F420173

General Info

Members Datasets Scaffolds Average Seq Length
355 213 710 175

Family's Representative Sequence

Representative Sequence 3300026142|Ga0207698_10791923|Ga0207698_107919232
Length 213
Sequence MKRALYNAVAGRAGLIAAMKRAVIVIGLVVFVATLVASMYDLCGWSRSCMAWKHLDTSLHFFLYAAAVLLAAALVAPATGRWLLHAYHLSPSPDADRLVMACRAIAAVFLVAIPLHYVVLKRLLAIVETVRAGDPFVAANALHLQAIAWMLLALQLLSLVIGAISRAVSTPAHPLHLRAGFSISGWLAVLLTFLLARVFAEGALMRDDLEGTV

Samples

Sample ID Description Type Environment
1 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
104 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
154 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
155 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
156 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
157 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
158 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
159 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
160 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
161 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
162 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
163 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
164 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
165 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
166 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
167 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
168 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
169 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
170 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
171 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
172 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
173 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
174 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
175 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
176 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
177 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
178 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
179 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
180 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
181 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
182 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
183 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
184 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
185 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
186 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
187 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
188 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
189 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
196 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
197 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
198 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
199 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
200 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
201 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
202 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
203 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
204 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
205 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
206 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
207 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
208 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
209 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
210 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
211 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
212 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
213 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.28
Nodule 0
Rhizoplane 4.51
Rhizosphere 94.65
Stem 0
Stem Tuber 0
Unclassified 9.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207698_10791923 3300026142 Bacteria 950
