F420205

General Info

Members Datasets Scaffolds Average Seq Length
355 239 710 166

Family's Representative Sequence

Representative Sequence 3300035691|Ga0373931_0895770|Ga0373931_0895770_15_566
Length 183
Sequence MVVPVADEGTSTAGGRMIDQLLRGARAVVSVLRVVAGVLLAASVLLNFANVIGRYFFNASIFWAEEIMLFLMVGCVFLGNGVVAWSGRQLRMDVIVGMMPASVQKILALLSELVFIAAAAAVVAFGWPVIRDLYNFDQRSQSADLPMVIPQVMIPIGLSIMAILVVIRLLTGGDRAHSERTGH

Samples

Sample ID Description Type Environment
1 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
71 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
72 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
73 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
111 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
112 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
113 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
114 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
115 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
116 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
117 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
118 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
119 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
120 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
121 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
122 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
123 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
124 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
125 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
126 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
127 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
128 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
129 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
130 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
131 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
132 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
133 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
134 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
135 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
136 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
137 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
138 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
139 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
140 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
143 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
144 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
145 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
146 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
147 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
148 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
149 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
150 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
151 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
152 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
153 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
154 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
155 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
156 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
157 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
158 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
159 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
160 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
161 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
162 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
163 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
164 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
165 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
166 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
167 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
168 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
169 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
170 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
171 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
172 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
173 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
174 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
175 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
