F420237

General Info

Members Datasets Scaffolds Average Seq Length
355 219 710 193

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0000909|Ga0451576_0000909_25515_26180
Length 221
Sequence MNAMLKMSQLIDGLNERIGRTLMWAVLAAVIISAVNAVVRKAFDMSSNAFLEIQWYLFAAVVMLGSAYTMLRQGHVKIDVIIGRFSKRTQIIVECLGIVLFLFPFVYKVNELVWPLVIQAYHSGEMSQNAGGLIRWPVYALVPAGFILLGLQGLSELIKRIGFLMGLAVDPTHPVQTKTAEEELAEEILKHQVAPEVIVRVEDSLDMHADRNGNSGTGSTK

Samples

Sample ID Description Type Environment
1 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
116 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
123 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
124 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
125 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
126 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
127 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
128 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
129 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
130 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
131 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
132 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
133 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
134 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
135 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
136 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
137 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
138 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
139 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
140 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
141 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
142 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
143 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
144 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
145 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
146 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
147 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
148 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
151 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
152 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
153 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
154 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
155 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
156 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
157 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
158 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
159 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
160 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
161 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
162 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
163 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
164 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
165 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
166 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
167 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
168 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
169 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
170 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
171 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
172 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
173 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
174 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
175 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
176 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
177 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
178 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
179 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
180 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
181 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
182 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
183 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
184 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
185 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