2 JGI24752J21851_1007647 3300001976 Bacteria 1410
3 JGI24751J29686_10004648 3300002459 Bacteria 2786
4 Ga0065712_10278298 3300005290 Bacteria 883
5 Ga0065707_10003025 3300005295 Bacteria 5067
6 Ga0070658_10345047 3300005327 Bacteria 1274
7 Ga0070676_10102863 3300005328 Bacteria 1767
8 Ga0070683_100023642 3300005329 Bacteria 5498
9 Ga0070690_100066538 3300005330 Bacteria 2333
10 Ga0070690_100090696 3300005330 Bacteria 2012
11 Ga0070670_100067209 3300005331 Unclassified 3076
12 Ga0070670_100097478 3300005331 Bacteria 2529
13 Ga0070677_10031947 3300005333 Bacteria 2016
14 Ga0068869_100518386 3300005334 Unclassified 997
15 Ga0070666_10046254 3300005335 Bacteria 2918
16 Ga0070680_100378330 3300005336 Bacteria 1205
17 Ga0070682_100010640 3300005337 Bacteria 5227
18 Ga0068868_100199251 3300005338 Bacteria 1668
19 Ga0068868_100734845 3300005338 Bacteria 886
20 Ga0070660_100108918 3300005339 Bacteria 2202
21 Ga0070689_100185298 3300005340 Unclassified 1692
22 Ga0070689_100607844 3300005340 Bacteria 948
23 Ga0070691_10003235 3300005341 Bacteria 7304
24 Ga0070661_100020336 3300005344 Bacteria 4733
25 Ga0070661_101066980 3300005344 Bacteria 672
26 Ga0070668_100068221 3300005347 Bacteria 2764
27 Ga0070669_100016855 3300005353 Bacteria 5215
28 Ga0070669_100041045 3300005353 Bacteria 3364
29 Ga0070669_101120342 3300005353 Bacteria 678
30 Ga0070675_100007041 3300005354 Bacteria 8647
31 Ga0070675_100048316 3300005354 Bacteria 3488
32 Ga0070671_100005274 3300005355 Bacteria 10307
33 Ga0070671_100078705 3300005355 Bacteria 2755
34 Ga0070671_100098298 3300005355 Unclassified 2455
35 Ga0070674_100187600 3300005356 Unclassified 1588
36 Ga0070673_100003117 3300005364 Bacteria 10264
37 Ga0070673_100099216 3300005364 Unclassified 2395
38 Ga0070673_100115648 3300005364 Bacteria 2231
39 Ga0070673_100164829 3300005364 Bacteria 1887
40 Ga0070688_100229121 3300005365 Bacteria 1313
41 Ga0070688_100274569 3300005365 Bacteria 1209
42 Ga0070688_100444915 3300005365 Bacteria 968
43 Ga0070659_100509413 3300005366 Bacteria 1026
44 Ga0070667_100428967 3300005367 Bacteria 1206
45 Ga0070703_10198578 3300005406 Bacteria 786
46 Ga0070701_10006144 3300005438 Bacteria 5034
47 Ga0070701_10636933 3300005438 Bacteria 710
48 Ga0070705_100055663 3300005440 Bacteria 2326
49 Ga0070705_100187166 3300005440 Bacteria 1408
50 Ga0070700_100004985 3300005441 Bacteria 6993
51 Ga0070694_100254859 3300005444 Bacteria 1329
52 Ga0070694_101057789 3300005444 Bacteria 676
53 Ga0070663_100008376 3300005455 Bacteria 6355
54 Ga0070678_100026798 3300005456 Bacteria 3903
55 Ga0070678_100033857 3300005456 Bacteria 3552
56 Ga0070662_100114636 3300005457 Bacteria 2058
57 Ga0070662_100165905 3300005457 Bacteria 1731
58 Ga0070681_11198574 3300005458 Unclassified 681
59 Ga0068867_100009422 3300005459 Bacteria 6888
60 Ga0068867_100109620 3300005459 Bacteria 2119
61 Ga0070685_10078426 3300005466 Unclassified 1974
62 Ga0070706_100004760 3300005467 Bacteria 13013
63 Ga0070706_100011639 3300005467 Bacteria 8171
64 Ga0070707_100002291 3300005468 Bacteria 18295
65 Ga0070707_100154585 3300005468 Bacteria 2234
66 Ga0070699_100010499 3300005518 Bacteria 8011
67 Ga0070684_100189992 3300005535 Bacteria 1868
68 Ga0068853_100360309 3300005539 Bacteria 1354
69 Ga0070672_100089554 3300005543 Bacteria 2480
70 Ga0070672_100095455 3300005543 Bacteria 2405
71 Ga0070672_100098734 3300005543 Bacteria 2365
72 Ga0070686_100601385 3300005544 Bacteria 866
73 Ga0070695_100451977 3300005545 Bacteria 985
74 Ga0070696_100316059 3300005546 Bacteria 1200
75 Ga0070665_100000238 3300005548 Bacteria 91410
76 Ga0070665_100023723 3300005548 Bacteria 6179
77 Ga0070704_100747963 3300005549 Bacteria 870
78 Ga0068855_100178116 3300005563 Bacteria 2404
79 Ga0070664_100215281 3300005564 Bacteria 1717
80 Ga0070664_100569327 3300005564 Bacteria 1049
81 Ga0068857_100001653 3300005577 Bacteria 17904