176 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
177 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
178 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
179 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
180 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
181 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
182 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
183 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
184 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
185 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
186 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
187 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
188 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
189 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
190 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
191 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
192 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
193 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
194 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
195 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
196 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
197 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
198 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
199 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
200 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
201 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
202 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
214 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
215 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
216 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
217 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
218 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
219 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
220 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
221 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
222 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
224 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
225 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
226 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
227 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
228 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
229 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
230 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
231 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
232 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
233 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
234 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
235 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
236 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
237 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
238 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
239 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.15
Metatranscriptomes 0.85
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.51
Nodule 0
Rhizoplane 5.07
Rhizosphere 89.86
Stem 0
Stem Tuber 0
Unclassified 9.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373931_0895770 3300035691 Bacteria 596
2 JGI24744J21845_10037622 3300002077 Bacteria 911
3 JGI24034J26672_10028248 3300002239 Bacteria 905
4 JGI24742J22300_10087715 3300002244 Unclassified 593
5 JGI25153J46596_10005253 3300003215 Bacteria 6810
6 JGI25153J46596_10005807 3300003215 Bacteria 6416
7 rootH1_10184333 3300003323 Bacteria 3034
8 rootH1_10187137 3300003323 Bacteria 1592
9 Ga0070658_10040283 3300005327 Bacteria 3769
10 Ga0070676_10263029 3300005328 Bacteria 1156
11 Ga0070683_101200251 3300005329 Bacteria 729
12 Ga0070690_100137094 3300005330 Bacteria 1658
13 Ga0070670_100820013 3300005331 Bacteria 841
14 Ga0068869_100183799 3300005334 Bacteria 1640
15 Ga0070680_100000703 3300005336 Bacteria 23213
16 Ga0070680_100303523 3300005336 Bacteria 1354
17 Ga0070682_100140021 3300005337 Bacteria 1648
18 Ga0068868_100217031 3300005338 Bacteria 1600
19 Ga0070660_100023822 3300005339 Bacteria 4538
20 Ga0070689_100001407 3300005340 Bacteria 15345
21 Ga0070689_100148211 3300005340 Bacteria 1891
22 Ga0070687_100068387 3300005343 Bacteria 1899
23 Ga0070669_100102599 3300005353 Bacteria 2160
