F420146

General Info

Members Datasets Scaffolds Average Seq Length
355 225 343 337

Family's Representative Sequence

Representative Sequence 3300025261|Ga0209233_1001631|Ga0209233_10016317
Length 382
Sequence MEYGPTIGAGGEPVPDVVRGQGRGGARPHRQFQNHWEDFMGRLNFARAAICGVVFAGLMGATAAYADGAVVGLITKTEGNPFFVKMREGAQAEATKLGLTLKTYAGKFDGDNDSQVAAIEDLIAAGAKGFAIVPSDSSAIVPTIKKARDAGLLVIDLDTPTDPITAVDATFATDNFKAGNLIGAWAKGTLGDKAASAKIAFLDLATNQPTVDYLRDQGFMQGFGIDIKDPKKYGDEDDKRICGHEMTGGAEDGGRTAMETLLQKCPDVNVMYTINEPAAAGGYQALKAAGKDDGSVLVVSIDGGCPGVKNVGAGVIGATSQQYPLKMAAMAMDAIAAFAKDGTKPTVPEAGFIDTGATLITDKPVAGVQSITSAEGLKICWG

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
3 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
4 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
5 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
6 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
7 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
8 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
9 2932401849 Devosia sp. 2618 Isolate Rhizosphere
10 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
11 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
12 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
13 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
14 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
15 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
16 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
17 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
18 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
19 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
76 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
77 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
78 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
79 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
116 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
117 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
118 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
119 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
120 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
121 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
122 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
123 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
124 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
125 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
126 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
127 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
128 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
129 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
130 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
135 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
136 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
137 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
138 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
139 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
140 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
142 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
143 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
144 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
145 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
146 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
147 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
148 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
149 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
150 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
151 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
152 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
153 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
154 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
155 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
156 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
157 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