186 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
187 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
188 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
189 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
196 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
197 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
198 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
199 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
200 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
201 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
202 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
203 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
204 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
205 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
206 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
207 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
208 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
209 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
210 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
211 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
212 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
213 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
214 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
215 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
216 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
217 2842677519 Variovorax sp. R-72495 Isolate Unclassified
218 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
219 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.87
Metatranscriptomes 0
Isolates 1.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.82
Nodule 0.56
Rhizoplane 1.69
Rhizosphere 91.55
Stem 0
Stem Tuber 0
Unclassified 1.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451576_0000909 3300045051 Bacteria 56035
2 Ga0065712_10314748 3300005290 Bacteria 829
3 Ga0070676_10012268 3300005328 Bacteria 4673
4 Ga0070670_100051811 3300005331 Bacteria 3524
5 Ga0070670_100067564 3300005331 Bacteria 3067
6 Ga0070670_100114373 3300005331 Bacteria 2326
7 Ga0070677_10001509 3300005333 Bacteria 7370
8 Ga0068869_100024693 3300005334 Bacteria 4165
9 Ga0070666_10057157 3300005335 Bacteria 2636
10 Ga0070666_10304726 3300005335 Bacteria 1135
11 Ga0070680_100024022 3300005336 Bacteria 4865
12 Ga0068868_100316509 3300005338 Bacteria 1329
13 Ga0070661_100009516 3300005344 Bacteria 6732
14 Ga0070668_100004749 3300005347 Bacteria 10080
15 Ga0070669_100005812 3300005353 Bacteria 8897
16 Ga0070675_100291778 3300005354 Bacteria 1435
17 Ga0070675_100412690 3300005354 Bacteria 1206
18 Ga0070675_100580307 3300005354 Bacteria 1016
19 Ga0070671_100062287 3300005355 Bacteria 3106
20 Ga0070671_100366284 3300005355 Bacteria 1231
21 Ga0070674_100011281 3300005356 Bacteria 5435
22 Ga0070674_100027028 3300005356 Bacteria 3756
23 Ga0070673_100087149 3300005364 Bacteria 2544
24 Ga0070673_100189534 3300005364 Bacteria 1765
25 Ga0070667_100003317 3300005367 Bacteria 13761
26 Ga0070667_100014226 3300005367 Bacteria 6573
27 Ga0070700_100051444 3300005441 Bacteria 2564
28 Ga0070700_100232028 3300005441 Bacteria 1314
29 Ga0070663_100210087 3300005455 Bacteria 1524
30 Ga0070663_100495486 3300005455 Bacteria 1014
31 Ga0070678_100560391 3300005456 Bacteria 1015
32 Ga0070662_100028972 3300005457 Bacteria 3859
33 Ga0070662_100052757 3300005457 Bacteria 2941
34 Ga0068867_100000085 3300005459 Bacteria 58473
35 Ga0068867_100001695 3300005459 Bacteria 15364
36 Ga0068867_100017886 3300005459 Bacteria 5035
37 Ga0068867_100326229 3300005459 Bacteria 1273
38 Ga0068867_100583509 3300005459 Unclassified 973
39 Ga0070679_100036124 3300005530 Bacteria 4903
40 Ga0068853_100067194 3300005539 Bacteria 3114
41 Ga0068853_100368953 3300005539 Bacteria 1339
42 Ga0070672_100018179 3300005543 Bacteria 5075
43 Ga0070672_100023511 3300005543 Bacteria 4544
44 Ga0070672_100062850 3300005543 Bacteria 2931
45 Ga0070672_100152671 3300005543 Bacteria 1911
46 Ga0070672_100170737 3300005543 Bacteria 1808
47 Ga0070665_100472255 3300005548 Bacteria 1265
48 Ga0070664_100150146 3300005564 Bacteria 2057