24 Ga0070675_100023992 3300005354 Bacteria 4882
25 Ga0070675_100394977 3300005354 Bacteria 1233
26 Ga0070674_100041045 3300005356 Bacteria 3133
27 Ga0070673_100095308 3300005364 Bacteria 2441
28 Ga0070688_100020940 3300005365 Bacteria 3812
29 Ga0070659_100490004 3300005366 Unclassified 1047
30 Ga0070667_100168745 3300005367 Bacteria 1931
31 Ga0070667_100652359 3300005367 Bacteria 972
32 Ga0070714_100289235 3300005435 Bacteria 1525
33 Ga0070713_100673331 3300005436 Bacteria 987
34 Ga0070711_100987464 3300005439 Bacteria 722
35 Ga0070678_100036249 3300005456 Bacteria 3451
36 Ga0070681_10001492 3300005458 Bacteria 20686
37 Ga0070681_10085043 3300005458 Bacteria 3116
38 Ga0070681_10181602 3300005458 Bacteria 2025
39 Ga0068867_100180015 3300005459 Bacteria 1680
40 Ga0070685_10071349 3300005466 Bacteria 2059
41 Ga0070706_100832230 3300005467 Bacteria 854
42 Ga0070679_100026800 3300005530 Bacteria 5668
43 Ga0070697_100441774 3300005536 Unclassified 1132
44 Ga0068853_100584055 3300005539 Unclassified 1060
45 Ga0070686_100245073 3300005544 Bacteria 1306
46 Ga0068855_100161988 3300005563 Bacteria 2538
47 Ga0068855_100185743 3300005563 Bacteria 2348
48 Ga0070702_100312168 3300005615 Bacteria 1092
49 Ga0068859_100090656 3300005617 Bacteria 3108
50 Ga0068859_100190721 3300005617 Bacteria 2134
51 Ga0068864_100232933 3300005618 Bacteria 1704
52 Ga0068866_10042100 3300005718 Bacteria 2271
53 Ga0068866_10123724 3300005718 Bacteria 1461
54 Ga0068861_100145016 3300005719 Bacteria 1942
55 Ga0068863_100229854 3300005841 Bacteria 1789
56 Ga0070717_10293960 3300006028 Unclassified 1443
57 Ga0075362_10058853 3300006177 Bacteria 1734
58 Ga0075366_10001178 3300006195 Bacteria 12963
59 Ga0075370_10237908 3300006353 Bacteria 1078
60 Ga0075370_10557319 3300006353 Bacteria 693
61 Ga0068871_100164566 3300006358 Bacteria 1898
62 Ga0068871_100210947 3300006358 Bacteria 1680
63 Ga0068871_100364230 3300006358 Bacteria 1281
64 Ga0068865_100808510 3300006881 Bacteria 809
65 Ga0068865_101364261 3300006881 Bacteria 632
66 Ga0097620_100090658 3300006931 Bacteria 3108
67 Ga0097620_100190719 3300006931 Bacteria 2134
68 Ga0075435_100799157 3300007076 Bacteria 821
69 Ga0111539_10539971 3300009094 Bacteria 1358
70 Ga0105245_11162122 3300009098 Bacteria 819
71 Ga0105247_10551787 3300009101 Bacteria 847
72 Ga0105247_10647549 3300009101 Unclassified 789
73 Ga0105243_10105811 3300009148 Bacteria 2344
74 Ga0105243_12196956 3300009148 Unclassified 588
75 Ga0105242_10166576 3300009176 Bacteria 1934
76 Ga0105242_10499924 3300009176 Bacteria 1156
77 Ga0105242_10874090 3300009176 Unclassified 896
78 Ga0105248_10122750 3300009177 Bacteria 2930
79 Ga0105249_10809877 3300009553 Bacteria 1001
80 Ga0105249_11089726 3300009553 Bacteria 869
81 Ga0105239_11615896 3300010375 Bacteria 750
82 Ga0105246_11289668 3300011119 Unclassified 676
83 Ga0163162_10344261 3300013306 Bacteria 1623
84 Ga0163162_10448240 3300013306 Bacteria 1423
85 Ga0163162_10822805 3300013306 Bacteria 1045
86 Ga0163162_12357180 3300013306 Bacteria 612
87 Ga0157375_12041326 3300013308 Bacteria 682
88 Ga0163163_10137167 3300014325 Bacteria 2488
89 Ga0163163_10585806 3300014325 Bacteria 1178
90 Ga0163163_10605307 3300014325 Bacteria 1159
91 Ga0157380_10162793 3300014326 Bacteria 1941
92 Ga0157380_10524286 3300014326 Bacteria 1156
93 Ga0157380_11098451 3300014326 Bacteria 834
94 Ga0182008_10033858 3300014497 Bacteria 2563
95 Ga0157379_10081949 3300014968 Bacteria 2890
96 Ga0157376_10360036 3300014969 Bacteria 1395
97 Ga0157376_10498370 3300014969 Bacteria 1196
98 Ga0157376_10560787 3300014969 Bacteria 1132
99 Ga0163161_10657722 3300017792 Bacteria 869
100 Ga0163161_10946867 3300017792 Bacteria 732
101 Ga0228598_1044411 3300024227 Unclassified 879
102 Ga0209758_1000364 3300025297 Bacteria 80651
103 Ga0209758_1030573 3300025297 Bacteria 2228
104 Ga0207426_1017054 3300025302 Bacteria 2591
105 Ga0207682_10027551 3300025893 Bacteria 2263
106 Ga0207642_10060051 3300025899 Unclassified 1761
107 Ga0207642_10094271 3300025899 Bacteria 1487
108 Ga0207642_10107253 3300025899 Bacteria 1415
109 Ga0207688_10060900 3300025901 Bacteria 2127
110 Ga0207680_10334323 3300025903 Bacteria 1062
111 Ga0207699_10101901 3300025906 Bacteria 1823
112 Ga0207699_10516960 3300025906 Bacteria 863
113 Ga0207645_10069934 3300025907 Bacteria 2245