158 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
159 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
160 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
161 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
162 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
163 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
164 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
165 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
166 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
180 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
181 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
182 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
183 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
184 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
185 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
186 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
187 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
189 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
190 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
191 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
192 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
193 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
194 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
195 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300059609 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 227R_SD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300059629 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 186R_SW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 80.56
Metatranscriptomes 16.06
Isolates 3.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.54
Nodule 0.85
Rhizoplane 2.82
Rhizosphere 83.94
Stem 0
Stem Tuber 0
Unclassified 9.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1005825 3300002705 Bacteria 3482
2 JGI25157J39369_1001027 3300002741 Bacteria 12885
3 JGI25406J46586_10004820 3300003203 Bacteria 6272
4 JGI25406J46586_10012758 3300003203 Bacteria 3632
5 JGI25406J46586_10035576 3300003203 Bacteria 1817
6 JGI25165J46597_1000016 3300003214 Bacteria 377866
7 Ga0007409J51694_1015741 3300003575 Bacteria 1743
8 Ga0007409J51694_1022246 3300003575 Bacteria 1136
9 Ga0007409J51694_1043664 3300003575 Bacteria 1206
10 Ga0058863_10002528 3300004799 Bacteria 1233
11 Ga0058863_11941704 3300004799 Bacteria 1224
12 Ga0058861_11870310 3300004800 Bacteria 1224
13 Ga0070658_10002384 3300005327 Bacteria 15783
14 Ga0070658_10068797 3300005327 Bacteria 2895
15 Ga0070658_10146122 3300005327 Bacteria 1977
16 Ga0070660_100073407 3300005339 Bacteria 2675
17 Ga0070660_100074904 3300005339 Bacteria 2649
18 Ga0070661_100002956 3300005344 Bacteria 11725
19 Ga0070661_100177155 3300005344 Bacteria 1621
20 Ga0070668_100029857 3300005347 Bacteria 4142
21 Ga0070668_100068027 3300005347 Bacteria 2768
22 Ga0070669_100185642 3300005353 Bacteria 1629
23 Ga0070673_100231990 3300005364 Bacteria 1601
24 Ga0070659_100025829 3300005366 Bacteria 4517
25 Ga0070659_100045728 3300005366 Bacteria 3430
26 Ga0070659_100221008 3300005366 Bacteria 1563
27 Ga0070667_100026653 3300005367 Bacteria 4808
28 Ga0070667_100180147 3300005367 Bacteria 1868
29 Ga0070700_100117411 3300005441 Bacteria 1778
30 Ga0070663_100007652 3300005455 Bacteria 6590
31 Ga0070678_100227081 3300005456 Bacteria 1554
32 Ga0070681_10138204 3300005458 Bacteria 2366
33 Ga0070699_100245579 3300005518 Bacteria 1599
34 Ga0068853_100112447 3300005539 Bacteria 2420
35 Ga0070665_100025941 3300005548 Bacteria 5902
36 Ga0070665_100256309 3300005548 Bacteria 1750
37 Ga0070704_100198708 3300005549 Bacteria 1617
38 Ga0068855_100043568 3300005563 Bacteria 5315
39 Ga0068854_100056539 3300005578 Bacteria 2828
40 Ga0068854_100126131 3300005578 Bacteria 1949
41 Ga0068856_100029490 3300005614 Bacteria 5359
42 Ga0068852_100005219 3300005616 Bacteria 9263
43 Ga0068852_100476599 3300005616 Bacteria 1239
44 Ga0068859_100050436 3300005617 Bacteria 4180
