F420153

General Info

Members Datasets Scaffolds Average Seq Length
355 242 710 165

Family's Representative Sequence

Representative Sequence 3300025916|Ga0207663_10002126|Ga0207663_100021265
Length 169
Sequence MAQPYVGEIRMFAGNFAPAGWMFCEGQLLPISEFETLFNLIGTTYGGDGQSTFALPDLRGRIPIHFGNGFTLAETGGVETVTLTVSQIPAHSHPYLGSTNLATGVVPTGQSGGKGGVSTILPYGTDVPVSPLSPSAVGSTGGSQPHNNFQPYLCVDFIISLFGIFPSQT

Samples

Sample ID Description Type Environment
1 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
95 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
96 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
97 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
98 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
142 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
143 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
144 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
145 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
146 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
147 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
148 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
150 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
151 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
152 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
153 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
154 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
155 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
156 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
157 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
158 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
159 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
160 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
161 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
162 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
163 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
164 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
165 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
166 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
167 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
168 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
169 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
170 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
171 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
172 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
173 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
174 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
175 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
176 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
177 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
178 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
181 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
182 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
183 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
184 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
185 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
186 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
187 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
188 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
189 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
190 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
191 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
192 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
193 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
194 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
195 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
196 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
197 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
198 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
199 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
200 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
201 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
202 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
203 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 2721755523 Delftia sp. HK171 Isolate Unclassified
212 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
213 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
214 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
215 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
216 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
217 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
218 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
219 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
220 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
221 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
222 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
223 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
224 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
225 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
226 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
227 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
228 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
229 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
230 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
231 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
232 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
233 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
234 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
235 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
236 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
237 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
238 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
239 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
240 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
241 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
242 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 85.63
Metatranscriptomes 5.35
Isolates 9.01

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.25
Nodule 7.89
Rhizoplane 1.97
Rhizosphere 83.94
Stem 0
Stem Tuber 0
Unclassified 2.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207663_10002126 3300025916 Bacteria 9451
2 JGI24740J21852_10026327 3300001979 Bacteria 1949
3 JGI25406J46586_10000076 3300003203 Bacteria 44212
4 Ga0058859_11371178 3300004798 Bacteria 1963
5 Ga0058861_12049764 3300004800 Bacteria 3881
6 Ga0058862_10051553 3300004803 Bacteria 3291
7 Ga0058862_11482339 3300004803 Bacteria 775
8 Ga0070670_100007296 3300005331 Bacteria 9375
9 Ga0068869_100226439 3300005334 Bacteria 1484
10 Ga0070666_10003376 3300005335 Bacteria 9678
11 Ga0070682_100177029 3300005337 Bacteria 1487
12 Ga0068868_100249247 3300005338 Bacteria 1494
13 Ga0070689_100977498 3300005340 Unclassified 752
14 Ga0070673_100158962 3300005364 Bacteria 1920
15 Ga0070688_100349492 3300005365 Bacteria 1082
16 Ga0070659_100268215 3300005366 Viruses 1418
17 Ga0070667_100033296 3300005367 Bacteria 4306
18 Ga0070667_100050111 3300005367 Bacteria 3518
19 Ga0070709_10000009 3300005434 Bacteria 178953
20 Ga0070709_10000373 3300005434 Bacteria 27557
21 Ga0070711_100000313 3300005439 Bacteria 25173
22 Ga0070711_100238053 3300005439 Bacteria 1422
23 Ga0070705_100078149 3300005440 Bacteria 2023
24 Ga0070700_100773184 3300005441 Bacteria 771
25 Ga0070694_100375015 3300005444 Bacteria 1108
26 Ga0070708_100001289 3300005445 Bacteria 19265
27 Ga0070708_100230401 3300005445 Bacteria 1738
28 Ga0070708_100292586 3300005445 Bacteria 1533
29 Ga0070708_100393868 3300005445 Bacteria 1306
30 Ga0070708_100445005 3300005445 Bacteria 1222
31 Ga0070663_100011452 3300005455 Bacteria 5569
32 Ga0070663_100036080 3300005455 Bacteria 3434
33 Ga0070681_10002753 3300005458 Bacteria 16213