114 Ga0207643_10064822 3300025908 Bacteria 2091
115 Ga0207705_10955625 3300025909 Bacteria 663
116 Ga0207707_10057487 3300025912 Bacteria 3385
117 Ga0207707_10143467 3300025912 Unclassified 2087
118 Ga0207693_10156623 3300025915 Bacteria 1792
119 Ga0207663_10161588 3300025916 Bacteria 1582
120 Ga0207660_10061041 3300025917 Bacteria 2712
121 Ga0207660_10552177 3300025917 Bacteria 937
122 Ga0207660_10555769 3300025917 Bacteria 934
123 Ga0207662_10087713 3300025918 Bacteria 1909
124 Ga0207657_10243276 3300025919 Bacteria 1436
125 Ga0207652_10013664 3300025921 Bacteria 6565
126 Ga0207681_10209355 3300025923 Bacteria 1502
127 Ga0207659_10227472 3300025926 Bacteria 1503
128 Ga0207659_10336067 3300025926 Bacteria 1250
129 Ga0207664_10290068 3300025929 Bacteria 1438
130 Ga0207644_10020644 3300025931 Bacteria 4483
131 Ga0207670_10005143 3300025936 Bacteria 7150
132 Ga0207670_11110964 3300025936 Unclassified 668
133 Ga0207704_10122468 3300025938 Bacteria 1783
134 Ga0207691_10862869 3300025940 Unclassified 759
135 Ga0207689_10334946 3300025942 Bacteria 1257
136 Ga0207667_10516807 3300025949 Bacteria 1210
137 Ga0207651_10086265 3300025960 Bacteria 2281
138 Ga0207712_10688578 3300025961 Bacteria 891
139 Ga0207668_10530719 3300025972 Bacteria 1017
140 Ga0207658_10292733 3300025986 Bacteria 1400
141 Ga0207677_10616660 3300026023 Bacteria 954
142 Ga0207708_10079272 3300026075 Bacteria 2523
143 Ga0207708_10376593 3300026075 Bacteria 1169
144 Ga0207641_10128129 3300026088 Bacteria 2275
145 Ga0207648_10128949 3300026089 Bacteria 2226
146 Ga0207648_10495618 3300026089 Bacteria 1117
147 Ga0207676_10066213 3300026095 Bacteria 2880
148 Ga0207676_11293860 3300026095 Unclassified 724
149 Ga0207675_100416728 3300026118 Bacteria 1326
150 Ga0207683_10539277 3300026121 Bacteria 1078
151 Ga0268266_10147080 3300028379 Unclassified 2120
152 Ga0268265_10213281 3300028380 Bacteria 1684
153 Ga0265338_10003261 3300028800 Bacteria 23067
154 Ga0265763_1002404 3300030763 Bacteria 1434
155 Ga0265773_1026927 3300031018 Bacteria 597
156 Ga0265760_10045255 3300031090 Bacteria 1318
157 Ga0265325_10002536 3300031241 Bacteria 12296
158 Ga0265325_10015646 3300031241 Bacteria 4261
159 Ga0265340_10007715 3300031247 Bacteria 5836
160 Ga0265340_10260883 3300031247 Unclassified 771
161 Ga0265339_10000060 3300031249 Bacteria 97276
162 Ga0265313_10000094 3300031595 Bacteria 89774
163 Ga0265342_10099093 3300031712 Unclassified 1662
164 Ga0373959_0013104 3300034820 Bacteria 1491
165 Ga0373929_0037471 3300035085 Unclassified 1063
166 Ga0373934_0026064 3300035086 Bacteria 2267
167 Ga0373940_0136484 3300035088 Bacteria 772
168 Ga0373951_0068588 3300035091 Bacteria 900
169 Ga0373952_0031368 3300035092 Bacteria 1181
170 Ga0373923_0279359 3300035111 Unclassified 787
171 Ga0373932_0089238 3300035112 Bacteria 986
172 Ga0373939_0014483 3300035114 Bacteria 2047
173 Ga0373945_0035689 3300035116 Bacteria 1778
174 Ga0373954_0088624 3300035118 Bacteria 1484
175 Ga0373956_0100549 3300035119 Bacteria 1341
176 Ga0373956_0260419 3300035119 Bacteria 825
177 Ga0373957_0261907 3300035120 Bacteria 729
178 Ga0373943_0115487 3300035170 Bacteria 1421
179 Ga0373946_0212293 3300035171 Bacteria 931
180 Ga0373955_0041106 3300035172 Bacteria 2476
181 Ga0373942_0113153 3300035207 Bacteria 841
182 Ga0373961_0025140 3300035241 Unclassified 1616
183 Ga0373931_0047055 3300035691 Bacteria 2282
184 Ga0373931_0678805 3300035691 Unclassified 679
185 Ga0373927_0004525 3300035695 Bacteria 9713
186 Ga0373927_0023404 3300035695 Bacteria 4045
187 Ga0373927_0219063 3300035695 Bacteria 1250
188 Ga0373927_0313333 3300035695 Bacteria 1033
189 Ga0373933_0023856 3300035724 Bacteria 3498
190 Ga0373933_0154588 3300035724 Bacteria 1454
191 Ga0373933_0223654 3300035724 Bacteria 1208
192 Ga0373947_0010594 3300035725 Bacteria 5289
193 Ga0373947_0022687 3300035725 Bacteria 3642
194 Ga0373947_0396077 3300035725 Bacteria 931
195 Ga0373947_0442324 3300035725 Bacteria 880
196 Ga0373937_0014971 3300036401 Bacteria 6852
197 Ga0373937_0124732 3300036401 Bacteria 2402
198 Ga0373937_0215328 3300036401 Bacteria 1808
199 Ga0373937_0354749 3300036401 Bacteria 1389
200 Ga0373937_1171411 3300036401 Bacteria 717
201 Ga0373937_1744677 3300036401 Bacteria 569
202 Ga0373925_0015229 3300037068 Bacteria 5560
203 Ga0373925_0584999 3300037068 Bacteria 919