49 Ga0070664_100915940 3300005564 Bacteria 822
50 Ga0068857_100236662 3300005577 Bacteria 1671
51 Ga0068854_100066990 3300005578 Bacteria 2615
52 Ga0068854_100333375 3300005578 Bacteria 1237
53 Ga0068856_100023452 3300005614 Bacteria 6000
54 Ga0068852_100013224 3300005616 Bacteria 6309
55 Ga0068852_100046171 3300005616 Bacteria 3710
56 Ga0068852_100046991 3300005616 Bacteria 3680
57 Ga0068852_100247035 3300005616 Bacteria 1708
58 Ga0068859_100183425 3300005617 Bacteria 2176
59 Ga0068859_100284786 3300005617 Bacteria 1745
60 Ga0068859_100292892 3300005617 Bacteria 1721
61 Ga0068859_100528239 3300005617 Bacteria 1275
62 Ga0068864_100343647 3300005618 Bacteria 1407
63 Ga0068866_10006663 3300005718 Bacteria 4817
64 Ga0068861_100000582 3300005719 Bacteria 21639
65 Ga0068863_100037925 3300005841 Bacteria 4586
66 Ga0068858_100010943 3300005842 Bacteria 8575
67 Ga0068858_100195061 3300005842 Bacteria 1914
68 Ga0068860_100001910 3300005843 Bacteria 22116
69 Ga0068860_100324206 3300005843 Bacteria 1512
70 Ga0068860_100778677 3300005843 Unclassified 969
71 Ga0068862_100004043 3300005844 Bacteria 12431
72 Ga0068862_100325095 3300005844 Bacteria 1421
73 Ga0070717_10858115 3300006028 Bacteria 826
74 Ga0075364_10347455 3300006051 Bacteria 1011
75 Ga0070712_100202821 3300006175 Bacteria 1559
76 Ga0075367_10243103 3300006178 Bacteria 1128
77 Ga0075366_10010509 3300006195 Bacteria 5197
78 Ga0075366_10211030 3300006195 Bacteria 1182
79 Ga0075366_10290470 3300006195 Bacteria 1000
80 Ga0075370_10010571 3300006353 Bacteria 4831
81 Ga0068871_100467733 3300006358 Bacteria 1132
82 Ga0075429_100001027 3300006880 Bacteria 22297
83 Ga0068865_100001694 3300006881 Bacteria 12918
84 Ga0068865_100021793 3300006881 Bacteria 4171
85 Ga0068865_100165642 3300006881 Bacteria 1690
86 Ga0068865_100528352 3300006881 Bacteria 988
87 Ga0097620_100183432 3300006931 Bacteria 2176
88 Ga0097620_100284786 3300006931 Bacteria 1745
89 Ga0097620_100292891 3300006931 Bacteria 1721
90 Ga0097620_100528180 3300006931 Bacteria 1275
91 Ga0099826_10240609 3300006948 Bacteria 960
92 Ga0105240_10073719 3300009093 Bacteria 4215
93 Ga0105245_10222839 3300009098 Bacteria 1821
94 Ga0105243_10009310 3300009148 Bacteria 7491
95 Ga0105243_10358638 3300009148 Bacteria 1341
96 Ga0105242_10113425 3300009176 Bacteria 2315
97 Ga0105242_10322245 3300009176 Bacteria 1418
98 Ga0105242_10340801 3300009176 Bacteria 1381
99 Ga0105248_11282259 3300009177 Bacteria 829
100 Ga0105249_10232419 3300009553 Bacteria 1819
101 Ga0105249_10593380 3300009553 Bacteria 1162
102 Ga0105239_10815787 3300010375 Bacteria 1069
103 Ga0105239_11193372 3300010375 Bacteria 877
104 Ga0105239_12342405 3300010375 Bacteria 622
105 Ga0157371_10255248 3300013102 Bacteria 1263
106 Ga0157374_10025500 3300013296 Bacteria 5309
107 Ga0157374_10252179 3300013296 Bacteria 1737
108 Ga0157378_10000558 3300013297 Bacteria 35454
109 Ga0157378_10165963 3300013297 Bacteria 2068
110 Ga0163162_10002211 3300013306 Bacteria 18267
111 Ga0163162_10226292 3300013306 Bacteria 2000
112 Ga0163162_10431309 3300013306 Bacteria 1450
113 Ga0157372_10641851 3300013307 Bacteria 1236
114 Ga0157375_10070238 3300013308 Bacteria 3511
115 Ga0157375_10436071 3300013308 Bacteria 1476
116 Ga0157375_10649840 3300013308 Bacteria 1211
117 Ga0163163_10464087 3300014325 Bacteria 1327
118 Ga0157380_10022686 3300014326 Bacteria 4731
119 Ga0157380_10179714 3300014326 Bacteria 1858
120 Ga0157380_10321458 3300014326 Bacteria 1435
121 Ga0157377_10000028 3300014745 Bacteria 134810
122 Ga0157379_10112216 3300014968 Bacteria 2450
123 Ga0157376_10093409 3300014969 Bacteria 2611
124 Ga0182006_1101606 3300015261 Bacteria 1020
125 Ga0163161_10022683 3300017792 Bacteria 4421
126 Ga0163161_10033682 3300017792 Bacteria 3661
127 Ga0207697_10114864 3300025315 Bacteria 1155
128 Ga0207656_10156561 3300025321 Bacteria 1082
129 Ga0207682_10005147 3300025893 Bacteria 5357
130 Ga0207682_10010051 3300025893 Bacteria 3715
131 Ga0207682_10207059 3300025893 Bacteria 904
132 Ga0207642_10007496 3300025899 Bacteria 3690
133 Ga0207688_10057510 3300025901 Bacteria 2186
134 Ga0207680_10044633 3300025903 Bacteria 2608