45 Ga0068866_10039864 3300005718 Bacteria 2322
46 Ga0068861_100253545 3300005719 Bacteria 1502
47 Ga0068861_100261233 3300005719 Bacteria 1482
48 Ga0068870_10021921 3300005840 Bacteria 3133
49 Ga0068863_100236377 3300005841 Bacteria 1763
50 Ga0068862_100084954 3300005844 Bacteria 2750
51 Ga0081540_1029022 3300005983 Bacteria 3091
52 Ga0081539_10000625 3300005985 Bacteria 71667
53 Ga0081539_10000637 3300005985 Bacteria 70993
54 Ga0081539_10003049 3300005985 Bacteria 21640
55 Ga0081539_10003444 3300005985 Bacteria 19435
56 Ga0081539_10011727 3300005985 Bacteria 6874
57 Ga0081539_10011985 3300005985 Bacteria 6757
58 Ga0081539_10074995 3300005985 Bacteria 1799
59 Ga0075365_10054896 3300006038 Bacteria 2643
60 Ga0070715_10027339 3300006163 Bacteria 2279
61 Ga0070712_100220412 3300006175 Bacteria 1501
62 Ga0068865_100019996 3300006881 Bacteria 4339
63 Ga0097620_100050436 3300006931 Bacteria 4180
64 Ga0105240_10116036 3300009093 Bacteria 3231
65 Ga0105240_10512028 3300009093 Bacteria 1333
66 Ga0111539_10141357 3300009094 Bacteria 2818
67 Ga0105241_10070558 3300009174 Bacteria 2711
68 Ga0105242_10085276 3300009176 Bacteria 2648
69 Ga0105248_10106197 3300009177 Bacteria 3166
70 Ga0105237_10001906 3300009545 Bacteria 26600
71 Ga0105238_10028901 3300009551 Bacteria 5648
72 Ga0105238_10033342 3300009551 Bacteria 5242
73 Ga0105239_10095224 3300010375 Bacteria 3289
74 Ga0105239_10547420 3300010375 Bacteria 1318
75 Ga0105246_10126819 3300011119 Bacteria 1900
76 Ga0157371_10013041 3300013102 Bacteria 6328
77 Ga0157371_10052221 3300013102 Bacteria 2903
78 Ga0157370_10009366 3300013104 Bacteria 10474
79 Ga0157370_10013336 3300013104 Bacteria 8465
80 Ga0157370_10411834 3300013104 Bacteria 1244
81 Ga0157369_10019547 3300013105 Bacteria 7579
82 Ga0157369_10104502 3300013105 Bacteria 3016
83 Ga0157369_10214144 3300013105 Bacteria 2018
84 Ga0157374_10032892 3300013296 Bacteria 4727
85 Ga0157372_10128722 3300013307 Bacteria 2911
86 Ga0157372_10449512 3300013307 Bacteria 1502
87 Ga0157372_10456826 3300013307 Bacteria 1489
88 Ga0163163_10085665 3300014325 Bacteria 3159
89 Ga0157379_10373573 3300014968 Bacteria 1307
90 Ga0182005_1025826 3300015265 Bacteria 1603
91 Ga0163161_10093954 3300017792 Bacteria 2223
92 Ga0206356_10938532 3300020070 Bacteria 1758
93 Ga0206356_11281493 3300020070 Bacteria 1150
94 Ga0206351_10089958 3300020077 Bacteria 1340
95 Ga0206351_10760914 3300020077 Bacteria 1198
96 Ga0206352_10445410 3300020078 Bacteria 1246
97 Ga0206352_10532224 3300020078 Bacteria 1523
98 Ga0206352_11166553 3300020078 Bacteria 1220
99 Ga0206350_10552220 3300020080 Bacteria 1133
100 Ga0209026_1000005 3300025250 Bacteria 731387
101 Ga0209759_1000106 3300025256 Bacteria 149959
102 Ga0209233_1000068 3300025261 Bacteria 377969
103 Ga0209233_1001631 3300025261 Bacteria 8730
104 Ga0209025_1076526 3300025294 Bacteria 1159
105 Ga0207642_10162150 3300025899 Bacteria 1201
106 Ga0207688_10045019 3300025901 Bacteria 2461
107 Ga0207647_10027394 3300025904 Bacteria 3715
108 Ga0207685_10118503 3300025905 Bacteria 1158
109 Ga0207645_10117316 3300025907 Bacteria 1726
110 Ga0207643_10033378 3300025908 Bacteria 2879
111 Ga0207705_10003617 3300025909 Bacteria 11774
112 Ga0207705_10083427 3300025909 Bacteria 2331
113 Ga0207684_10072784 3300025910 Bacteria 2919
114 Ga0207654_10113149 3300025911 Bacteria 1692
115 Ga0207695_10043453 3300025913 Bacteria 4789
116 Ga0207695_10117850 3300025913 Bacteria 2627
117 Ga0207671_10000168 3300025914 Bacteria 100117
118 Ga0207671_10251866 3300025914 Bacteria 1388
119 Ga0207657_10003579 3300025919 Bacteria 16574
120 Ga0207657_10074907 3300025919 Bacteria 2857
121 Ga0207657_10320489 3300025919 Bacteria 1226
122 Ga0207649_10013572 3300025920 Bacteria 4550
123 Ga0207652_10247985 3300025921 Bacteria 1606
124 Ga0207694_10013184 3300025924 Bacteria 6223
125 Ga0207706_10086365 3300025933 Bacteria 2758
126 Ga0207686_10071337 3300025934 Bacteria 2235
127 Ga0207669_10117933 3300025937 Bacteria 1795
128 Ga0207691_10078229 3300025940 Bacteria 2977