204 Ga0395900_0237392 3300037418 Bacteria 1830
205 Ga0395898_0115388 3300037466 Bacteria 2573
206 Ga0395901_0105941 3300038443 Bacteria 2951
207 Ga0436361_0077243 3300039447 Bacteria 1834
208 Ga0436361_0346058 3300039447 Bacteria 1369
209 Ga0436362_0298939 3300039453 Bacteria 802
210 Ga0439465_0119734 3300041413 Bacteria 922
211 Ga0439441_023122 3300042001 Bacteria 1159
212 Ga0439456_041517 3300042013 Bacteria 997
213 Ga0466966_0006201 3300044684 Bacteria 7905
214 Ga0466961_0040713 3300044693 Bacteria 2978
215 Ga0466961_0219504 3300044693 Bacteria 1172
216 Ga0466961_0229424 3300044693 Bacteria 1143
217 Ga0466963_0055871 3300044694 Bacteria 2626
218 Ga0466963_0090306 3300044694 Bacteria 2086
219 Ga0466963_0502133 3300044694 Bacteria 856
220 Ga0466971_0080750 3300044719 Bacteria 1483
221 Ga0466957_0010047 3300044842 Bacteria 5415
222 Ga0466957_0032256 3300044842 Bacteria 3136
223 Ga0466957_0823233 3300044842 Unclassified 660
224 Ga0466959_0025948 3300045049 Bacteria 4345
225 Ga0466959_0046363 3300045049 Bacteria 3199
226 Ga0466959_0321480 3300045049 Bacteria 1058
227 Ga0466959_0426595 3300045049 Bacteria 900
228 Ga0466958_0058501 3300045836 Bacteria 2343
229 Ga0466958_0393456 3300045836 Bacteria 894
230 Ga0466967_0026387 3300045976 Bacteria 4812
231 Ga0466967_0210311 3300045976 Bacteria 1845
232 Ga0495592_0455224 3300046454 Bacteria 801
233 Ga0495629_0073416 3300046459 Bacteria 2389
234 Ga0495629_0203143 3300046459 Bacteria 1370
235 Ga0495653_0003256 3300046463 Bacteria 13027
236 Ga0495653_0827419 3300046463 Bacteria 555
237 Ga0495582_0268531 3300046473 Bacteria 979
238 Ga0495662_0002658 3300046476 Bacteria 9031
239 Ga0495664_0001449 3300046477 Bacteria 12569
240 Ga0495608_0101667 3300046511 Bacteria 1853
241 Ga0495618_0000471 3300046514 Bacteria 28723
242 Ga0495630_0015709 3300046517 Bacteria 5531
243 Ga0495630_0335923 3300046517 Bacteria 1156
244 Ga0495652_0015923 3300046529 Bacteria 6730
245 Ga0495652_0069956 3300046529 Bacteria 2936
246 Ga0495652_0076426 3300046529 Bacteria 2778
247 Ga0495652_0499621 3300046529 Unclassified 844
248 Ga0495665_0058928 3300046531 Bacteria 2027
249 Ga0495665_0152753 3300046531 Bacteria 1205
250 Ga0495640_0002578 3300046533 Bacteria 14574
251 Ga0495587_0009112 3300046536 Bacteria 6369
252 Ga0495587_0250463 3300046536 Bacteria 996
253 Ga0495598_0145716 3300046537 Bacteria 823
254 Ga0495645_0004015 3300046543 Bacteria 10049
255 Ga0495667_0185642 3300046559 Bacteria 1333
256 Ga0495667_0216713 3300046559 Unclassified 1222
257 Ga0495634_0006939 3300046642 Bacteria 8553
258 Ga0495634_0303723 3300046642 Unclassified 964
259 Ga0495635_0001072 3300046663 Bacteria 18142
260 Ga0495635_0386385 3300046663 Bacteria 931
261 Ga0495657_0537602 3300046675 Bacteria 679
262 Ga0495623_0363975 3300046679 Bacteria 785
263 Ga0495646_0015255 3300046680 Bacteria 4879
264 Ga0495658_0609252 3300046683 Bacteria 700
265 Ga0495613_0508678 3300046689 Unclassified 810
266 Ga0495600_0068328 3300046809 Bacteria 2322
267 Ga0495600_0263461 3300046809 Bacteria 1094
268 Ga0495600_0534563 3300046809 Bacteria 718
269 Ga0495581_0305147 3300047315 Bacteria 930
270 Ga0495604_0085042 3300047317 Bacteria 2361
271 Ga0495604_0299612 3300047317 Bacteria 1080
272 Ga0495604_0601820 3300047317 Bacteria 705
273 Ga0495674_0004573 3300047319 Bacteria 13302
274 Ga0495674_0934651 3300047319 Bacteria 668
275 Ga0495680_0124201 3300047322 Bacteria 1903
276 Ga0495680_0159949 3300047322 Bacteria 1636
277 Ga0495680_0294479 3300047322 Bacteria 1141
278 Ga0495675_0209745 3300047444 Bacteria 1183
279 Ga0495684_0064307 3300047471 Bacteria 2788
280 Ga0495684_0142750 3300047471 Bacteria 1795
281 Ga0495684_0532213 3300047471 Unclassified 803
282 Ga0495593_0052352 3300047673 Bacteria 2158
283 Ga0495593_0107060 3300047673 Bacteria 1430
284 Ga0495602_0223049 3300048088 Bacteria 1421
285 Ga0496100_0045918 3300048903 Bacteria 2805
286 Ga0496101_0101178 3300048904 Bacteria 2157
287 Ga0496101_0574667 3300048904 Bacteria 891
288 Ga0496101_0916082 3300048904 Archaea 690
289 Ga0496102_0053773 3300048905 Bacteria 3670
290 Ga0496103_0130864 3300048906 Bacteria 1602
291 Ga0496104_0022495 3300048907 Bacteria 5791
292 Ga0496104_1242955 3300048907 Bacteria 648
293 Ga0496105_0005429 3300048908 Bacteria 9672
294 Ga0496106_0248277 3300048909 Bacteria 1422
295 Ga0496108_0039004 3300048911 Bacteria 3959