135 Ga0207645_10017366 3300025907 Bacteria 4750
136 Ga0207695_10107860 3300025913 Bacteria 2770
137 Ga0207671_10045713 3300025914 Bacteria 3238
138 Ga0207660_10080147 3300025917 Bacteria 2396
139 Ga0207662_10037163 3300025918 Bacteria 2850
140 Ga0207649_10048010 3300025920 Bacteria 2631
141 Ga0207652_10002539 3300025921 Bacteria 15323
142 Ga0207681_10028924 3300025923 Bacteria 3593
143 Ga0207650_10006252 3300025925 Bacteria 8115
144 Ga0207650_10189274 3300025925 Bacteria 1644
145 Ga0207650_10210743 3300025925 Bacteria 1560
146 Ga0207650_10312732 3300025925 Bacteria 1285
147 Ga0207659_10070921 3300025926 Bacteria 2542
148 Ga0207659_10529486 3300025926 Bacteria 1000
149 Ga0207687_10083429 3300025927 Bacteria 2314
150 Ga0207687_10157194 3300025927 Bacteria 1741
151 Ga0207644_10001435 3300025931 Bacteria 15350
152 Ga0207644_10095903 3300025931 Bacteria 2219
153 Ga0207690_10087804 3300025932 Bacteria 2189
154 Ga0207706_10000845 3300025933 Bacteria 31549
155 Ga0207706_10052506 3300025933 Bacteria 3599
156 Ga0207706_10169715 3300025933 Bacteria 1917
157 Ga0207686_10129532 3300025934 Bacteria 1729
158 Ga0207686_10516602 3300025934 Bacteria 929
159 Ga0207686_10630327 3300025934 Bacteria 846
160 Ga0207709_10002462 3300025935 Bacteria 11620
161 Ga0207709_10203237 3300025935 Bacteria 1416
162 Ga0207669_10013736 3300025937 Bacteria 4035
163 Ga0207669_10014175 3300025937 Bacteria 3988
164 Ga0207704_10003573 3300025938 Bacteria 7066
165 Ga0207704_10098517 3300025938 Bacteria 1942
166 Ga0207704_10115902 3300025938 Bacteria 1822
167 Ga0207691_10018444 3300025940 Bacteria 6613
168 Ga0207691_10044937 3300025940 Bacteria 4063
169 Ga0207691_10148347 3300025940 Bacteria 2063
170 Ga0207691_10325243 3300025940 Bacteria 1318
171 Ga0207691_10348660 3300025940 Bacteria 1267
172 Ga0207691_10360167 3300025940 Bacteria 1244
173 Ga0207711_10564598 3300025941 Bacteria 1061
174 Ga0207689_10020073 3300025942 Bacteria 5626
175 Ga0207651_10021817 3300025960 Bacteria 3901
176 Ga0207651_10161238 3300025960 Bacteria 1758
177 Ga0207651_10223900 3300025960 Bacteria 1522
178 Ga0207651_10374983 3300025960 Bacteria 1204
179 Ga0207712_10013145 3300025961 Bacteria 5304
180 Ga0207712_10045602 3300025961 Bacteria 3036
181 Ga0207712_10683606 3300025961 Unclassified 894
182 Ga0207668_10014832 3300025972 Bacteria 4830
183 Ga0207640_10020727 3300025981 Bacteria 3907
184 Ga0207640_10118985 3300025981 Bacteria 1888
185 Ga0207658_10003189 3300025986 Bacteria 11689
186 Ga0207658_10006549 3300025986 Bacteria 7942
187 Ga0207658_10147601 3300025986 Bacteria 1912
188 Ga0207677_10362236 3300026023 Bacteria 1218
189 Ga0207703_10182414 3300026035 Bacteria 1853
190 Ga0207639_10219209 3300026041 Bacteria 1642
191 Ga0207678_10031379 3300026067 Bacteria 4635
192 Ga0207708_10070621 3300026075 Bacteria 2674
193 Ga0207708_10225929 3300026075 Bacteria 1501
194 Ga0207702_10040894 3300026078 Bacteria 3886
195 Ga0207641_10006217 3300026088 Bacteria 10101
196 Ga0207648_10000146 3300026089 Bacteria 70573
197 Ga0207648_10002481 3300026089 Bacteria 19810
198 Ga0207648_10005079 3300026089 Bacteria 13337
199 Ga0207648_10073224 3300026089 Bacteria 2986
200 Ga0207648_10221975 3300026089 Bacteria 1680
201 Ga0207676_10041792 3300026095 Bacteria 3522
202 Ga0207676_10454538 3300026095 Bacteria 1208
203 Ga0207676_10894011 3300026095 Bacteria 871
204 Ga0207675_100004297 3300026118 Bacteria 13767
205 Ga0207675_100009279 3300026118 Bacteria 9227
206 Ga0207683_10012690 3300026121 Bacteria 7187
207 Ga0207683_10013995 3300026121 Bacteria 6840
208 Ga0207683_10312977 3300026121 Bacteria 1437
209 Ga0207698_10083790 3300026142 Bacteria 2582
210 Ga0209281_1017516 3300027111 Bacteria 1450
211 Ga0209996_1001316 3300027395 Bacteria 2973
212 Ga0209995_1009423 3300027471 Bacteria 1579
213 Ga0209968_1001732 3300027526 Bacteria 3302
214 Ga0209966_1000036 3300027695 Bacteria 55883
215 Ga0268265_10005309 3300028380 Bacteria 8830
216 Ga0268265_10192540 3300028380 Bacteria 1762
217 Ga0268264_10004254 3300028381 Bacteria 12219
218 Ga0268264_10011851 3300028381 Bacteria 7185
219 Ga0268264_10742201 3300028381 Unclassified 977