82 Ga0068854_100027961 3300005578 Unclassified 3892
83 Ga0068854_100187585 3300005578 Bacteria 1619
84 Ga0068854_100272279 3300005578 Bacteria 1360
85 Ga0068856_100225493 3300005614 Unclassified 1889
86 Ga0070702_100019185 3300005615 Bacteria 3561
87 Ga0068852_100026368 3300005616 Bacteria 4722
88 Ga0068859_100045450 3300005617 Bacteria 4412
89 Ga0068859_100126031 3300005617 Bacteria 2629
90 Ga0068859_100139502 3300005617 Bacteria 2498
91 Ga0068859_100172661 3300005617 Unclassified 2243
92 Ga0068859_100325842 3300005617 Bacteria 1630
93 Ga0068859_100907399 3300005617 Bacteria 965
94 Ga0068859_101871074 3300005617 Bacteria 663
95 Ga0068864_100053058 3300005618 Bacteria 3496
96 Ga0068864_100137651 3300005618 Bacteria 2200
97 Ga0068864_101143971 3300005618 Bacteria 776
98 Ga0068866_10069983 3300005718 Bacteria 1850
99 Ga0068861_100082437 3300005719 Bacteria 2520
100 Ga0068861_100496836 3300005719 Unclassified 1102
101 Ga0068870_10019217 3300005840 Unclassified 3311
102 Ga0068870_10112829 3300005840 Bacteria 1555
103 Ga0068870_10175198 3300005840 Bacteria 1283
104 Ga0068863_101465722 3300005841 Bacteria 691
105 Ga0068858_100120200 3300005842 Unclassified 2456
106 Ga0068858_100734035 3300005842 Bacteria 962
107 Ga0068858_101126591 3300005842 Bacteria 771
108 Ga0068858_101500529 3300005842 Bacteria 665
109 Ga0068860_100320845 3300005843 Bacteria 1520
110 Ga0068862_100017030 3300005844 Bacteria 6046
111 Ga0097621_100146286 3300006237 Bacteria 2023
112 Ga0097621_100174495 3300006237 Bacteria 1855
113 Ga0068871_100035073 3300006358 Bacteria 3984
114 Ga0068871_100251217 3300006358 Bacteria 1540
115 Ga0068871_100471096 3300006358 Bacteria 1128
116 Ga0068871_101017631 3300006358 Bacteria 772
117 Ga0075428_100033457 3300006844 Bacteria 5676
118 Ga0075428_100097417 3300006844 Bacteria 3206
119 Ga0075428_100898662 3300006844 Bacteria 939
120 Ga0075431_100011180 3300006847 Bacteria 9039
121 Ga0075431_100366742 3300006847 Bacteria 1446
122 Ga0075433_10054759 3300006852 Bacteria 3480
123 Ga0075434_100026898 3300006871 Bacteria 5643
124 Ga0075434_100717753 3300006871 Bacteria 1017
125 Ga0068865_100099479 3300006881 Bacteria 2126
126 Ga0097620_100045449 3300006931 Bacteria 4412
127 Ga0097620_100126040 3300006931 Bacteria 2629
128 Ga0097620_100139500 3300006931 Bacteria 2498
129 Ga0097620_100172658 3300006931 Unclassified 2243
130 Ga0097620_100325827 3300006931 Bacteria 1630
131 Ga0097620_100907390 3300006931 Bacteria 965
132 Ga0097620_101870640 3300006931 Bacteria 663
133 Ga0105240_10441791 3300009093 Unclassified 1458
134 Ga0111539_10214786 3300009094 Bacteria 2241
135 Ga0105245_10773806 3300009098 Bacteria 997
136 Ga0105247_10937941 3300009101 Bacteria 671
137 Ga0114129_10079876 3300009147 Bacteria 4547
138 Ga0114129_10190039 3300009147 Bacteria 2789
139 Ga0114129_10423101 3300009147 Bacteria 1751
140 Ga0114129_10629002 3300009147 Bacteria 1387
141 Ga0114129_11351415 3300009147 Bacteria 881
142 Ga0105243_10132552 3300009148 Bacteria 2116
143 Ga0105243_10957586 3300009148 Bacteria 856
144 Ga0105241_10014749 3300009174 Bacteria 5720
145 Ga0105242_10030613 3300009176 Bacteria 4297
146 Ga0105242_10321528 3300009176 Bacteria 1419
147 Ga0105248_10012596 3300009177 Bacteria 9330
148 Ga0105248_10199140 3300009177 Bacteria 2256
149 Ga0105248_10233078 3300009177 Bacteria 2072
150 Ga0099796_10002357 3300010159 Bacteria 4131
151 Ga0105239_10355138 3300010375 Bacteria 1655
152 Ga0105246_10011169 3300011119 Bacteria 5566
153 Ga0157315_1038173 3300012508 Bacteria 596
154 Ga0157373_10018525 3300013100 Bacteria 5067
155 Ga0157371_10009000 3300013102 Bacteria 7896
156 Ga0157369_10039419 3300013105 Bacteria 5163
157 Ga0157374_10029690 3300013296 Bacteria 4956
158 Ga0157374_11085610 3300013296 Bacteria 821
159 Ga0157378_10637054 3300013297 Unclassified 1080
160 Ga0157378_10795335 3300013297 Bacteria 971
161 Ga0163162_10074555 3300013306 Bacteria 3452