34 Ga0070681_10224052 3300005458 Bacteria 1795
35 Ga0068867_100107888 3300005459 Bacteria 2134
36 Ga0070685_10002224 3300005466 Bacteria 10011
37 Ga0070706_100014913 3300005467 Bacteria 7178
38 Ga0070706_100076709 3300005467 Bacteria 3093
39 Ga0070707_100132030 3300005468 Bacteria 2428
40 Ga0070707_100189315 3300005468 Bacteria 2006
41 Ga0070707_100535695 3300005468 Bacteria 1133
42 Ga0070707_101504891 3300005468 Bacteria 640
43 Ga0070698_100014743 3300005471 Bacteria 8257
44 Ga0070698_100080253 3300005471 Bacteria 3257
45 Ga0070698_100319069 3300005471 Bacteria 1484
46 Ga0070698_100356698 3300005471 Bacteria 1394
47 Ga0070698_100536103 3300005471 Bacteria 1109
48 Ga0070699_100029384 3300005518 Bacteria 4739
49 Ga0070699_100223211 3300005518 Bacteria 1679
50 Ga0070699_100264536 3300005518 Bacteria 1538
51 Ga0070679_100032425 3300005530 Bacteria 5167
52 Ga0070679_100365368 3300005530 Bacteria 1390
53 Ga0070684_100143749 3300005535 Bacteria 2159
54 Ga0070697_100000652 3300005536 Bacteria 26194
55 Ga0070697_100029688 3300005536 Unclassified 4386
56 Ga0070697_100577209 3300005536 Bacteria 987
57 Ga0070697_100607474 3300005536 Bacteria 962
58 Ga0070697_100814943 3300005536 Bacteria 826
59 Ga0068853_100011726 3300005539 Bacteria 7122
60 Ga0068853_100351915 3300005539 Bacteria 1370
61 Ga0070695_100080665 3300005545 Bacteria 2151
62 Ga0070696_100261645 3300005546 Bacteria 1312
63 Ga0070693_100027584 3300005547 Bacteria 3080
64 Ga0070665_100003278 3300005548 Bacteria 17372
65 Ga0068855_100073046 3300005563 Bacteria 3986
66 Ga0068855_100165553 3300005563 Bacteria 2507
67 Ga0068855_100590997 3300005563 Bacteria 1198
68 Ga0068855_100603499 3300005563 Bacteria 1183
69 Ga0070664_100262477 3300005564 Bacteria 1554
70 Ga0068857_100135835 3300005577 Bacteria 2220
71 Ga0068854_100320019 3300005578 Bacteria 1260
72 Ga0068856_100069469 3300005614 Bacteria 3483
73 Ga0068856_101163323 3300005614 Bacteria 788
74 Ga0068852_100072822 3300005616 Bacteria 3020
75 Ga0068859_100035697 3300005617 Bacteria 4989
76 Ga0068859_100188853 3300005617 Bacteria 2144
77 Ga0068859_101119552 3300005617 Bacteria 866
78 Ga0068864_101484144 3300005618 Bacteria 681
79 Ga0068851_10001672 3300005834 Bacteria 9706
80 Ga0068870_10021098 3300005840 Bacteria 3182
81 Ga0068863_100033985 3300005841 Bacteria 4857
82 Ga0068863_100200615 3300005841 Bacteria 1919
83 Ga0068863_100246444 3300005841 Bacteria 1725
84 Ga0068858_100000909 3300005842 Bacteria 30679
85 Ga0068860_100038278 3300005843 Bacteria 4587
86 Ga0068862_100006996 3300005844 Bacteria 9365
87 Ga0068862_101065997 3300005844 Bacteria 802
88 Ga0081539_10000229 3300005985 Bacteria 131455
89 Ga0070717_10000191 3300006028 Bacteria 43325
90 Ga0070717_10091487 3300006028 Bacteria 2569
91 Ga0070717_10581820 3300006028 Bacteria 1015
92 Ga0070717_10652605 3300006028 Viruses 955
93 Ga0075365_10250654 3300006038 Bacteria 1244
94 Ga0070716_100000020 3300006173 Bacteria 79851
95 Ga0070716_100073507 3300006173 Bacteria 2017
96 Ga0070712_101271256 3300006175 Bacteria 641
97 Ga0075369_10255692 3300006186 Bacteria 814
98 Ga0097621_100184579 3300006237 Bacteria 1804
99 Ga0097621_100694685 3300006237 Unclassified 936
100 Ga0097621_100859165 3300006237 Bacteria 843
101 Ga0068871_100116481 3300006358 Bacteria 2253
102 Ga0068871_100892186 3300006358 Bacteria 824
103 Ga0068871_101043073 3300006358 Bacteria 763
104 Ga0075428_100316599 3300006844 Bacteria 1677
105 Ga0075431_100094262 3300006847 Bacteria 3089
106 Ga0075433_10068170 3300006852 Bacteria 3123
107 Ga0075434_100011576 3300006871 Bacteria 8328
108 Ga0075434_100119618 3300006871 Bacteria 2648
109 Ga0075429_100000502 3300006880 Bacteria 29456
110 Ga0068865_100095436 3300006881 Bacteria 2167
111 Ga0075436_100001244 3300006914 Bacteria 17316
112 Ga0075436_100027991 3300006914 Bacteria 3879
113 Ga0075436_100048677 3300006914 Bacteria 2925
114 Ga0097620_100035697 3300006931 Bacteria 4989
115 Ga0097620_101119519 3300006931 Bacteria 866