220 Ga0307515_10002466 3300028794 Bacteria 40227
221 Ga0307515_10185366 3300028794 Bacteria 2013
222 Ga0307512_10144600 3300030522 Bacteria 1443
223 Ga0316177_1017130 3300030731 Bacteria 678
224 Ga0316177_1053075 3300030731 Bacteria 3886
225 Ga0316176_1079732 3300030732 Bacteria 1656
226 Ga0314311_1063365 3300030733 Bacteria 11084
227 Ga0316179_1060310 3300030734 Bacteria 4794
228 Ga0316178_1108720 3300030735 Bacteria 5188
229 Ga0316183_1062567 3300030742 Bacteria 3572
230 Ga0316181_1287950 3300030744 Bacteria 1666
231 Ga0316182_1237975 3300030745 Bacteria 2917
232 Ga0265327_10061913 3300031251 Bacteria 1907
233 Ga0307513_10034454 3300031456 Bacteria 5682
234 Ga0307408_100439964 3300031548 Bacteria 1128
235 Ga0307514_10001019 3300031649 Bacteria 40708
236 Ga0307516_10003697 3300031730 Bacteria 19455
237 Ga0307516_10019850 3300031730 Bacteria 6949
238 Ga0307516_10069627 3300031730 Bacteria 3383
239 Ga0307405_10015293 3300031731 Bacteria 4152
240 Ga0307413_10121518 3300031824 Bacteria 1770
241 Ga0307410_10237825 3300031852 Bacteria 1410
242 Ga0307406_10007947 3300031901 Bacteria 5907
243 Ga0307407_10070874 3300031903 Bacteria 2073
244 Ga0307412_10022254 3300031911 Bacteria 3883
245 Ga0307412_10065299 3300031911 Bacteria 2462
246 Ga0307412_10364109 3300031911 Bacteria 1165
247 Ga0307412_10423628 3300031911 Bacteria 1089
248 Ga0307416_100223857 3300032002 Bacteria 1807
249 Ga0307416_100253690 3300032002 Bacteria 1714
250 Ga0307416_100997081 3300032002 Bacteria 940
251 Ga0307414_10056915 3300032004 Bacteria 2745
252 Ga0307411_10053085 3300032005 Bacteria 2653
253 Ga0307510_10230938 3300033180 Bacteria 1353
254 Ga0373943_0424332 3300035170 Bacteria 770
255 Ga0373937_0027056 3300036401 Bacteria 5184
256 Ga0373925_0019888 3300037068 Bacteria 4884
257 Ga0395900_0000109 3300037418 Bacteria 146053
258 Ga0395898_0000868 3300037466 Bacteria 49428
259 Ga0395905_0050200 3300037471 Bacteria 3909
260 Ga0395905_0108640 3300037471 Bacteria 2604
261 Ga0451797_0653079 3300041453 Bacteria 1986
262 Ga0451802_1813680 3300041460 Bacteria 1059
263 Ga0451833_0520428 3300041491 Bacteria 771
264 Ga0439431_0008626 3300041997 Bacteria 2295
265 Ga0439449_0013152 3300042007 Bacteria 3114
266 Ga0439450_002823 3300042008 Bacteria 2790
267 Ga0450906_033943 3300042145 Bacteria 901
268 Ga0439434_0045216 3300042435 Bacteria 1358
269 Ga0439434_0067420 3300042435 Bacteria 1124
270 Ga0439459_0058722 3300042438 Bacteria 864
271 Ga0439464_0015768 3300042439 Bacteria 2041
272 Ga0450893_0011571 3300042532 Bacteria 1459
273 Ga0451577_0001509 3300042876 Bacteria 30757
274 Ga0451577_0002068 3300042876 Bacteria 24786
275 Ga0451577_0025140 3300042876 Bacteria 5405
276 Ga0451577_0031768 3300042876 Bacteria 4762
277 Ga0451577_0049369 3300042876 Bacteria 3758
278 Ga0451577_0089232 3300042876 Bacteria 2751
279 Ga0451577_0224071 3300042876 Bacteria 1700
280 Ga0451577_0628205 3300042876 Bacteria 974
281 Ga0439440_0068679 3300042993 Bacteria 918
282 Ga0466969_0000385 3300044656 Bacteria 24302
283 Ga0453683_0007560 3300044673 Bacteria 7360
284 Ga0453683_0021673 3300044673 Bacteria 4100
285 Ga0466966_0006769 3300044684 Bacteria 7588
286 Ga0466961_0064503 3300044693 Bacteria 2327
287 Ga0466961_0085633 3300044693 Bacteria 1992
288 Ga0466963_0052031 3300044694 Bacteria 2716
289 Ga0466964_0004724 3300044706 Bacteria 5032
290 Ga0453684_0000694 3300044712 Bacteria 119688
291 Ga0453684_0009627 3300044712 Bacteria 16847
292 Ga0453684_0032550 3300044712 Bacteria 7294
293 Ga0453684_0239945 3300044712 Bacteria 2087
294 Ga0453684_0368503 3300044712 Bacteria 1615
295 Ga0453684_0391907 3300044712 Bacteria 1557
296 Ga0453684_0563681 3300044712 Bacteria 1253
297 Ga0453684_1400596 3300044712 Bacteria 725
298 Ga0466970_0006015 3300044765 Bacteria 6049
299 Ga0466970_0031405 3300044765 Bacteria 2805
300 Ga0466957_0036602 3300044842 Bacteria 2951
301 Ga0466959_0000371 3300045049 Bacteria 26505
302 Ga0466959_0019290 3300045049 Bacteria 5014
303 Ga0466959_0023670 3300045049 Bacteria 4546
304 Ga0451576_0002187 3300045051 Bacteria 30196
305 Ga0451576_0012822 3300045051 Bacteria 9405
306 Ga0466958_0035526 3300045836 Bacteria 2977