162 Ga0163162_10221406 3300013306 Bacteria 2022
163 Ga0163162_10312944 3300013306 Bacteria 1703
164 Ga0157372_10267248 3300013307 Bacteria 1987
165 Ga0157375_10023760 3300013308 Bacteria 5663
166 Ga0163163_10026902 3300014325 Bacteria 5503
167 Ga0163163_10135470 3300014325 Bacteria 2504
168 Ga0163163_10798263 3300014325 Bacteria 1007
169 Ga0157380_10324200 3300014326 Bacteria 1429
170 Ga0157377_10006871 3300014745 Bacteria 5457
171 Ga0157377_10108027 3300014745 Bacteria 1668
172 Ga0157377_10739550 3300014745 Bacteria 719
173 Ga0157379_10049806 3300014968 Bacteria 3740
174 Ga0157379_10075833 3300014968 Bacteria 3011
175 Ga0157379_10298969 3300014968 Bacteria 1467
176 Ga0157376_10122847 3300014969 Bacteria 2304
177 Ga0157376_10219809 3300014969 Bacteria 1759
178 Ga0163161_10022371 3300017792 Bacteria 4452
179 Ga0163161_10696363 3300017792 Bacteria 846
180 Ga0213876_10035449 3300021384 Bacteria 2631
181 Ga0207697_10133605 3300025315 Bacteria 1073
182 Ga0207682_10066649 3300025893 Bacteria 1518
183 Ga0207642_10097909 3300025899 Bacteria 1465
184 Ga0207642_10281518 3300025899 Bacteria 957
185 Ga0207680_10047764 3300025903 Bacteria 2538
186 Ga0207680_10052615 3300025903 Unclassified 2441
187 Ga0207647_10004401 3300025904 Bacteria 10445
188 Ga0207645_10006290 3300025907 Bacteria 8535
189 Ga0207645_10007878 3300025907 Bacteria 7490
190 Ga0207643_10008423 3300025908 Bacteria 5534
191 Ga0207643_10536232 3300025908 Bacteria 750
192 Ga0207705_10268586 3300025909 Bacteria 1304
193 Ga0207684_10029951 3300025910 Bacteria 4634
194 Ga0207684_10041020 3300025910 Bacteria 3926
195 Ga0207654_10188840 3300025911 Bacteria 1349
196 Ga0207693_10079454 3300025915 Bacteria 2567
197 Ga0207662_10235851 3300025918 Unclassified 1196
198 Ga0207657_10010709 3300025919 Bacteria 9132
199 Ga0207649_10000805 3300025920 Bacteria 20142
200 Ga0207646_10002879 3300025922 Bacteria 19963
201 Ga0207681_10207652 3300025923 Bacteria 1507
202 Ga0207650_10000541 3300025925 Bacteria 30916
203 Ga0207650_10011172 3300025925 Bacteria 6176
204 Ga0207650_10036817 3300025925 Bacteria 3561
205 Ga0207659_10147373 3300025926 Unclassified 1834
206 Ga0207659_10371698 3300025926 Bacteria 1190
207 Ga0207687_10110852 3300025927 Unclassified 2036
208 Ga0207687_10591184 3300025927 Bacteria 935
209 Ga0207644_10037231 3300025931 Bacteria 3422
210 Ga0207644_10063965 3300025931 Unclassified 2672
211 Ga0207644_10066690 3300025931 Bacteria 2621
212 Ga0207690_10007013 3300025932 Bacteria 6680
213 Ga0207706_10011326 3300025933 Bacteria 8125
214 Ga0207706_11241500 3300025933 Bacteria 618
215 Ga0207686_10673621 3300025934 Bacteria 820
216 Ga0207686_10896633 3300025934 Bacteria 715
217 Ga0207670_10014075 3300025936 Bacteria 4736
218 Ga0207704_10154346 3300025938 Bacteria 1625
219 Ga0207704_10247562 3300025938 Bacteria 1336
220 Ga0207704_10444603 3300025938 Unclassified 1033
221 Ga0207691_10013015 3300025940 Bacteria 7967
222 Ga0207691_10065382 3300025940 Bacteria 3292
223 Ga0207691_10095916 3300025940 Bacteria 2652
224 Ga0207711_10049334 3300025941 Unclassified 3604
225 Ga0207711_10092154 3300025941 Bacteria 2666
226 Ga0207711_10362896 3300025941 Bacteria 1342
227 Ga0207711_10648356 3300025941 Bacteria 985
228 Ga0207689_10006458 3300025942 Bacteria 10366
229 Ga0207689_10098372 3300025942 Bacteria 2403
230 Ga0207689_10243323 3300025942 Bacteria 1487
231 Ga0207689_10670632 3300025942 Bacteria 874
232 Ga0207661_10000122 3300025944 Bacteria 49562
233 Ga0207679_10000870 3300025945 Bacteria 19277
234 Ga0207679_10526270 3300025945 Bacteria 1058
235 Ga0207667_10211004 3300025949 Bacteria 1990
236 Ga0207651_10347727 3300025960 Bacteria 1247
237 Ga0207640_10584366 3300025981 Bacteria 943
238 Ga0207658_10217965 3300025986 Bacteria 1603
239 Ga0207658_10723403 3300025986 Bacteria 900
240 Ga0207677_10145792 3300026023 Bacteria 1819
241 Ga0207677_10427846 3300026023 Bacteria 1129