116 Ga0075435_100011911 3300007076 Bacteria 6422
117 Ga0075435_100157412 3300007076 Bacteria 1912
118 Ga0075435_100257991 3300007076 Bacteria 1485
119 Ga0099794_10232315 3300007265 Unclassified 949
120 Ga0105240_10000239 3300009093 Bacteria 109259
121 Ga0105240_10050241 3300009093 Bacteria 5259
122 Ga0105240_11000478 3300009093 Bacteria 894
123 Ga0105245_10447033 3300009098 Bacteria 1300
124 Ga0105245_10536185 3300009098 Bacteria 1191
125 Ga0105247_10720634 3300009101 Bacteria 753
126 Ga0114129_10021626 3300009147 Bacteria 9130
127 Ga0105241_10033703 3300009174 Bacteria 3845
128 Ga0105241_10315001 3300009174 Bacteria 1347
129 Ga0105241_10792969 3300009174 Bacteria 872
130 Ga0105242_10467397 3300009176 Bacteria 1192
131 Ga0105248_10525997 3300009177 Bacteria 1334
132 Ga0105237_10016724 3300009545 Bacteria 7616
133 Ga0105237_10101105 3300009545 Bacteria 2875
134 Ga0105237_10832340 3300009545 Bacteria 930
135 Ga0105238_10001918 3300009551 Bacteria 20874
136 Ga0105238_10019377 3300009551 Bacteria 6929
137 Ga0105249_10021608 3300009553 Bacteria 5762
138 Ga0105249_10953029 3300009553 Bacteria 926
139 Ga0105239_10021673 3300010375 Bacteria 7083
140 Ga0105239_10027070 3300010375 Bacteria 6312
141 Ga0105239_11065707 3300010375 Bacteria 930
142 Ga0105246_10002517 3300011119 Bacteria 11080
143 Ga0105246_10677682 3300011119 Bacteria 901
144 Ga0105246_11879566 3300011119 Bacteria 574
145 Ga0157373_10003863 3300013100 Bacteria 11320
146 Ga0157370_11124935 3300013104 Bacteria 709
147 Ga0157369_10041257 3300013105 Bacteria 5038
148 Ga0157369_10626715 3300013105 Bacteria 1109
149 Ga0157378_11253118 3300013297 Bacteria 782
150 Ga0163162_10043702 3300013306 Bacteria 4486
151 Ga0163162_10374740 3300013306 Bacteria 1556
152 Ga0163162_11486444 3300013306 Bacteria 772
153 Ga0163163_10003458 3300014325 Bacteria 13422
154 Ga0157380_10000235 3300014326 Bacteria 33292
155 Ga0157380_12148398 3300014326 Bacteria 622
156 Ga0157379_10039121 3300014968 Bacteria 4231
157 Ga0206349_1402693 3300020075 Bacteria 1659
158 Ga0206354_10644897 3300020081 Bacteria 742
159 Ga0206353_11977533 3300020082 Bacteria 1308
160 Ga0154015_1206444 3300020610 Bacteria 2254
161 Ga0213873_10085119 3300021358 Bacteria 891
162 Ga0213874_10198035 3300021377 Bacteria 721
163 Ga0213875_10004818 3300021388 Bacteria 7333
164 Ga0224712_10143508 3300022467 Bacteria 1053
165 Ga0207656_10004827 3300025321 Bacteria 4732
166 Ga0207680_10025694 3300025903 Bacteria 3251
167 Ga0207680_10178398 3300025903 Bacteria 1435
168 Ga0207680_10367996 3300025903 Bacteria 1012
169 Ga0207647_10005321 3300025904 Bacteria 9459
170 Ga0207647_10096611 3300025904 Bacteria 1758
171 Ga0207699_10000020 3300025906 Bacteria 179154
172 Ga0207699_10000092 3300025906 Bacteria 66083
173 Ga0207643_10011131 3300025908 Bacteria 4857
174 Ga0207684_10000358 3300025910 Bacteria 62368
175 Ga0207684_10003775 3300025910 Bacteria 14638
176 Ga0207684_10213328 3300025910 Bacteria 1665
177 Ga0207654_10018025 3300025911 Bacteria 3702
178 Ga0207654_10452579 3300025911 Bacteria 900
179 Ga0207695_10000082 3300025913 Bacteria 284333
180 Ga0207695_10026988 3300025913 Bacteria 6398
181 Ga0207695_10077681 3300025913 Bacteria 3371
182 Ga0207671_10008103 3300025914 Bacteria 8970
183 Ga0207671_10083498 3300025914 Bacteria 2398
184 Ga0207649_10008919 3300025920 Bacteria 5476
185 Ga0207652_10006426 3300025921 Bacteria 9477
186 Ga0207646_10001844 3300025922 Bacteria 25581
187 Ga0207646_10316667 3300025922 Bacteria 1410
188 Ga0207646_10857653 3300025922 Bacteria 807
189 Ga0207694_10001472 3300025924 Bacteria 20135
190 Ga0207694_10001626 3300025924 Bacteria 18893
191 Ga0207650_10043835 3300025925 Bacteria 3286
192 Ga0207650_10244212 3300025925 Bacteria 1452
193 Ga0207687_10098226 3300025927 Bacteria 2149
194 Ga0207700_10275003 3300025928 Bacteria 1447
195 Ga0207700_10870032 3300025928 Bacteria 806
196 Ga0207690_10725401 3300025932 Bacteria 818