296 Ga0496108_0055563 3300048911 Bacteria 3325
297 Ga0496109_0104783 3300048912 Bacteria 2626
298 Ga0496109_0107786 3300048912 Bacteria 2588
299 Ga0496109_0345544 3300048912 Bacteria 1405
300 Ga0496110_1153967 3300048913 Bacteria 683
301 Ga0496111_0024947 3300048914 Bacteria 4217
302 Ga0496114_0163043 3300048917 Bacteria 1939
303 Ga0501031_0002680 3300049568 Bacteria 11332
304 Ga0501032_0003844 3300049569 Bacteria 11408
305 Ga0501033_0222090 3300049570 Bacteria 1344
306 Ga0501034_0439012 3300049571 Bacteria 1224
307 Ga0501037_0010757 3300049573 Bacteria 6722
308 Ga0501038_0040472 3300049574 Bacteria 4070
309 Ga0501038_0236285 3300049574 Bacteria 1452
310 Ga0501039_0157848 3300049575 Unclassified 1782
311 Ga0501043_0132845 3300049579 Bacteria 1950
312 Ga0501046_0044930 3300049580 Bacteria 3511
313 Ga0501047_0143463 3300049581 Bacteria 2266
314 Ga0501047_0254402 3300049581 Bacteria 1605
315 Ga0501047_0264634 3300049581 Bacteria 1566
316 Ga0501048_0002144 3300049582 Bacteria 15054
317 Ga0501067_0065524 3300049583 Bacteria 2011
318 Ga0501067_0116246 3300049583 Bacteria 1488
319 Ga0501068_0161823 3300049584 Bacteria 1411
320 Ga0501069_0012053 3300049585 Bacteria 4590
321 Ga0501073_0203325 3300049589 Bacteria 1369
322 Ga0501074_0003839 3300049590 Bacteria 10691
323 Ga0501077_0246526 3300049593 Unclassified 1136
324 Ga0501079_0061322 3300049741 Bacteria 2901
325 Ga0501080_0028107 3300049742 Bacteria 5229
326 Ga0501083_0010448 3300049744 Bacteria 6536
327 Ga0501035_0359769 3300049822 Bacteria 1216
328 Ga0501044_0000420 3300049823 Bacteria 52415
329 Ga0501044_0048096 3300049823 Bacteria 4407
330 nmdc:mga03683_46248_c1 3300050489 Bacteria 1803
331 nmdc:mga0k408_85822_c1 3300050493 Bacteria 1848
332 nmdc:mga06z11_454448_c1 3300050494 Bacteria 774
333 nmdc:mga04h51_247617_c1 3300050495 Bacteria 713
334 nmdc:mga07m45_199388_c1 3300050496 Bacteria 1164
335 nmdc:mga08y16_409538_c1 3300050511 Bacteria 1387
336 nmdc:mga0rr50_1422182_c1 3300050513 Bacteria 587
337 nmdc:mga0rr50_664990_c1 3300050513 Bacteria 889
338 Ga0495601_0004389 3300053077 Bacteria 8150
339 Ga0495601_0006466 3300053077 Bacteria 6853
340 Ga0495601_0029545 3300053077 Bacteria 3401
341 Ga0495612_0003496 3300053078 Bacteria 6513
342 Ga0495612_0256919 3300053078 Unclassified 778
343 Ga0495595_0014091 3300053084 Bacteria 3386
344 Ga0495595_0015981 3300053084 Bacteria 3205
345 Ga0495595_0329176 3300053084 Bacteria 770
346 Ga0495619_0001812 3300053085 Bacteria 14213
347 Ga0495619_0006175 3300053085 Bacteria 7592
348 Ga0495619_0088486 3300053085 Bacteria 2094
349 Ga0495619_0093532 3300053085 Bacteria 2038
350 Ga0495619_0363734 3300053085 Unclassified 1000
351 Ga0500578_0400896 3300053086 Bacteria 791
352 Ga0500568_0126886 3300053139 Bacteria 949
353 Ga0501084_0080391 3300054114 Bacteria 2733
354 Ga0501082_0266930 3300060353 Bacteria 1489
355 Ga0466962_0114068 3300061719 Bacteria 1302
356 Ga0373931_0895770
357 JGI24744J21845_10037622
358 JGI24034J26672_10028248
359 JGI24742J22300_10087715
360 JGI25153J46596_10005253
361 JGI25153J46596_10005807
362 rootH1_10184333
363 rootH1_10187137
364 Ga0070658_10040283
365 Ga0070676_10263029
366 Ga0070683_101200251
367 Ga0070690_100137094
368 Ga0070670_100820013
369 Ga0068869_100183799
370 Ga0070680_100000703
371 Ga0070680_100303523
372 Ga0070682_100140021
373 Ga0068868_100217031
374 Ga0070660_100023822
375 Ga0070689_100001407
376 Ga0070689_100148211
377 Ga0070687_100068387
378 Ga0070669_100102599
379 Ga0070675_100023992
380 Ga0070675_100394977
381 Ga0070674_100041045
382 Ga0070673_100095308
383 Ga0070688_100020940
384 Ga0070659_100490004
385 Ga0070667_100168745
386 Ga0070667_100652359
387 Ga0070714_100289235
388 Ga0070713_100673331
389 Ga0070711_100987464
390 Ga0070678_100036249
391 Ga0070681_10001492
392 Ga0070681_10085043
393 Ga0070681_10181602
394 Ga0068867_100180015
395 Ga0070685_10071349
396 Ga0070706_100832230
397 Ga0070679_100026800
398 Ga0070697_100441774
399 Ga0068853_100584055
400 Ga0070686_100245073
401 Ga0068855_100161988
402 Ga0068855_100185743
403 Ga0070702_100312168
404 Ga0068859_100090656
405 Ga0068859_100190721
406 Ga0068864_100232933
407 Ga0068866_10042100
408 Ga0068866_10123724
409 Ga0068861_100145016
410 Ga0068863_100229854
411 Ga0070717_10293960
412 Ga0075362_10058853
413 Ga0075366_10001178
414 Ga0075370_10237908
415 Ga0075370_10557319
416 Ga0068871_100164566