242 Ga0207703_10183657 3300026035 Bacteria 1847
243 Ga0207703_10215875 3300026035 Bacteria 1713
244 Ga0207703_10524401 3300026035 Bacteria 1115
245 Ga0207703_10532207 3300026035 Bacteria 1106
246 Ga0207639_10833224 3300026041 Bacteria 860
247 Ga0207678_10010978 3300026067 Bacteria 7956
248 Ga0207678_10087708 3300026067 Bacteria 2659
249 Ga0207708_10001998 3300026075 Bacteria 15020
250 Ga0207702_10154160 3300026078 Unclassified 2093
251 Ga0207641_10000006 3300026088 Bacteria 442569
252 Ga0207641_10279780 3300026088 Bacteria 1569
253 Ga0207641_10585444 3300026088 Bacteria 1091
254 Ga0207641_11086005 3300026088 Bacteria 798
255 Ga0207648_10004897 3300026089 Bacteria 13649
256 Ga0207648_10013823 3300026089 Bacteria 7487
257 Ga0207648_10504957 3300026089 Bacteria 1107
258 Ga0207676_10002394 3300026095 Bacteria 13374
259 Ga0207676_10048831 3300026095 Bacteria 3288
260 Ga0207676_10365836 3300026095 Bacteria 1338
261 Ga0207674_10000537 3300026116 Bacteria 49684
262 Ga0207675_100000867 3300026118 Bacteria 30154
263 Ga0207675_100101916 3300026118 Bacteria 2705
264 Ga0207683_10008965 3300026121 Bacteria 8520
265 Ga0207683_10011271 3300026121 Bacteria 7621
266 Ga0268266_10000061 3300028379 Bacteria 255207
267 Ga0268266_10123512 3300028379 Bacteria 2306
268 Ga0268265_10008649 3300028380 Bacteria 6880
269 Ga0268265_10100446 3300028380 Bacteria 2335
270 Ga0268264_10196481 3300028381 Unclassified 1842
271 Ga0268264_10909998 3300028381 Bacteria 883
272 Ga0268264_11174447 3300028381 Bacteria 777
273 Ga0265339_10235829 3300031249 Bacteria 890
274 Ga0265331_10399234 3300031250 Unclassified 616
275 Ga0265314_10151907 3300031711 Bacteria 1419
276 Ga0307405_10034455 3300031731 Bacteria 3013
277 Ga0307405_10104424 3300031731 Bacteria 1907
278 Ga0307406_10056382 3300031901 Bacteria 2516
279 Ga0307407_10122677 3300031903 Bacteria 1650
280 Ga0307412_10014827 3300031911 Bacteria 4607
281 Ga0307412_10057037 3300031911 Bacteria 2605
282 Ga0307409_101434409 3300031995 Bacteria 717
283 Ga0307416_100121446 3300032002 Bacteria 2329
284 Ga0307411_10032084 3300032005 Bacteria 3242
285 Ga0307411_10039590 3300032005 Bacteria 2983
286 Ga0307415_100112514 3300032126 Bacteria 2023
287 Ga0307415_100799178 3300032126 Bacteria 861
288 Ga0373959_0076465 3300034820 Bacteria 765
289 Ga0373939_0299376 3300035114 Bacteria 641
290 Ga0373935_0178230 3300035692 Bacteria 1458
291 Ga0373935_0925925 3300035692 Bacteria 646
292 Ga0373927_0016917 3300035695 Bacteria 4807
293 Ga0373925_0190524 3300037068 Bacteria 1627
294 Ga0395901_0760774 3300038443 Bacteria 961
295 Ga0436365_0456969 3300039437 Bacteria 2764
296 Ga0451577_0361329 3300042876 Bacteria 1317
297 Ga0453684_0307793 3300044712 Bacteria 1799
298 Ga0451576_0215753 3300045051 Bacteria 2004
299 Ga0451576_0252191 3300045051 Bacteria 1844
300 Ga0451576_1055325 3300045051 Bacteria 851
301 Ga0495580_0627807 3300046472 Bacteria 708
302 Ga0495665_0378765 3300046531 Bacteria 719
303 Ga0495621_0153705 3300046539 Bacteria 906
304 Ga0495674_0282388 3300047319 Unclassified 1360
305 Ga0495684_0323061 3300047471 Bacteria 1103
306 Ga0496102_0393968 3300048905 Bacteria 1302
307 Ga0496104_0417530 3300048907 Bacteria 1254
308 Ga0496107_0557247 3300048910 Bacteria 849
309 Ga0496107_0601426 3300048910 Unclassified 813
310 Ga0496108_0000258 3300048911 Bacteria 45782
311 Ga0496108_0219288 3300048911 Bacteria 1653
312 Ga0496109_0000781 3300048912 Bacteria 26465
313 Ga0496109_0776626 3300048912 Bacteria 896
314 Ga0496110_0009726 3300048913 Bacteria 7787
315 Ga0496111_0075009 3300048914 Unclassified 2464
316 Ga0496112_0000081 3300048915 Bacteria 62594
317 Ga0496112_0153262 3300048915 Bacteria 2272
318 Ga0496113_0083821 3300048916 Unclassified 2446
319 Ga0496113_0410651 3300048916 Bacteria 1087
320 Ga0496115_0816324 3300048918 Bacteria 725
321 Ga0496115_1000911 3300048918 Bacteria 639
322 Ga0501031_0264637 3300049568 Bacteria 1117