197 Ga0207706_10282362 3300025933 Bacteria 1448
198 Ga0207686_10402711 3300025934 Bacteria 1043
199 Ga0207670_10673336 3300025936 Bacteria 855
200 Ga0207670_10784840 3300025936 Bacteria 793
201 Ga0207665_10000045 3300025939 Bacteria 79809
202 Ga0207665_10080870 3300025939 Bacteria 2236
203 Ga0207665_11125464 3300025939 Bacteria 626
204 Ga0207711_10692164 3300025941 Unclassified 951
205 Ga0207689_10127622 3300025942 Bacteria 2092
206 Ga0207689_10188618 3300025942 Bacteria 1701
207 Ga0207661_10263634 3300025944 Bacteria 1536
208 Ga0207679_10206258 3300025945 Bacteria 1645
209 Ga0207667_10184292 3300025949 Bacteria 2143
210 Ga0207667_10207659 3300025949 Bacteria 2008
211 Ga0207667_10341633 3300025949 Bacteria 1528
212 Ga0207667_10875836 3300025949 Bacteria 891
213 Ga0207651_10072093 3300025960 Bacteria 2451
214 Ga0207712_10003134 3300025961 Bacteria 10543
215 Ga0207658_10022467 3300025986 Bacteria 4392
216 Ga0207703_10001939 3300026035 Bacteria 18306
217 Ga0207703_10454391 3300026035 Bacteria 1197
218 Ga0207639_10000008 3300026041 Bacteria 434844
219 Ga0207639_10000663 3300026041 Bacteria 23749
220 Ga0207678_10007943 3300026067 Bacteria 9359
221 Ga0207678_10041035 3300026067 Bacteria 4012
222 Ga0207708_10042120 3300026075 Bacteria 3481
223 Ga0207702_10044802 3300026078 Bacteria 3719
224 Ga0207702_11006881 3300026078 Bacteria 827
225 Ga0207641_10073626 3300026088 Bacteria 2944
226 Ga0207641_10099476 3300026088 Bacteria 2559
227 Ga0207641_10373259 3300026088 Bacteria 1364
228 Ga0207648_10171820 3300026089 Bacteria 1916
229 Ga0207674_10219918 3300026116 Bacteria 1847
230 Ga0207675_100109547 3300026118 Bacteria 2606
231 Ga0207698_10072501 3300026142 Bacteria 2738
232 Ga0268266_10000008 3300028379 Bacteria 1161875
233 Ga0268265_10086988 3300028380 Bacteria 2485
234 Ga0268265_10852873 3300028380 Bacteria 891
235 Ga0268264_10499384 3300028381 Bacteria 1186
236 Ga0265338_10275779 3300028800 Bacteria 1231
237 Ga0307508_10049689 3300031616 Bacteria 3735
238 Ga0373929_0000008 3300035085 Bacteria 298561
239 Ga0373923_0058841 3300035111 Bacteria 1628
240 Ga0373957_0173621 3300035120 Viruses 891
241 Ga0373961_0000245 3300035241 Bacteria 25270
242 Ga0373933_0050164 3300035724 Bacteria 2490
243 Ga0373937_0039775 3300036401 Viruses 4285
244 Ga0395905_0004035 3300037471 Bacteria 15411
245 Ga0436364_0019595 3300037853 Bacteria 18406
246 Ga0436364_0110751 3300037853 Bacteria 2417
247 Ga0436365_0935740 3300039437 Bacteria 4144
248 Ga0436365_1818776 3300039437 Bacteria 939
249 Ga0436363_1137676 3300039450 Bacteria 4309
250 Ga0436362_0781285 3300039453 Bacteria 703
251 Ga0436362_1224636 3300039453 Bacteria 2911
252 Ga0436362_1263296 3300039453 Bacteria 1002
253 Ga0451800_1081215 3300041459 Bacteria 699
254 Ga0451807_1898185 3300041486 Bacteria 1011
255 Ga0451853_2879237 3300041512 Bacteria 1259
256 Ga0439434_0283087 3300042435 Bacteria 571
257 Ga0439435_0035403 3300042436 Bacteria 1376
258 Ga0439460_0074597 3300042461 Bacteria 1056
259 Ga0451577_0725770 3300042876 Bacteria 899
260 Ga0466961_0237432 3300044693 Bacteria 1121
261 Ga0466963_0015226 3300044694 Bacteria 4758
262 Ga0453684_0000548 3300044712 Bacteria 142109
263 Ga0453684_0005024 3300044712 Bacteria 26860
264 Ga0453684_0032446 3300044712 Bacteria 7309
265 Ga0453684_0225520 3300044712 Bacteria 2167
266 Ga0453684_1044968 3300044712 Bacteria 866
267 Ga0466960_0001712 3300044901 Bacteria 8049
268 Ga0451576_0042106 3300045051 Bacteria 4823
269 Ga0466967_0154377 3300045976 Bacteria 2149
270 Ga0495629_0929036 3300046459 Unclassified 569
271 Ga0495630_0705572 3300046517 Unclassified 772
272 Ga0495645_0229545 3300046543 Viruses 1244
273 Ga0495604_0657322 3300047317 Unclassified 668
274 Ga0495672_0026267 3300047320 Unclassified 3717
275 Ga0496103_0162467 3300048906 Bacteria 1433
276 Ga0496104_0886395 3300048907 Bacteria 797
277 Ga0496105_0240357 3300048908 Bacteria 1470
278 Ga0496110_0008976 3300048913 Bacteria 8063