417 Ga0068871_100210947
418 Ga0068871_100364230
419 Ga0068865_100808510
420 Ga0068865_101364261
421 Ga0097620_100090658
422 Ga0097620_100190719
423 Ga0075435_100799157
424 Ga0111539_10539971
425 Ga0105245_11162122
426 Ga0105247_10551787
427 Ga0105247_10647549
428 Ga0105243_10105811
429 Ga0105243_12196956
430 Ga0105242_10166576
431 Ga0105242_10499924
432 Ga0105242_10874090
433 Ga0105248_10122750
434 Ga0105249_10809877
435 Ga0105249_11089726
436 Ga0105239_11615896
437 Ga0105246_11289668
438 Ga0163162_10344261
439 Ga0163162_10448240
440 Ga0163162_10822805
441 Ga0163162_12357180
442 Ga0157375_12041326
443 Ga0163163_10137167
444 Ga0163163_10585806
445 Ga0163163_10605307
446 Ga0157380_10162793
447 Ga0157380_10524286
448 Ga0157380_11098451
449 Ga0182008_10033858
450 Ga0157379_10081949
451 Ga0157376_10360036
452 Ga0157376_10498370
453 Ga0157376_10560787
454 Ga0163161_10657722
455 Ga0163161_10946867
456 Ga0228598_1044411
457 Ga0209758_1000364
458 Ga0209758_1030573
459 Ga0207426_1017054
460 Ga0207682_10027551
461 Ga0207642_10060051
462 Ga0207642_10094271
463 Ga0207642_10107253
464 Ga0207688_10060900
465 Ga0207680_10334323
466 Ga0207699_10101901
467 Ga0207699_10516960
468 Ga0207645_10069934
469 Ga0207643_10064822
470 Ga0207705_10955625
471 Ga0207707_10057487
472 Ga0207707_10143467
473 Ga0207693_10156623
474 Ga0207663_10161588
475 Ga0207660_10061041
476 Ga0207660_10552177
477 Ga0207660_10555769
478 Ga0207662_10087713
479 Ga0207657_10243276
480 Ga0207652_10013664
481 Ga0207681_10209355
482 Ga0207659_10227472
483 Ga0207659_10336067
484 Ga0207664_10290068
485 Ga0207644_10020644
486 Ga0207670_10005143
487 Ga0207670_11110964
488 Ga0207704_10122468
489 Ga0207691_10862869
490 Ga0207689_10334946
491 Ga0207667_10516807
492 Ga0207651_10086265
493 Ga0207712_10688578
494 Ga0207668_10530719
495 Ga0207658_10292733
496 Ga0207677_10616660
497 Ga0207708_10079272
498 Ga0207708_10376593
499 Ga0207641_10128129
500 Ga0207648_10128949
501 Ga0207648_10495618
502 Ga0207676_10066213
503 Ga0207676_11293860
504 Ga0207675_100416728
505 Ga0207683_10539277
506 Ga0268266_10147080
507 Ga0268265_10213281
508 Ga0265338_10003261
509 Ga0265763_1002404
510 Ga0265773_1026927
511 Ga0265760_10045255
512 Ga0265325_10002536
513 Ga0265325_10015646
514 Ga0265340_10007715
515 Ga0265340_10260883
516 Ga0265339_10000060
517 Ga0265313_10000094
518 Ga0265342_10099093
519 Ga0373959_0013104
520 Ga0373929_0037471
521 Ga0373934_0026064
522 Ga0373940_0136484
523 Ga0373951_0068588
524 Ga0373952_0031368
525 Ga0373923_0279359
526 Ga0373932_0089238
527 Ga0373939_0014483
528 Ga0373945_0035689
529 Ga0373954_0088624
530 Ga0373956_0100549
531 Ga0373956_0260419
532 Ga0373957_0261907
533 Ga0373943_0115487
534 Ga0373946_0212293
535 Ga0373955_0041106
536 Ga0373942_0113153
537 Ga0373961_0025140
538 Ga0373931_0047055
539 Ga0373931_0678805
540 Ga0373927_0004525
541 Ga0373927_0023404
542 Ga0373927_0219063
543 Ga0373927_0313333
544 Ga0373933_0023856
545 Ga0373933_0154588
546 Ga0373933_0223654
547 Ga0373947_0010594
548 Ga0373947_0022687
549 Ga0373947_0396077
550 Ga0373947_0442324
551 Ga0373937_0014971
552 Ga0373937_0124732
553 Ga0373937_0215328
554 Ga0373937_0354749
555 Ga0373937_1171411
556 Ga0373937_1744677
557 Ga0373925_0015229
558 Ga0373925_0584999
559 Ga0395900_0237392
560 Ga0395898_0115388
561 Ga0395901_0105941
562 Ga0436361_0077243
563 Ga0436361_0346058
564 Ga0436362_0298939
565 Ga0439465_0119734
566 Ga0439441_023122
567 Ga0439456_041517
568 Ga0466966_0006201
569 Ga0466961_0040713
570 Ga0466961_0219504
571 Ga0466961_0229424
572 Ga0466963_0055871
573 Ga0466963_0090306
574 Ga0466963_0502133
575 Ga0466971_0080750
576 Ga0466957_0010047
577 Ga0466957_0032256
578 Ga0466957_0823233
579 Ga0466959_0025948
580 Ga0466959_0046363
581 Ga0466959_0321480
582 Ga0466959_0426595
583 Ga0466958_0058501
584 Ga0466958_0393456
585 Ga0466967_0026387
586 Ga0466967_0210311
587 Ga0495592_0455224
588 Ga0495629_0073416
589 Ga0495629_0203143
590 Ga0495653_0003256
591 Ga0495653_0827419
592 Ga0495582_0268531
593 Ga0495662_0002658
594 Ga0495664_0001449
595 Ga0495608_0101667
596 Ga0495618_0000471
597 Ga0495630_0015709
598 Ga0495630_0335923
599 Ga0495652_0015923
600 Ga0495652_0069956
601 Ga0495652_0076426
602 Ga0495652_0499621
603 Ga0495665_0058928
604 Ga0495665_0152753
605 Ga0495640_0002578
606 Ga0495587_0009112
607 Ga0495587_0250463
608 Ga0495598_0145716