129 Ga0207689_10005049 3300025942 Bacteria 11894
130 Ga0207689_10030336 3300025942 Bacteria 4506
131 Ga0207679_10063067 3300025945 Bacteria 2765
132 Ga0207667_10008878 3300025949 Bacteria 11896
133 Ga0207667_10023438 3300025949 Bacteria 6797
134 Ga0207712_10007694 3300025961 Bacteria 6813
135 Ga0207668_10006469 3300025972 Bacteria 6927
136 Ga0207640_10061579 3300025981 Bacteria 2486
137 Ga0207658_10064346 3300025986 Bacteria 2751
138 Ga0207639_10001998 3300026041 Bacteria 13745
139 Ga0207639_10115273 3300026041 Bacteria 2197
140 Ga0207678_10021057 3300026067 Bacteria 5716
141 Ga0207678_10023358 3300026067 Bacteria 5407
142 Ga0207678_10056960 3300026067 Bacteria 3364
143 Ga0207678_10091943 3300026067 Bacteria 2593
144 Ga0207708_10012373 3300026075 Bacteria 6359
145 Ga0207708_10115870 3300026075 Bacteria 2084
146 Ga0207702_10008133 3300026078 Bacteria 8875
147 Ga0207702_10034572 3300026078 Bacteria 4226
148 Ga0207674_10054248 3300026116 Bacteria 4081
149 Ga0207675_100111130 3300026118 Bacteria 2586
150 Ga0207675_100228371 3300026118 Bacteria 1795
151 Ga0207683_10032231 3300026121 Bacteria 4552
152 Ga0207683_10165989 3300026121 Bacteria 1998
153 Ga0207698_10009753 3300026142 Bacteria 6133
154 Ga0207698_10091441 3300026142 Bacteria 2491
155 Ga0268266_10000691 3300028379 Bacteria 45474
156 Ga0268266_10004502 3300028379 Bacteria 13321
157 Ga0268265_10021966 3300028380 Bacteria 4478
158 Ga0307517_10074881 3300028786 Bacteria 2978
159 Ga0307515_10004370 3300028794 Bacteria 29310
160 Ga0307515_10016695 3300028794 Bacteria 13425
161 Ga0307515_10031929 3300028794 Bacteria 8747
162 Ga0307515_10032128 3300028794 Bacteria 8711
163 Ga0307515_10072941 3300028794 Bacteria 4623
164 Ga0307512_10025405 3300030522 Bacteria 5249
165 Ga0265330_10046612 3300031235 Bacteria 1910
166 Ga0265340_10000264 3300031247 Bacteria 27200
167 Ga0265316_10009686 3300031344 Bacteria 8845
168 Ga0307513_10000004 3300031456 Bacteria 558931
169 Ga0307513_10003112 3300031456 Bacteria 22645
170 Ga0307513_10034606 3300031456 Bacteria 5666
171 Ga0307513_10117695 3300031456 Bacteria 2634
172 Ga0307509_10010313 3300031507 Bacteria 11476
173 Ga0307408_100390225 3300031548 Bacteria 1193
174 Ga0265313_10006384 3300031595 Bacteria 8365
175 Ga0265342_10007507 3300031712 Bacteria 7977
176 Ga0307516_10001634 3300031730 Bacteria 30915
177 Ga0307516_10009002 3300031730 Bacteria 11183
178 Ga0307516_10010387 3300031730 Bacteria 10241
179 Ga0307516_10062773 3300031730 Bacteria 3599
180 Ga0307516_10062844 3300031730 Bacteria 3596
181 Ga0307516_10081209 3300031730 Bacteria 3085
182 Ga0307516_10214297 3300031730 Bacteria 1638
183 Ga0307405_10086286 3300031731 Bacteria 2066
184 Ga0307405_10247002 3300031731 Bacteria 1325
185 Ga0307413_10120912 3300031824 Bacteria 1774
186 Ga0307410_10216341 3300031852 Bacteria 1471
187 Ga0307410_10271259 3300031852 Bacteria 1327
188 Ga0307407_10022238 3300031903 Bacteria 3286
189 Ga0307407_10022445 3300031903 Bacteria 3275
190 Ga0307412_10022169 3300031911 Bacteria 3890
191 Ga0307412_10225630 3300031911 Bacteria 1439
192 Ga0307409_100052931 3300031995 Bacteria 3116
193 Ga0307409_100096008 3300031995 Bacteria 2444
194 Ga0307416_100124744 3300032002 Bacteria 2304
195 Ga0307416_100602650 3300032002 Bacteria 1178
196 Ga0307414_10122708 3300032004 Bacteria 2000
197 Ga0307415_100010755 3300032126 Bacteria 5199
198 Ga0307415_100034981 3300032126 Bacteria 3277
199 Ga0307415_100052709 3300032126 Bacteria 2768
200 Ga0373948_0007197 3300034817 Bacteria 1864
201 Ga0373939_0029750 3300035114 Bacteria 1566
202 Ga0373942_0008089 3300035207 Bacteria 2446
203 Ga0373962_0014526 3300035242 Bacteria 2007
204 Ga0373937_0197433 3300036401 Bacteria 1891
205 Ga0395899_0121916 3300037312 Bacteria 1866
206 Ga0395900_0007854 3300037418 Bacteria 10995
207 Ga0395900_0430451 3300037418 Bacteria 1279
208 Ga0395898_0020956 3300037466 Bacteria 6632
209 Ga0395898_0145109 3300037466 Bacteria 2272
210 Ga0395901_0013798 3300038443 Bacteria 8216