279 Ga0496111_0052900 3300048914 Bacteria 2933
280 Ga0496126_0246310 3300048929 Bacteria 1491
281 Ga0501039_0084860 3300049575 Bacteria 2467
282 Ga0501043_0118002 3300049579 Bacteria 2082
283 Ga0501067_0037433 3300049583 Bacteria 2695
284 Ga0501068_0017311 3300049584 Bacteria 4167
285 Ga0501069_0285731 3300049585 Bacteria 966
286 Ga0501070_0175622 3300049586 Bacteria 1764
287 Ga0501072_0721860 3300049588 Bacteria 783
288 Ga0501081_0384474 3300049743 Bacteria 1038
289 Ga0501035_0835888 3300049822 Bacteria 733
290 nmdc:mga03n38_78755_c1 3300050490 Bacteria 1543
291 nmdc:mga00v17_73476_c1 3300050491 Bacteria 2123
292 nmdc:mga0yw44_759921_c1 3300050492 Bacteria 658
293 nmdc:mga06z11_50152_c1 3300050494 Bacteria 2132
294 nmdc:mga05p37_3621_c1 3300050507 Bacteria 18061
295 nmdc:mga09592_1390_c1 3300050508 Bacteria 19348
296 nmdc:mga0qj67_6159_c1 3300050509 Bacteria 8793
297 nmdc:mga06r32_63215_c1 3300050510 Bacteria 3567
298 nmdc:mga0n895_177297_c1 3300050512 Bacteria 2162
299 nmdc:mga0n895_36897_c1 3300050512 Bacteria 4723
300 nmdc:mga0n895_533098_c1 3300050512 Bacteria 1181
301 nmdc:mga0n895_7983_c1 3300050512 Bacteria 9127
302 nmdc:mga0rr50_145584_c1 3300050513 Bacteria 1910
303 nmdc:mga0rr50_546763_c1 3300050513 Bacteria 986
304 nmdc:mga0rr50_8787_c1 3300050513 Bacteria 6304
305 nmdc:mga08x19_17_c1 3300050514 Bacteria 313678
306 nmdc:mga08x19_205046_c1 3300050514 Bacteria 1352
307 nmdc:mga08x19_31272_c1 3300050514 Bacteria 3348
308 nmdc:mga08x19_44515_c1 3300050514 Bacteria 2834
309 nmdc:mga0a205_68467_c1 3300050515 Bacteria 3428
310 nmdc:mga0sz30_188353_c1 3300050516 Bacteria 916
311 Ga0495655_0000072 3300053083 Bacteria 20024
312 Ga0500616_0005133 3300053153 Bacteria 9010
313 Ga0501084_1029393 3300054114 Bacteria 692
314 Ga0587070_111389 3300059491 Bacteria 643
315 Ga0587077_075552 3300059493 Bacteria 762
316 Ga0587092_012392 3300059512 Bacteria 1202
317 Ga0587069_007644 3300059642 Bacteria 1341
318 Ga0587079_034517 3300059647 Bacteria 990
319 Ga0587110_004874 3300059654 Bacteria 1186
320 Ga0587071_069126 3300060344 Bacteria 766
321 Ga0587111_0028759 3300060346 Bacteria 1121
322 Ga0587111_0031419 3300060346 Bacteria 1086
323 Ga0587111_0105372 3300060346 Bacteria 708
324 2722882505 2721755523 Bacteria 6430384
325 2839141239 2839138175 Bacteria 6549354
326 2869173695 2869169390 Bacteria 6659796
327 2869247563 2869242130 Bacteria 6609239
328 2869262506 2869256925 Bacteria 6981691
329 2871443040 2871435913 Bacteria 6880295
330 2871486511 2871481445 Bacteria 6700002
331 2874116604 2874116593 Bacteria 6674494
332 2876387758 2876386047 Bacteria 6698674
333 2876427803 2876420981 Bacteria 6687741
334 2906407465 2906401398 Bacteria 6693206
335 2908747875 2908739725 Bacteria 8628932
336 2919684231 2919683626 Bacteria 5534354
337 2924740521 2924733363 Bacteria 7574837
338 2924745260 2924741084 Bacteria 6661321
339 2937867158 2937861824 Bacteria 6660327
340 2937986026 2937980651 Bacteria 6517427
341 2958114253 2958108152 Bacteria 6681128
342 2961189225 2961183825 Bacteria 6688536
343 2968140052 2968138860 Bacteria 6605449
344 2970532237 2970532167 Bacteria 6553173
345 2970620610 2970619444 Bacteria 6986144
346 2970630347 2970627176 Bacteria 6680862
347 2977853486 2977851361 Bacteria 6694324
348 2977912521 2977907340 Bacteria 6577984
349 2979769433 2979764755 Bacteria 6610066
350 2979773320 2979772303 Bacteria 6618277
351 2996389083 2996386984 Bacteria 6978667
352 3004253963 3004248173 Bacteria 6563236
353 3004269500 3004268573 Bacteria 7043476
354 8004644295 8004640170 Bacteria 6723001
355 8004731880 8004727605 Bacteria 6643904
356 Ga0207663_10002126
357 JGI24740J21852_10026327
358 JGI25406J46586_10000076
359 Ga0058859_11371178
360 Ga0058861_12049764
361 Ga0058862_10051553
362 Ga0058862_11482339
363 Ga0070670_100007296
364 Ga0068869_100226439
365 Ga0070666_10003376
366 Ga0070682_100177029
367 Ga0068868_100249247
368 Ga0070689_100977498