609 Ga0495645_0004015
610 Ga0495667_0185642
611 Ga0495667_0216713
612 Ga0495634_0006939
613 Ga0495634_0303723
614 Ga0495635_0001072
615 Ga0495635_0386385
616 Ga0495657_0537602
617 Ga0495623_0363975
618 Ga0495646_0015255
619 Ga0495658_0609252
620 Ga0495613_0508678
621 Ga0495600_0068328
622 Ga0495600_0263461
623 Ga0495600_0534563
624 Ga0495581_0305147
625 Ga0495604_0085042
626 Ga0495604_0299612
627 Ga0495604_0601820
628 Ga0495674_0004573
629 Ga0495674_0934651
630 Ga0495680_0124201
631 Ga0495680_0159949
632 Ga0495680_0294479
633 Ga0495675_0209745
634 Ga0495684_0064307
635 Ga0495684_0142750
636 Ga0495684_0532213
637 Ga0495593_0052352
638 Ga0495593_0107060
639 Ga0495602_0223049
640 Ga0496100_0045918
641 Ga0496101_0101178
642 Ga0496101_0574667
643 Ga0496101_0916082
644 Ga0496102_0053773
645 Ga0496103_0130864
646 Ga0496104_0022495
647 Ga0496104_1242955
648 Ga0496105_0005429
649 Ga0496106_0248277
650 Ga0496108_0039004
651 Ga0496108_0055563
652 Ga0496109_0104783
653 Ga0496109_0107786
654 Ga0496109_0345544
655 Ga0496110_1153967
656 Ga0496111_0024947
657 Ga0496114_0163043
658 Ga0501031_0002680
659 Ga0501032_0003844
660 Ga0501033_0222090
661 Ga0501034_0439012
662 Ga0501037_0010757
663 Ga0501038_0040472
664 Ga0501038_0236285
665 Ga0501039_0157848
666 Ga0501043_0132845
667 Ga0501046_0044930
668 Ga0501047_0143463
669 Ga0501047_0254402
670 Ga0501047_0264634
671 Ga0501048_0002144
672 Ga0501067_0065524
673 Ga0501067_0116246
674 Ga0501068_0161823
675 Ga0501069_0012053
676 Ga0501073_0203325
677 Ga0501074_0003839
678 Ga0501077_0246526
679 Ga0501079_0061322
680 Ga0501080_0028107
681 Ga0501083_0010448
682 Ga0501035_0359769
683 Ga0501044_0000420
684 Ga0501044_0048096
685 nmdc:mga03683_46248_c1
686 nmdc:mga0k408_85822_c1
687 nmdc:mga06z11_454448_c1
688 nmdc:mga04h51_247617_c1
689 nmdc:mga07m45_199388_c1
690 nmdc:mga08y16_409538_c1
691 nmdc:mga0rr50_1422182_c1
692 nmdc:mga0rr50_664990_c1
693 Ga0495601_0004389
694 Ga0495601_0006466
695 Ga0495601_0029545
696 Ga0495612_0003496
697 Ga0495612_0256919
698 Ga0495595_0014091
699 Ga0495595_0015981
700 Ga0495595_0329176
701 Ga0495619_0001812
702 Ga0495619_0006175
703 Ga0495619_0088486
704 Ga0495619_0093532
705 Ga0495619_0363734
706 Ga0500578_0400896
707 Ga0500568_0126886
708 Ga0501084_0080391
709 Ga0501082_0266930
710 Ga0466962_0114068

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04290

DctQ

Tripartite ATP-independent periplasmic transporters, DctQ component

43

172

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qha-assembly1.cif.gz_A cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from photobacterium profundum in amphipol 0.8827 15 154
8thj-assembly1.cif.gz_B cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from haemophilus influenzae (antiparallel dimer) 0.8164 15 157
7qha-assembly1.cif.gz_A cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from photobacterium profundum in amphipol 0.7988 15 154
8thj-assembly1.cif.gz_B cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from haemophilus influenzae (antiparallel dimer) 0.7061 15 157
8hap-assembly1.cif.gz_A crystal structure of thermostable acetaldehyde dehydrogenase from hyperthermophilic archaeon sulfolobus tokodaii 0.6586 9 70
ID Description Score Start End Superfamily
af_P37674_16_146_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.772 29 157 1.20.120.550
af_P37674_16_146_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7271 29 157 1.20.120.550
af_P24485_1_104_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.5436 6 102 1.10.287.70
af_P24485_1_104_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.5073 6 102 1.10.287.70
af_F1QHP6_18_146_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.467 15 154 1.20.140.150
ID Description Score Start End GO Terms
AF-A0A127F230-F1-model_v4 TRAP transporter small permease protein 0.9665 1 167 GO:0005886
GO:0015740
GO:0022857
AF-A0A7C6JT45-F1-model_v4 TRAP transporter small permease 0.9487 10 154 GO:0005886
GO:0015740
GO:0022857
AF-A0A318TQD9-F1-model_v4 TRAP-type C4-dicarboxylate transport system permease small subunit 0.9486 15 154 GO:0005886
GO:0015740
GO:0022857
AF-A0A7C4SAK1-F1-model_v4 TRAP transporter small permease 0.9479 3 154 GO:0005886
GO:0015740
GO:0022857
AF-A0A494ZT40-F1-model_v4 TRAP transporter small permease 0.9441 10 154 GO:0005886
GO:0015740
GO:0022857

Map