323 Ga0501036_0598116 3300049572 Bacteria 915
324 Ga0501036_1020538 3300049572 Bacteria 677
325 Ga0501039_0684321 3300049575 Bacteria 802
326 Ga0501040_0110603 3300049576 Bacteria 1921
327 Ga0501041_0068690 3300049577 Bacteria 2172
328 Ga0501048_0506364 3300049582 Bacteria 866
329 Ga0501075_0056332 3300049591 Bacteria 2959
330 Ga0501075_0458773 3300049591 Unclassified 972
331 Ga0501076_0001133 3300049592 Bacteria 17618
332 Ga0501079_0050282 3300049741 Bacteria 3218
333 Ga0501079_0056500 3300049741 Bacteria 3028
334 Ga0501081_0034966 3300049743 Bacteria 3420
335 Ga0501045_0217188 3300049824 Bacteria 1424
336 nmdc:mga0k408_14750_c1 3300050493 Bacteria 4311
337 nmdc:mga05p37_128641_c1 3300050507 Bacteria 3109
338 nmdc:mga05p37_237815_c1 3300050507 Bacteria 2191
339 nmdc:mga05p37_493650_c1 3300050507 Bacteria 1407
340 nmdc:mga09592_119210_c1 3300050508 Bacteria 2265
341 nmdc:mga09592_122076_c1 3300050508 Bacteria 2238
342 nmdc:mga0qj67_902691_c1 3300050509 Bacteria 696
343 nmdc:mga06r32_1061988_c1 3300050510 Bacteria 760
344 nmdc:mga06r32_8990_c1 3300050510 Bacteria 9001
345 nmdc:mga06r32_905285_c1 3300050510 Bacteria 838
346 nmdc:mga08y16_486038_c1 3300050511 Bacteria 1256
347 nmdc:mga0n895_429475_c1 3300050512 Bacteria 1335
348 nmdc:mga0a205_39183_c2 3300050515 Bacteria 2596
349 Ga0501084_0077260 3300054114 Bacteria 2791
350 Ga0501084_0937091 3300054114 Bacteria 728
351 Ga0590071_000630 3300059421 Bacteria 10031
352 Ga0590074_010517 3300059423 Bacteria 1546
353 Ga0590075_000859 3300059424 Bacteria 7971
354 Ga0590077_001351 3300059426 Bacteria 5794
355 Ga0530510_0554898 3300061734 Bacteria 872
356 Ga0207698_10791923
357 JGI24752J21851_1007647
358 JGI24751J29686_10004648
359 Ga0065712_10278298
360 Ga0065707_10003025
361 Ga0070658_10345047
362 Ga0070676_10102863
363 Ga0070683_100023642
364 Ga0070690_100066538
365 Ga0070690_100090696
366 Ga0070670_100067209
367 Ga0070670_100097478
368 Ga0070677_10031947
369 Ga0068869_100518386
370 Ga0070666_10046254
371 Ga0070680_100378330
372 Ga0070682_100010640
373 Ga0068868_100199251
374 Ga0068868_100734845
375 Ga0070660_100108918
376 Ga0070689_100185298
377 Ga0070689_100607844
378 Ga0070691_10003235
379 Ga0070661_100020336
380 Ga0070661_101066980
381 Ga0070668_100068221
382 Ga0070669_100016855
383 Ga0070669_100041045
384 Ga0070669_101120342
385 Ga0070675_100007041
386 Ga0070675_100048316
387 Ga0070671_100005274
388 Ga0070671_100078705
389 Ga0070671_100098298
390 Ga0070674_100187600
391 Ga0070673_100003117
392 Ga0070673_100099216
393 Ga0070673_100115648
394 Ga0070673_100164829
395 Ga0070688_100229121
396 Ga0070688_100274569
397 Ga0070688_100444915
398 Ga0070659_100509413
399 Ga0070667_100428967
400 Ga0070703_10198578
401 Ga0070701_10006144
402 Ga0070701_10636933
403 Ga0070705_100055663
404 Ga0070705_100187166
405 Ga0070700_100004985
406 Ga0070694_100254859
407 Ga0070694_101057789
408 Ga0070663_100008376
409 Ga0070678_100026798
410 Ga0070678_100033857
411 Ga0070662_100114636
412 Ga0070662_100165905
413 Ga0070681_11198574
414 Ga0068867_100009422
415 Ga0068867_100109620
416 Ga0070685_10078426
417 Ga0070706_100004760
418 Ga0070706_100011639
419 Ga0070707_100002291
420 Ga0070707_100154585
421 Ga0070699_100010499
422 Ga0070684_100189992
423 Ga0068853_100360309
424 Ga0070672_100089554
425 Ga0070672_100095455
426 Ga0070672_100098734
427 Ga0070686_100601385
428 Ga0070695_100451977
429 Ga0070696_100316059
430 Ga0070665_100000238
431 Ga0070665_100023723
432 Ga0070704_100747963
433 Ga0068855_100178116
434 Ga0070664_100215281
435 Ga0070664_100569327
436 Ga0068857_100001653
437 Ga0068854_100027961
438 Ga0068854_100187585
439 Ga0068854_100272279
440 Ga0068856_100225493
441 Ga0070702_100019185
442 Ga0068852_100026368
443 Ga0068859_100045450
444 Ga0068859_100126031
445 Ga0068859_100139502
446 Ga0068859_100172661
447 Ga0068859_100325842
448 Ga0068859_100907399
449 Ga0068859_101871074
450 Ga0068864_100053058