369 Ga0070673_100158962
370 Ga0070688_100349492
371 Ga0070659_100268215
372 Ga0070667_100033296
373 Ga0070667_100050111
374 Ga0070709_10000009
375 Ga0070709_10000373
376 Ga0070711_100000313
377 Ga0070711_100238053
378 Ga0070705_100078149
379 Ga0070700_100773184
380 Ga0070694_100375015
381 Ga0070708_100001289
382 Ga0070708_100230401
383 Ga0070708_100292586
384 Ga0070708_100393868
385 Ga0070708_100445005
386 Ga0070663_100011452
387 Ga0070663_100036080
388 Ga0070681_10002753
389 Ga0070681_10224052
390 Ga0068867_100107888
391 Ga0070685_10002224
392 Ga0070706_100014913
393 Ga0070706_100076709
394 Ga0070707_100132030
395 Ga0070707_100189315
396 Ga0070707_100535695
397 Ga0070707_101504891
398 Ga0070698_100014743
399 Ga0070698_100080253
400 Ga0070698_100319069
401 Ga0070698_100356698
402 Ga0070698_100536103
403 Ga0070699_100029384
404 Ga0070699_100223211
405 Ga0070699_100264536
406 Ga0070679_100032425
407 Ga0070679_100365368
408 Ga0070684_100143749
409 Ga0070697_100000652
410 Ga0070697_100029688
411 Ga0070697_100577209
412 Ga0070697_100607474
413 Ga0070697_100814943
414 Ga0068853_100011726
415 Ga0068853_100351915
416 Ga0070695_100080665
417 Ga0070696_100261645
418 Ga0070693_100027584
419 Ga0070665_100003278
420 Ga0068855_100073046
421 Ga0068855_100165553
422 Ga0068855_100590997
423 Ga0068855_100603499
424 Ga0070664_100262477
425 Ga0068857_100135835
426 Ga0068854_100320019
427 Ga0068856_100069469
428 Ga0068856_101163323
429 Ga0068852_100072822
430 Ga0068859_100035697
431 Ga0068859_100188853
432 Ga0068859_101119552
433 Ga0068864_101484144
434 Ga0068851_10001672
435 Ga0068870_10021098
436 Ga0068863_100033985
437 Ga0068863_100200615
438 Ga0068863_100246444
439 Ga0068858_100000909
440 Ga0068860_100038278
441 Ga0068862_100006996
442 Ga0068862_101065997
443 Ga0081539_10000229
444 Ga0070717_10000191
445 Ga0070717_10091487
446 Ga0070717_10581820
447 Ga0070717_10652605
448 Ga0075365_10250654
449 Ga0070716_100000020
450 Ga0070716_100073507
451 Ga0070712_101271256
452 Ga0075369_10255692
453 Ga0097621_100184579
454 Ga0097621_100694685
455 Ga0097621_100859165
456 Ga0068871_100116481
457 Ga0068871_100892186
458 Ga0068871_101043073
459 Ga0075428_100316599
460 Ga0075431_100094262
461 Ga0075433_10068170
462 Ga0075434_100011576
463 Ga0075434_100119618
464 Ga0075429_100000502
465 Ga0068865_100095436
466 Ga0075436_100001244
467 Ga0075436_100027991
468 Ga0075436_100048677
469 Ga0097620_100035697
470 Ga0097620_101119519
471 Ga0075435_100011911
472 Ga0075435_100157412
473 Ga0075435_100257991
474 Ga0099794_10232315
475 Ga0105240_10000239
476 Ga0105240_10050241
477 Ga0105240_11000478
478 Ga0105245_10447033
479 Ga0105245_10536185
480 Ga0105247_10720634
481 Ga0114129_10021626
482 Ga0105241_10033703
483 Ga0105241_10315001
484 Ga0105241_10792969
485 Ga0105242_10467397
486 Ga0105248_10525997
487 Ga0105237_10016724
488 Ga0105237_10101105
489 Ga0105237_10832340
490 Ga0105238_10001918
491 Ga0105238_10019377
492 Ga0105249_10021608
493 Ga0105249_10953029
494 Ga0105239_10021673
495 Ga0105239_10027070
496 Ga0105239_11065707
497 Ga0105246_10002517
498 Ga0105246_10677682
499 Ga0105246_11879566
500 Ga0157373_10003863
501 Ga0157370_11124935
502 Ga0157369_10041257
503 Ga0157369_10626715
504 Ga0157378_11253118
505 Ga0163162_10043702
506 Ga0163162_10374740
507 Ga0163162_11486444
508 Ga0163163_10003458
509 Ga0157380_10000235
510 Ga0157380_12148398
511 Ga0157379_10039121
512 Ga0206349_1402693
513 Ga0206354_10644897
514 Ga0206353_11977533
515 Ga0154015_1206444
516 Ga0213873_10085119
517 Ga0213874_10198035
518 Ga0213875_10004818
519 Ga0224712_10143508
520 Ga0207656_10004827
521 Ga0207680_10025694
522 Ga0207680_10178398
523 Ga0207680_10367996
524 Ga0207647_10005321
525 Ga0207647_10096611
526 Ga0207699_10000020
527 Ga0207699_10000092
528 Ga0207643_10011131
529 Ga0207684_10000358
530 Ga0207684_10003775
531 Ga0207684_10213328
532 Ga0207654_10018025
533 Ga0207654_10452579
534 Ga0207695_10000082