307 Ga0466967_0329216 3300045976 Bacteria 1475
308 Ga0495580_0242703 3300046472 Bacteria 1235
309 Ga0495597_0037428 3300046542 Bacteria 2178
310 Ga0495625_0000250 3300046660 Bacteria 84096
311 Ga0495658_0106630 3300046683 Bacteria 1680
312 Ga0495658_0211774 3300046683 Bacteria 1211
313 Ga0495658_0213131 3300046683 Bacteria 1207
314 Ga0495671_0359414 3300046692 Bacteria 698
315 Ga0495687_000599 3300047443 Bacteria 42066
316 Ga0496101_0179561 3300048904 Bacteria 1630
317 Ga0496108_0155008 3300048911 Bacteria 1978
318 Ga0496109_0200225 3300048912 Bacteria 1877
319 Ga0496109_0494878 3300048912 Bacteria 1154
320 Ga0501292_000588 3300049515 Bacteria 4474
321 Ga0501294_006476 3300049517 Bacteria 1123
322 Ga0501039_0278843 3300049575 Bacteria 1314
323 Ga0501041_0190379 3300049577 Bacteria 1285
324 Ga0501043_0000004 3300049579 Bacteria 291085
325 Ga0501046_0000016 3300049580 Bacteria 234374
326 Ga0501047_0000012 3300049581 Bacteria 368824
327 Ga0501048_0002521 3300049582 Bacteria 13990
328 Ga0501071_0491816 3300049587 Bacteria 941
329 Ga0501071_0826831 3300049587 Bacteria 714
330 Ga0501072_0188259 3300049588 Bacteria 1646
331 Ga0501075_0161265 3300049591 Bacteria 1711
332 Ga0501076_0127709 3300049592 Bacteria 2061
333 Ga0501198_000006 3300049649 Bacteria 129954
334 Ga0501202_069569 3300049652 Bacteria 809
335 Ga0501206_012278 3300049653 Bacteria 1162
336 Ga0501207_016103 3300049654 Bacteria 1157
337 Ga0501222_000007 3300049662 Bacteria 126703
338 Ga0501249_010894 3300049679 Bacteria 1905
339 Ga0501253_023369 3300049683 Bacteria 1111
340 Ga0501257_077625 3300049686 Unclassified 854
341 Ga0501225_0038861 3300049705 Bacteria 1311
342 Ga0501262_000406 3300049759 Bacteria 5202
343 Ga0501281_03173 3300049777 Bacteria 1180
344 Ga0501045_0016671 3300049824 Bacteria 5219
345 Ga0501045_0039715 3300049824 Bacteria 3425
346 nmdc:mga00v17_337350_c1 3300050491 Bacteria 980
347 nmdc:mga0k408_112453_c2 3300050493 Bacteria 1201
348 nmdc:mga0k408_70623_c1 3300050493 Bacteria 2038
349 nmdc:mga07m45_67041_c1 3300050496 Bacteria 2040
350 nmdc:mga09592_3159_c1 3300050508 Bacteria 13376
351 nmdc:mga08y16_487220_c1 3300050511 Bacteria 1254
352 2644221363 2643221639 Bacteria 6649903
353 2842678066 2842677519 Bacteria 5615038
354 2891636178 2891633521 Bacteria 4602265
355 2954768428 2954767861 Bacteria 5535784
356 Ga0451576_0000909
357 Ga0065712_10314748
358 Ga0070676_10012268
359 Ga0070670_100051811
360 Ga0070670_100067564
361 Ga0070670_100114373
362 Ga0070677_10001509
363 Ga0068869_100024693
364 Ga0070666_10057157
365 Ga0070666_10304726
366 Ga0070680_100024022
367 Ga0068868_100316509
368 Ga0070661_100009516
369 Ga0070668_100004749
370 Ga0070669_100005812
371 Ga0070675_100291778
372 Ga0070675_100412690
373 Ga0070675_100580307
374 Ga0070671_100062287
375 Ga0070671_100366284
376 Ga0070674_100011281
377 Ga0070674_100027028
378 Ga0070673_100087149
379 Ga0070673_100189534
380 Ga0070667_100003317
381 Ga0070667_100014226
382 Ga0070700_100051444
383 Ga0070700_100232028
384 Ga0070663_100210087
385 Ga0070663_100495486
386 Ga0070678_100560391
387 Ga0070662_100028972
388 Ga0070662_100052757
389 Ga0068867_100000085
390 Ga0068867_100001695
391 Ga0068867_100017886
392 Ga0068867_100326229
393 Ga0068867_100583509
394 Ga0070679_100036124
395 Ga0068853_100067194
396 Ga0068853_100368953
397 Ga0070672_100018179
398 Ga0070672_100023511
399 Ga0070672_100062850
400 Ga0070672_100152671
401 Ga0070672_100170737
402 Ga0070665_100472255
403 Ga0070664_100150146
404 Ga0070664_100915940
405 Ga0068857_100236662
406 Ga0068854_100066990
407 Ga0068854_100333375
408 Ga0068856_100023452
409 Ga0068852_100013224
410 Ga0068852_100046171
411 Ga0068852_100046991
412 Ga0068852_100247035
413 Ga0068859_100183425
414 Ga0068859_100284786
415 Ga0068859_100292892
416 Ga0068859_100528239
417 Ga0068864_100343647
418 Ga0068866_10006663
419 Ga0068861_100000582
420 Ga0068863_100037925
421 Ga0068858_100010943
422 Ga0068858_100195061
423 Ga0068860_100001910
424 Ga0068860_100324206
425 Ga0068860_100778677
426 Ga0068862_100004043
427 Ga0068862_100325095
428 Ga0070717_10858115
429 Ga0075364_10347455
430 Ga0070712_100202821
431 Ga0075367_10243103
