ga0075435_100019633
462 Ga0105240_10658814
463 Ga0111539_10011270
464 Ga0111539_10070958
465 Ga0111539_10079693
466 Ga0111539_10115004
467 Ga0111539_10420758
468 Ga0111539_11860890
469 Ga0105245_11073336
470 Ga0105245_12450508
471 Ga0105245_13075001
472 Ga0114129_10002437
473 Ga0114129_10003803
474 Ga0114129_10019688
475 Ga0114129_10106968
476 Ga0114129_10248192
477 Ga0114129_10604721
478 Ga0114129_10958967
479 Ga0105243_10876688
480 Ga0105243_10909016
481 Ga0105242_10032641
482 Ga0105248_10003818
483 Ga0105248_10036824
484 Ga0105248_10118262
485 Ga0105238_10359432
486 Ga0105249_10008041
487 Ga0105249_10456285
488 Ga0105249_10569907
489 Ga0105246_10085049
490 Ga0105246_10113246
491 Ga0163162_10127056
492 Ga0163162_11342094
493 Ga0157375_10351381
494 Ga0163163_10102574
495 Ga0157380_10432613
496 Ga0157377_10207754
497 Ga0157377_10256470
498 Ga0157377_10409940
499 Ga0157379_10176094
500 Ga0207697_10005475
501 Ga0207653_10144674
502 Ga0207680_10010869
503 Ga0207645_10009238
504 Ga0207657_10706446
505 Ga0207649_10190482
506 Ga0207649_10242413
507 Ga0207681_10008059
508 Ga0207681_10009959
509 Ga0207650_10231218
510 Ga0207659_10066037
511 Ga0207687_10314325
512 Ga0207644_10539950
513 Ga0207644_10692168
514 Ga0207690_10152576
515 Ga0207690_11419433
516 Ga0207706_10165102
517 Ga0207706_10281234
518 Ga0207686_10018002
519 Ga0207709_10140603
520 Ga0207670_10093001
521 Ga0207670_10208904
522 Ga0207704_10110534
523 Ga0207691_10052177
524 Ga0207691_10187186
525 Ga0207691_10284976
526 Ga0207691_10300458
527 Ga0207711_10009966
528 Ga0207711_10057097
529 Ga0207711_10148929
530 Ga0207661_11786869
531 Ga0207679_10731570
532 Ga0207679_11161748
533 Ga0207651_10571089
534 Ga0207712_10231699
535 Ga0207712_10640252
536 Ga0207668_10684147
537 Ga0207640_10129576
538 Ga0207658_10464779
539 Ga0207703_10052122
540 Ga0207703_10264637
541 Ga0207678_10097994
542 Ga0207678_10469025
543 Ga0207641_11456061
544 Ga0207648_10005031
545 Ga0207676_10111259
546 Ga0207674_10087385
547 Ga0207674_10448486
548 Ga0207675_100033201
549 Ga0207675_100155344
550 Ga0207675_101175001
551 Ga0207683_10771929
552 Ga0209813_10069610
553 Ga0207428_10054848
554 Ga0207428_10302184
555 Ga0207428_10728410
556 Ga0268264_10317266
557 Ga0307408_100579050
558 Ga0307408_101019139
559 Ga0316579_10141060
560 Ga0316576_10047659
561 Ga0316576_10098990
562 Ga0316576_10163266
563 Ga0316576_10509492
564 Ga0316576_10962693
565 Ga0316578_10004644
566 Ga0316578_10222530
567 Ga0316578_10268526
568 Ga0316577_10004065
569 Ga0316577_10007037
570 Ga0316577_10018214
571 Ga0316577_10021631
572 Ga0307410_11343567
573 Ga0307412_11574118
574 Ga0307416_100433443
575 Ga0307416_100688984
576 Ga0307411_10182505
577 Ga0307411_10677467
578 Ga0307415_100129110
579 Ga0316583_10010086
580 Ga0316583_10061263
581 Ga0316585_10000190
582 Ga0316585_10048391
583 Ga0316580_10002800
584 Ga0316580_10019935
585 Ga0316593_10036381
586 Ga0316592_1010026
587 Ga0316588_1023892
588 Ga0316596_1013587
589 Ga0373950_0119939
590 Ga0373942_0163805
591 Ga0316574_0000768
592 Ga0316574_0468041
593 Ga0316582_0006235
594 Ga0316582_0007419
595 Ga0316582_0074841
596 Ga0316582_0083533
597 Ga0316584_0012525
598 Ga0316584_0026465
599 Ga0316584_0029312
600 Ga0316584_0049011
601 Ga0316584_0265367
602 Ga0316581_0001977
603 Ga0316581_0037739
604 Ga0316581_0083520
605 Ga0451577_0001582
606 Ga0451577_0007390
607 Ga0453683_0267051
608 Ga0453684_0005530
609 Ga0453684_0185086
610 Ga0453684_0243123
611 Ga0453684_0267223
612 Ga0453684_0363082
613 Ga0453684_1120276
614 Ga0451576_0014297
615 Ga0451576_1754799
616 Ga0496102_0799564
617 Ga0496103_0416152
618 Ga0496104_0002583
619 Ga0496104_0435676
620 Ga0496104_0975858
621 Ga0496105_0022020
622 Ga0496106_0552401
623 Ga0496106_0556844
624 Ga0496107_0633853
625 Ga0496108_0013109
626 Ga0496108_0381476
627 Ga0496108_0463520
628 Ga0496108_0731082
629 Ga0496109_0324293
630 Ga0496109_1390070
631 Ga0496110_0000061
632 Ga0496110_0237640
633 Ga0496111_0079584
634 Ga0496111_0230751
635 Ga0496112_0040572
636 Ga0496113_0111277
637 Ga0496113_0208991
638 Ga0501031_0304548
639 Ga0501036_0887912
640 Ga0501037_0503792
641 Ga0501038_0237056
642 Ga0501038_0294481
643 Ga0501040_0164372
644 Ga0501041_0175035
645 Ga0501041_0313613
646 Ga0501041_0644626
647 Ga0501042_0341727
648 Ga0501042_1001394
649 Ga0501043_0983207
650 Ga0501069_0149381
651 Ga0501071_0123563
652 Ga0501071_0647745
653 Ga0501072_0449666
654 Ga0501072_0493479
655 Ga0501075_0235625
656 Ga0501075_0263853
657 Ga0501076_0106366
658 Ga0501076_0498920
659 Ga0501076_0980020
660 Ga0501077_0643779
661 Ga0501235_115944
662 Ga0501079_0223191
663 Ga0501080_0549171
664 Ga0501081_0250189
665 Ga0501081_0591797
666 Ga0501081_0750052
667 Ga0501081_1440043
668 Ga0501045_0279520
669 Ga0501045_0718096
670 Ga0501045_1062917
671 nmdc:mga05p37_141508_c1
672 nmdc:mga05p37_1593_c1
673 nmdc:mga05p37_1596577_c1
674 nmdc:mga05p37_316230_c1
675 nmdc:mga05p37_347090_c1
676 nmdc:mga05p37_36541_c1
677 nmdc:mga05p37_833824_c1
678 nmdc:mga05p37_87957_c1
679 nmdc:mga09592_201150_c1
680 nmdc:mga09592_35686_c1
681 nmdc:mga09592_395608_c1
682 nmdc:mga09592_5896_c1
683 nmdc:mga09592_769439_c1
684 nmdc:mga09592_99893_c1
685 nmdc:mga0qj67_107144_c1
686 nmdc:mga06r32_291963_c1
687 nmdc:mga06r32_933287_c1
688 nmdc:mga08y16_1153383_c1
689 nmdc:mga08y16_19185_c1
690 nmdc:mga08y16_283487_c1
691 nmdc:mga08y16_46146_c1
692 nmdc:mga08y16_678925_c1
693 nmdc:mga08y16_95572_c1
694 nmdc:mga0n895_1525977_c1
695 nmdc:mga0n895_349144_c1
696 nmdc:mga0n895_526720_c1
697 nmdc:mga0n895_71542_c1
698 nmdc:mga0rr50_11661_c1
699 nmdc:mga0rr50_44727_c1
700 nmdc:mga0a205_1207212_c1
701 nmdc:mga0a205_16326_c1
702 nmdc:mga0a205_177459_c1
703 nmdc:mga0a205_374820_c1
704 nmdc:mga0a205_68091_c1
705 Ga0501084_0091767
706 Ga0501084_1028725
707 Ga0501084_1473863
708 Ga0501082_1484275
709 Ga0530510_0042463
710 Ga0530510_1130663