451 Ga0068864_100137651
452 Ga0068864_101143971
453 Ga0068866_10069983
454 Ga0068861_100082437
455 Ga0068861_100496836
456 Ga0068870_10019217
457 Ga0068870_10112829
458 Ga0068870_10175198
459 Ga0068863_101465722
460 Ga0068858_100120200
461 Ga0068858_100734035
462 Ga0068858_101126591
463 Ga0068858_101500529
464 Ga0068860_100320845
465 Ga0068862_100017030
466 Ga0097621_100146286
467 Ga0097621_100174495
468 Ga0068871_100035073
469 Ga0068871_100251217
470 Ga0068871_100471096
471 Ga0068871_101017631
472 Ga0075428_100033457
473 Ga0075428_100097417
474 Ga0075428_100898662
475 Ga0075431_100011180
476 Ga0075431_100366742
477 Ga0075433_10054759
478 Ga0075434_100026898
479 Ga0075434_100717753
480 Ga0068865_100099479
481 Ga0097620_100045449
482 Ga0097620_100126040
483 Ga0097620_100139500
484 Ga0097620_100172658
485 Ga0097620_100325827
486 Ga0097620_100907390
487 Ga0097620_101870640
488 Ga0105240_10441791
489 Ga0111539_10214786
490 Ga0105245_10773806
491 Ga0105247_10937941
492 Ga0114129_10079876
493 Ga0114129_10190039
494 Ga0114129_10423101
495 Ga0114129_10629002
496 Ga0114129_11351415
497 Ga0105243_10132552
498 Ga0105243_10957586
499 Ga0105241_10014749
500 Ga0105242_10030613
501 Ga0105242_10321528
502 Ga0105248_10012596
503 Ga0105248_10199140
504 Ga0105248_10233078
505 Ga0099796_10002357
506 Ga0105239_10355138
507 Ga0105246_10011169
508 Ga0157315_1038173
509 Ga0157373_10018525
510 Ga0157371_10009000
511 Ga0157369_10039419
512 Ga0157374_10029690
513 Ga0157374_11085610
514 Ga0157378_10637054
515 Ga0157378_10795335
516 Ga0163162_10074555
517 Ga0163162_10221406
518 Ga0163162_10312944
519 Ga0157372_10267248
520 Ga0157375_10023760
521 Ga0163163_10026902
522 Ga0163163_10135470
523 Ga0163163_10798263
524 Ga0157380_10324200
525 Ga0157377_10006871
526 Ga0157377_10108027
527 Ga0157377_10739550
528 Ga0157379_10049806
529 Ga0157379_10075833
530 Ga0157379_10298969
531 Ga0157376_10122847
532 Ga0157376_10219809
533 Ga0163161_10022371
534 Ga0163161_10696363
535 Ga0213876_10035449
536 Ga0207697_10133605
537 Ga0207682_10066649
538 Ga0207642_10097909
539 Ga0207642_10281518
540 Ga0207680_10047764
541 Ga0207680_10052615
542 Ga0207647_10004401
543 Ga0207645_10006290
544 Ga0207645_10007878
545 Ga0207643_10008423
546 Ga0207643_10536232
547 Ga0207705_10268586
548 Ga0207684_10029951
549 Ga0207684_10041020
550 Ga0207654_10188840
551 Ga0207693_10079454
552 Ga0207662_10235851
553 Ga0207657_10010709
554 Ga0207649_10000805
555 Ga0207646_10002879
556 Ga0207681_10207652
557 Ga0207650_10000541
558 Ga0207650_10011172
559 Ga0207650_10036817
560 Ga0207659_10147373
561 Ga0207659_10371698
562 Ga0207687_10110852
563 Ga0207687_10591184
564 Ga0207644_10037231
565 Ga0207644_10063965
566 Ga0207644_10066690
567 Ga0207690_10007013
568 Ga0207706_10011326
569 Ga0207706_11241500
570 Ga0207686_10673621
571 Ga0207686_10896633
572 Ga0207670_10014075
573 Ga0207704_10154346
574 Ga0207704_10247562
575 Ga0207704_10444603
576 Ga0207691_10013015
577 Ga0207691_10065382
578 Ga0207691_10095916
579 Ga0207711_10049334
580 Ga0207711_10092154
581 Ga0207711_10362896
582 Ga0207711_10648356
583 Ga0207689_10006458
584 Ga0207689_10098372
585 Ga0207689_10243323
586 Ga0207689_10670632
587 Ga0207661_10000122
588 Ga0207679_10000870
589 Ga0207679_10526270
590 Ga0207667_10211004
591 Ga0207651_10347727
592 Ga0207640_10584366
593 Ga0207658_10217965
594 Ga0207658_10723403
595 Ga0207677_10145792
596 Ga0207677_10427846
597 Ga0207703_10183657
598 Ga0207703_10215875
599 Ga0207703_10524401
600 Ga0207703_10532207
601 Ga0207639_10833224
602 Ga0207678_10010978
603 Ga0207678_10087708
604 Ga0207708_10001998
605 Ga0207702_10154160
606 Ga0207641_10000006
607 Ga0207641_10279780
608 Ga0207641_10585444
609 Ga0207641_11086005
610 Ga0207648_10004897
611 Ga0207648_10013823
612 Ga0207648_10504957
613 Ga0207676_10002394
614 Ga0207676_10048831
615 Ga0207676_10365836
616 Ga0207674_10000537
617 Ga0207675_100000867
618 Ga0207675_100101916