432 Ga0075366_10010509
433 Ga0075366_10211030
434 Ga0075366_10290470
435 Ga0075370_10010571
436 Ga0068871_100467733
437 Ga0075429_100001027
438 Ga0068865_100001694
439 Ga0068865_100021793
440 Ga0068865_100165642
441 Ga0068865_100528352
442 Ga0097620_100183432
443 Ga0097620_100284786
444 Ga0097620_100292891
445 Ga0097620_100528180
446 Ga0099826_10240609
447 Ga0105240_10073719
448 Ga0105245_10222839
449 Ga0105243_10009310
450 Ga0105243_10358638
451 Ga0105242_10113425
452 Ga0105242_10322245
453 Ga0105242_10340801
454 Ga0105248_11282259
455 Ga0105249_10232419
456 Ga0105249_10593380
457 Ga0105239_10815787
458 Ga0105239_11193372
459 Ga0105239_12342405
460 Ga0157371_10255248
461 Ga0157374_10025500
462 Ga0157374_10252179
463 Ga0157378_10000558
464 Ga0157378_10165963
465 Ga0163162_10002211
466 Ga0163162_10226292
467 Ga0163162_10431309
468 Ga0157372_10641851
469 Ga0157375_10070238
470 Ga0157375_10436071
471 Ga0157375_10649840
472 Ga0163163_10464087
473 Ga0157380_10022686
474 Ga0157380_10179714
475 Ga0157380_10321458
476 Ga0157377_10000028
477 Ga0157379_10112216
478 Ga0157376_10093409
479 Ga0182006_1101606
480 Ga0163161_10022683
481 Ga0163161_10033682
482 Ga0207697_10114864
483 Ga0207656_10156561
484 Ga0207682_10005147
485 Ga0207682_10010051
486 Ga0207682_10207059
487 Ga0207642_10007496
488 Ga0207688_10057510
489 Ga0207680_10044633
490 Ga0207645_10017366
491 Ga0207695_10107860
492 Ga0207671_10045713
493 Ga0207660_10080147
494 Ga0207662_10037163
495 Ga0207649_10048010
496 Ga0207652_10002539
497 Ga0207681_10028924
498 Ga0207650_10006252
499 Ga0207650_10189274
500 Ga0207650_10210743
501 Ga0207650_10312732
502 Ga0207659_10070921
503 Ga0207659_10529486
504 Ga0207687_10083429
505 Ga0207687_10157194
506 Ga0207644_10001435
507 Ga0207644_10095903
508 Ga0207690_10087804
509 Ga0207706_10000845
510 Ga0207706_10052506
511 Ga0207706_10169715
512 Ga0207686_10129532
513 Ga0207686_10516602
514 Ga0207686_10630327
515 Ga0207709_10002462
516 Ga0207709_10203237
517 Ga0207669_10013736
518 Ga0207669_10014175
519 Ga0207704_10003573
520 Ga0207704_10098517
521 Ga0207704_10115902
522 Ga0207691_10018444
523 Ga0207691_10044937
524 Ga0207691_10148347
525 Ga0207691_10325243
526 Ga0207691_10348660
527 Ga0207691_10360167
528 Ga0207711_10564598
529 Ga0207689_10020073
530 Ga0207651_10021817
531 Ga0207651_10161238
532 Ga0207651_10223900
533 Ga0207651_10374983
534 Ga0207712_10013145
535 Ga0207712_10045602
536 Ga0207712_10683606
537 Ga0207668_10014832
538 Ga0207640_10020727
539 Ga0207640_10118985
540 Ga0207658_10003189
541 Ga0207658_10006549
542 Ga0207658_10147601
543 Ga0207677_10362236
544 Ga0207703_10182414
545 Ga0207639_10219209
546 Ga0207678_10031379
547 Ga0207708_10070621
548 Ga0207708_10225929
549 Ga0207702_10040894
550 Ga0207641_10006217
551 Ga0207648_10000146
552 Ga0207648_10002481
553 Ga0207648_10005079
554 Ga0207648_10073224
555 Ga0207648_10221975
556 Ga0207676_10041792
557 Ga0207676_10454538
558 Ga0207676_10894011
559 Ga0207675_100004297
560 Ga0207675_100009279
561 Ga0207683_10012690
562 Ga0207683_10013995
563 Ga0207683_10312977
564 Ga0207698_10083790
565 Ga0209281_1017516
566 Ga0209996_1001316
567 Ga0209995_1009423
568 Ga0209968_1001732
569 Ga0209966_1000036
570 Ga0268265_10005309
571 Ga0268265_10192540
572 Ga0268264_10004254
573 Ga0268264_10011851
574 Ga0268264_10742201
575 Ga0307515_10002466
576 Ga0307515_10185366
577 Ga0307512_10144600
578 Ga0316177_1017130
579 Ga0316177_1053075
580 Ga0316176_1079732
581 Ga0314311_1063365
582 Ga0316179_1060310
583 Ga0316178_1108720
584 Ga0316183_1062567
585 Ga0316181_1287950
586 Ga0316182_1237975
587 Ga0265327_10061913
588 Ga0307513_10034454
589 Ga0307408_100439964
590 Ga0307514_10001019
591 Ga0307516_10003697
592 Ga0307516_10019850
593 Ga0307516_10069627
594 Ga0307405_10015293
595 Ga0307413_10121518
596 Ga0307410_10237825
597 Ga0307406_10007947
598 Ga0307407_10070874
599 Ga0307412_10022254
600 Ga0307412_10065299
601 Ga0307412_10364109
602 Ga0307412_10423628
603 Ga0307416_100223857
604 Ga0307416_100253690
605 Ga0307416_100997081
606 Ga0307414_10056915
607 Ga0307411_10053085
608 Ga0307510_10230938
609 Ga0373943_0424332
610 Ga0373937_0027056