535 Ga0207695_10026988
536 Ga0207695_10077681
537 Ga0207671_10008103
538 Ga0207671_10083498
539 Ga0207649_10008919
540 Ga0207652_10006426
541 Ga0207646_10001844
542 Ga0207646_10316667
543 Ga0207646_10857653
544 Ga0207694_10001472
545 Ga0207694_10001626
546 Ga0207650_10043835
547 Ga0207650_10244212
548 Ga0207687_10098226
549 Ga0207700_10275003
550 Ga0207700_10870032
551 Ga0207690_10725401
552 Ga0207706_10282362
553 Ga0207686_10402711
554 Ga0207670_10673336
555 Ga0207670_10784840
556 Ga0207665_10000045
557 Ga0207665_10080870
558 Ga0207665_11125464
559 Ga0207711_10692164
560 Ga0207689_10127622
561 Ga0207689_10188618
562 Ga0207661_10263634
563 Ga0207679_10206258
564 Ga0207667_10184292
565 Ga0207667_10207659
566 Ga0207667_10341633
567 Ga0207667_10875836
568 Ga0207651_10072093
569 Ga0207712_10003134
570 Ga0207658_10022467
571 Ga0207703_10001939
572 Ga0207703_10454391
573 Ga0207639_10000008
574 Ga0207639_10000663
575 Ga0207678_10007943
576 Ga0207678_10041035
577 Ga0207708_10042120
578 Ga0207702_10044802
579 Ga0207702_11006881
580 Ga0207641_10073626
581 Ga0207641_10099476
582 Ga0207641_10373259
583 Ga0207648_10171820
584 Ga0207674_10219918
585 Ga0207675_100109547
586 Ga0207698_10072501
587 Ga0268266_10000008
588 Ga0268265_10086988
589 Ga0268265_10852873
590 Ga0268264_10499384
591 Ga0265338_10275779
592 Ga0307508_10049689
593 Ga0373929_0000008
594 Ga0373923_0058841
595 Ga0373957_0173621
596 Ga0373961_0000245
597 Ga0373933_0050164
598 Ga0373937_0039775
599 Ga0395905_0004035
600 Ga0436364_0019595
601 Ga0436364_0110751
602 Ga0436365_0935740
603 Ga0436365_1818776
604 Ga0436363_1137676
605 Ga0436362_0781285
606 Ga0436362_1224636
607 Ga0436362_1263296
608 Ga0451800_1081215
609 Ga0451807_1898185
610 Ga0451853_2879237
611 Ga0439434_0283087
612 Ga0439435_0035403
613 Ga0439460_0074597
614 Ga0451577_0725770
615 Ga0466961_0237432
616 Ga0466963_0015226
617 Ga0453684_0000548
618 Ga0453684_0005024
619 Ga0453684_0032446
620 Ga0453684_0225520
621 Ga0453684_1044968
622 Ga0466960_0001712
623 Ga0451576_0042106
624 Ga0466967_0154377
625 Ga0495629_0929036
626 Ga0495630_0705572
627 Ga0495645_0229545
628 Ga0495604_0657322
629 Ga0495672_0026267
630 Ga0496103_0162467
631 Ga0496104_0886395
632 Ga0496105_0240357
633 Ga0496110_0008976
634 Ga0496111_0052900
635 Ga0496126_0246310
636 Ga0501039_0084860
637 Ga0501043_0118002
638 Ga0501067_0037433
639 Ga0501068_0017311
640 Ga0501069_0285731
641 Ga0501070_0175622
642 Ga0501072_0721860
643 Ga0501081_0384474
644 Ga0501035_0835888
645 nmdc:mga03n38_78755_c1
646 nmdc:mga00v17_73476_c1
647 nmdc:mga0yw44_759921_c1
648 nmdc:mga06z11_50152_c1
649 nmdc:mga05p37_3621_c1
650 nmdc:mga09592_1390_c1
651 nmdc:mga0qj67_6159_c1
652 nmdc:mga06r32_63215_c1
653 nmdc:mga0n895_177297_c1
654 nmdc:mga0n895_36897_c1
655 nmdc:mga0n895_533098_c1
656 nmdc:mga0n895_7983_c1
657 nmdc:mga0rr50_145584_c1
658 nmdc:mga0rr50_546763_c1
659 nmdc:mga0rr50_8787_c1
660 nmdc:mga08x19_17_c1
661 nmdc:mga08x19_205046_c1
662 nmdc:mga08x19_31272_c1
663 nmdc:mga08x19_44515_c1
664 nmdc:mga0a205_68467_c1
665 nmdc:mga0sz30_188353_c1
666 Ga0495655_0000072
667 Ga0500616_0005133
668 Ga0501084_1029393
669 Ga0587070_111389
670 Ga0587077_075552
671 Ga0587092_012392
672 Ga0587069_007644
673 Ga0587079_034517
674 Ga0587110_004874
675 Ga0587071_069126
676 Ga0587111_0028759
677 Ga0587111_0031419
678 Ga0587111_0105372
679 2722882505
680 2839141239
681 2869173695
682 2869247563
683 2869262506
684 2871443040
685 2871486511
686 2874116604
687 2876387758
688 2876427803
689 2906407465
690 2908747875
691 2919684231
692 2924740521
693 2924745260
694 2937867158
695 2937986026
696 2958114253
697 2961189225
698 2968140052
699 2970532237
700 2970620610
701 2970630347
702 2977853486
703 2977912521
704 2979769433
705 2979773320
706 2996389083
707 3004253963
708 3004269500
709 8004644295
710 8004731880

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07484

Collar

Phage Tail Collar Domain

7

63

0.99

Map