619 Ga0207683_10008965
620 Ga0207683_10011271
621 Ga0268266_10000061
622 Ga0268266_10123512
623 Ga0268265_10008649
624 Ga0268265_10100446
625 Ga0268264_10196481
626 Ga0268264_10909998
627 Ga0268264_11174447
628 Ga0265339_10235829
629 Ga0265331_10399234
630 Ga0265314_10151907
631 Ga0307405_10034455
632 Ga0307405_10104424
633 Ga0307406_10056382
634 Ga0307407_10122677
635 Ga0307412_10014827
636 Ga0307412_10057037
637 Ga0307409_101434409
638 Ga0307416_100121446
639 Ga0307411_10032084
640 Ga0307411_10039590
641 Ga0307415_100112514
642 Ga0307415_100799178
643 Ga0373959_0076465
644 Ga0373939_0299376
645 Ga0373935_0178230
646 Ga0373935_0925925
647 Ga0373927_0016917
648 Ga0373925_0190524
649 Ga0395901_0760774
650 Ga0436365_0456969
651 Ga0451577_0361329
652 Ga0453684_0307793
653 Ga0451576_0215753
654 Ga0451576_0252191
655 Ga0451576_1055325
656 Ga0495580_0627807
657 Ga0495665_0378765
658 Ga0495621_0153705
659 Ga0495674_0282388
660 Ga0495684_0323061
661 Ga0496102_0393968
662 Ga0496104_0417530
663 Ga0496107_0557247
664 Ga0496107_0601426
665 Ga0496108_0000258
666 Ga0496108_0219288
667 Ga0496109_0000781
668 Ga0496109_0776626
669 Ga0496110_0009726
670 Ga0496111_0075009
671 Ga0496112_0000081
672 Ga0496112_0153262
673 Ga0496113_0083821
674 Ga0496113_0410651
675 Ga0496115_0816324
676 Ga0496115_1000911
677 Ga0501031_0264637
678 Ga0501036_0598116
679 Ga0501036_1020538
680 Ga0501039_0684321
681 Ga0501040_0110603
682 Ga0501041_0068690
683 Ga0501048_0506364
684 Ga0501075_0056332
685 Ga0501075_0458773
686 Ga0501076_0001133
687 Ga0501079_0050282
688 Ga0501079_0056500
689 Ga0501081_0034966
690 Ga0501045_0217188
691 nmdc:mga0k408_14750_c1
692 nmdc:mga05p37_128641_c1
693 nmdc:mga05p37_237815_c1
694 nmdc:mga05p37_493650_c1
695 nmdc:mga09592_119210_c1
696 nmdc:mga09592_122076_c1
697 nmdc:mga0qj67_902691_c1
698 nmdc:mga06r32_1061988_c1
699 nmdc:mga06r32_8990_c1
700 nmdc:mga06r32_905285_c1
701 nmdc:mga08y16_486038_c1
702 nmdc:mga0n895_429475_c1
703 nmdc:mga0a205_39183_c2
704 Ga0501084_0077260
705 Ga0501084_0937091
706 Ga0590071_000630
707 Ga0590074_010517
708 Ga0590075_000859
709 Ga0590077_001351
710 Ga0530510_0554898

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11188

DUF2975

Protein of unknown function (DUF2975)

50

213

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
6v1i-assembly1.cif.gz_A cryo-em reconstruction of the thermophilic bacteriophage p74-26 small terminase- symmetric 0.4998 103 168
6tpk-assembly1.cif.gz_A crystal structure of the human oxytocin receptor 0.4938 9 166
6e8g-assembly1.cif.gz_S cryoem reconstruction of ist1-chmp1b copolymer filament bound to ssdna at 2.9 angstrom resolution 0.484 14 154
4clv-assembly1.cif.gz_B crystal structure of dodecylphosphocholine-solubilized nccx from cupriavidus metallidurans 31a 0.4796 5 153
3jc1-assembly1.cif.gz_Aa electron cryo-microscopy of the ist1-chmp1b escrt-iii copolymer 0.4774 18 154
ID Description Score Start End Superfamily
af_Q9NY35_1_250_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.733 67 174 1.20.140.150
af_B3GWC2_64_271_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.6482 67 172 1.20.140.150
af_Q9TZ35_1_155_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.6177 52 162 1.20.140.150
af_O45665_47_200_3.80.10.10 Alpha Beta;Alpha-Beta Horseshoe;Leucine-rich repeat, LRR (right-handed beta-alpha superhelix);Ribonuclease Inhibitor 0.5885 52 163 3.80.10.10
af_Q9SZW6_305_633_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.5646 53 175 1.20.1270.60
ID Description Score Start End GO Terms
AF-A0A7H0G5F3-F1-model_v4 deleted 0.9801 19 175
AF-A0A7H0G5F3-F1-model_v4 deleted 0.9619 19 175
AF-A0A2V8FHK5-F1-model_v4 DUF2975 domain-containing protein 0.9527 49 175 GO:0016020
AF-A0A2U2IZC6-F1-model_v4 DUF2975 domain-containing protein 0.9434 12 175 GO:0016020
AF-A0A2V8FHK5-F1-model_v4 DUF2975 domain-containing protein 0.9382 49 175 GO:0016020

Map