611 Ga0373925_0019888
612 Ga0395900_0000109
613 Ga0395898_0000868
614 Ga0395905_0050200
615 Ga0395905_0108640
616 Ga0451797_0653079
617 Ga0451802_1813680
618 Ga0451833_0520428
619 Ga0439431_0008626
620 Ga0439449_0013152
621 Ga0439450_002823
622 Ga0450906_033943
623 Ga0439434_0045216
624 Ga0439434_0067420
625 Ga0439459_0058722
626 Ga0439464_0015768
627 Ga0450893_0011571
628 Ga0451577_0001509
629 Ga0451577_0002068
630 Ga0451577_0025140
631 Ga0451577_0031768
632 Ga0451577_0049369
633 Ga0451577_0089232
634 Ga0451577_0224071
635 Ga0451577_0628205
636 Ga0439440_0068679
637 Ga0466969_0000385
638 Ga0453683_0007560
639 Ga0453683_0021673
640 Ga0466966_0006769
641 Ga0466961_0064503
642 Ga0466961_0085633
643 Ga0466963_0052031
644 Ga0466964_0004724
645 Ga0453684_0000694
646 Ga0453684_0009627
647 Ga0453684_0032550
648 Ga0453684_0239945
649 Ga0453684_0368503
650 Ga0453684_0391907
651 Ga0453684_0563681
652 Ga0453684_1400596
653 Ga0466970_0006015
654 Ga0466970_0031405
655 Ga0466957_0036602
656 Ga0466959_0000371
657 Ga0466959_0019290
658 Ga0466959_0023670
659 Ga0451576_0002187
660 Ga0451576_0012822
661 Ga0466958_0035526
662 Ga0466967_0329216
663 Ga0495580_0242703
664 Ga0495597_0037428
665 Ga0495625_0000250
666 Ga0495658_0106630
667 Ga0495658_0211774
668 Ga0495658_0213131
669 Ga0495671_0359414
670 Ga0495687_000599
671 Ga0496101_0179561
672 Ga0496108_0155008
673 Ga0496109_0200225
674 Ga0496109_0494878
675 Ga0501292_000588
676 Ga0501294_006476
677 Ga0501039_0278843
678 Ga0501041_0190379
679 Ga0501043_0000004
680 Ga0501046_0000016
681 Ga0501047_0000012
682 Ga0501048_0002521
683 Ga0501071_0491816
684 Ga0501071_0826831
685 Ga0501072_0188259
686 Ga0501075_0161265
687 Ga0501076_0127709
688 Ga0501198_000006
689 Ga0501202_069569
690 Ga0501206_012278
691 Ga0501207_016103
692 Ga0501222_000007
693 Ga0501249_010894
694 Ga0501253_023369
695 Ga0501257_077625
696 Ga0501225_0038861
697 Ga0501262_000406
698 Ga0501281_03173
699 Ga0501045_0016671
700 Ga0501045_0039715
701 nmdc:mga00v17_337350_c1
702 nmdc:mga0k408_112453_c2
703 nmdc:mga0k408_70623_c1
704 nmdc:mga07m45_67041_c1
705 nmdc:mga09592_3159_c1
706 nmdc:mga08y16_487220_c1
707 2644221363
708 2842678066
709 2891636178
710 2954768428

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04290

DctQ

Tripartite ATP-independent periplasmic transporters, DctQ component

29

162

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qha-assembly1.cif.gz_A cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from photobacterium profundum in amphipol 0.7257 9 154
7qha-assembly1.cif.gz_A cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from photobacterium profundum in amphipol 0.6939 9 154
8thj-assembly1.cif.gz_B cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from haemophilus influenzae (antiparallel dimer) 0.4938 9 183
8thj-assembly1.cif.gz_B cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from haemophilus influenzae (antiparallel dimer) 0.4455 9 183
6rcu-assembly1.cif.gz_A pfrh5 bound to monoclonal antibodies r5.004 and r5.016 0.3683 11 158
ID Description Score Start End Superfamily
af_P37674_16_146_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7029 20 153 1.20.120.550
af_P37674_16_146_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.6894 20 153 1.20.120.550
af_A0A2R8QSC2_1_189_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.5326 40 157 1.20.140.150
af_Q9Z0S5_1_194_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.5006 36 165 1.20.140.150
af_A0A0R0EVP9_174_336_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4892 14 157 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A257K914-F1-model_v4 TRAP transporter small permease protein 0.9142 69 168 GO:0005886
GO:0022857
AF-A0A6P0T7W3-F1-model_v4 TRAP transporter small permease subunit 0.9086 67 165 GO:0005886
AF-U5D756-F1-model_v4 TRAP-type mannitol/chloroaromatic compound transport system, small permease component 0.9031 2 157 GO:0005886
AF-A0A6S6XXG4-F1-model_v4 TRAP transporter small permease protein 0.8987 1 162 GO:0005886
GO:0022857
AF-A0A177E5L9-F1-model_v4 C4-dicarboxylate ABC transporter substrate-binding protein 0.8978 5 157 GO:0005886

Map