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01894

UPF0047

Uncharacterised protein family UPF0047

41

157

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vph-assembly2.cif.gz_E crystal structure of a ybjq-like protein of unknown function (sso2532) from sulfolobus solfataricus p2 at 1.76 a resolution 0.966 2 139
2p6h-assembly1.cif.gz_A crystal structure of hypothetical protein ape1520 from aeropyrum pernix k1 0.953 4 139
1xbf-assembly1.cif.gz_C x-ray structure northeast structural genomics consortium target car10 from c. acetobutylicum 0.9527 4 137
1vmh-assembly1.cif.gz_A crystal structure of an uncharacterized conserved protein yjbq/upf0047 family, ortholog yugu b.subtilis (ca_c0907) from clostridium acetobutylicum at 1.31 a resolution 0.9525 6 137
1ve0-assembly1.cif.gz_A crystal structure of uncharacterized protein st2072 from sulfolobus tokodaii 0.9507 1 139
ID Description Score Start End Superfamily
1vphC00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9638 3 139 2.60.120.460
2p6hB00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9527 4 139 2.60.120.460
1ve0A00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9494 2 139 2.60.120.460
1xbfB00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9466 6 137 2.60.120.460
2p6cB00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.946 1 139 2.60.120.460
ID Description Score Start End GO Terms
AF-A0A7C7V510-F1-model_v4 YjbQ family protein 0.9986 1 139
AF-A0A0S8A4G3-F1-model_v4 Secondary thiamine-phosphate synthase enzyme 0.9979 19 139
AF-A0A3M1BK28-F1-model_v4 YjbQ family protein 0.9968 1 109
AF-A0A3M1H4M2-F1-model_v4 YjbQ family protein 0.9961 2 139
AF-A0A497IHW7-F1-model_v4 YjbQ family protein 0.9961 2 139

Map