211 Ga0395901_0216411 3300038443 Bacteria 2004
212 Ga0436365_1202722 3300039437 Bacteria 1313
213 Ga0436363_0844810 3300039450 Bacteria 3405
214 Ga0436362_0756631 3300039453 Unclassified 1358
215 Ga0439465_0018416 3300041413 Bacteria 2182
216 Ga0451791_0167513 3300041451 Bacteria 3722
217 Ga0451797_0018404 3300041453 Bacteria 1370
218 Ga0451795_0977500 3300041456 Bacteria 969
219 Ga0451795_0989321 3300041456 Bacteria 3263
220 Ga0451853_0199027 3300041512 Bacteria 2417
221 Ga0451853_1360360 3300041512 Bacteria 1273
222 Ga0439432_033292 3300042006 Bacteria 1659
223 Ga0439463_020397 3300042016 Bacteria 1653
224 Ga0439435_0011139 3300042436 Bacteria 2152
225 Ga0453684_0288839 3300044712 Bacteria 1868
226 Ga0495650_0035630 3300046471 Bacteria 2188
227 Ga0495686_0090755 3300047472 Bacteria 1855
228 Ga0496108_0000136 3300048911 Bacteria 71114
229 Ga0496108_0284459 3300048911 Bacteria 1439
230 Ga0496110_0340884 3300048913 Bacteria 1365
231 Ga0496111_0041994 3300048914 Bacteria 3283
232 Ga0496114_0032178 3300048917 Bacteria 4316
233 Ga0496120_0008764 3300048923 Bacteria 7273
234 Ga0496125_0001401 3300048928 Bacteria 35263
235 Ga0496125_0144314 3300048928 Bacteria 1649
236 Ga0496126_0030068 3300048929 Bacteria 5153
237 Ga0501308_005731 3300049128 Bacteria 1249
238 Ga0501320_005339 3300049536 Bacteria 1167
239 Ga0501031_0013840 3300049568 Bacteria 5256
240 Ga0501031_0074719 3300049568 Bacteria 2207
241 Ga0501032_0030953 3300049569 Bacteria 3670
242 Ga0501033_0011584 3300049570 Bacteria 6747
243 Ga0501034_0000066 3300049571 Bacteria 184727
244 Ga0501034_0016038 3300049571 Bacteria 7689
245 Ga0501034_0114500 3300049571 Bacteria 2685
246 Ga0501034_0156010 3300049571 Bacteria 2256
247 Ga0501034_0262777 3300049571 Bacteria 1668
248 Ga0501036_0144698 3300049572 Bacteria 2005
249 Ga0501037_0000353 3300049573 Bacteria 38814
250 Ga0501037_0246324 3300049573 Bacteria 1251
251 Ga0501038_0048499 3300049574 Bacteria 3675
252 Ga0501038_0224696 3300049574 Bacteria 1496
253 Ga0501043_0000022 3300049579 Bacteria 154467
254 Ga0501043_0029814 3300049579 Bacteria 4287
255 Ga0501043_0162219 3300049579 Bacteria 1746
256 Ga0501046_0052536 3300049580 Bacteria 3211
257 Ga0501046_0123090 3300049580 Bacteria 1972
258 Ga0501047_0010891 3300049581 Bacteria 8598
259 Ga0501047_0024456 3300049581 Bacteria 5795
260 Ga0501047_0175886 3300049581 Bacteria 2008
261 Ga0501047_0207736 3300049581 Bacteria 1817
262 Ga0501048_0252382 3300049582 Bacteria 1252
263 Ga0501068_0012468 3300049584 Bacteria 4823
264 Ga0501068_0017830 3300049584 Bacteria 4110
265 Ga0501068_0165777 3300049584 Bacteria 1393
266 Ga0501069_0000035 3300049585 Bacteria 88215
267 Ga0501069_0034369 3300049585 Bacteria 2792
268 Ga0501070_0000103 3300049586 Bacteria 74597
269 Ga0501070_0006180 3300049586 Bacteria 10204
270 Ga0501070_0014927 3300049586 Bacteria 6534
271 Ga0501070_0030503 3300049586 Bacteria 4518
272 Ga0501070_0033271 3300049586 Bacteria 4313
273 Ga0501070_0085562 3300049586 Bacteria 2610
274 Ga0501070_0092004 3300049586 Bacteria 2510
275 Ga0501070_0142908 3300049586 Bacteria 1976
276 Ga0501071_0003562 3300049587 Bacteria 9746
277 Ga0501073_0018748 3300049589 Bacteria 5003
278 Ga0501073_0019725 3300049589 Bacteria 4866
279 Ga0501073_0095824 3300049589 Bacteria 2061
280 Ga0501074_0000327 3300049590 Bacteria 27615
281 Ga0501074_0158650 3300049590 Bacteria 1615
282 Ga0501079_0311004 3300049741 Bacteria 1233
283 Ga0501080_0025712 3300049742 Bacteria 5467
284 Ga0501080_0079920 3300049742 Bacteria 3039
285 Ga0501080_0197742 3300049742 Bacteria 1846
286 Ga0501035_0000139 3300049822 Bacteria 88322
287 Ga0501035_0005035 3300049822 Bacteria 12519
288 Ga0501035_0037518 3300049822 Bacteria 4389
289 Ga0501035_0069914 3300049822 Bacteria 3110
290 Ga0501035_0078276 3300049822 Bacteria 2921
291 Ga0501044_0000578 3300049823 Bacteria 44504
292 Ga0501044_0009388 3300049823 Bacteria 10659
293 Ga0501044_0056678 3300049823 Bacteria 4023
294 Ga0501044_0071659 3300049823 Bacteria 3523
295 Ga0501044_0141710 3300049823 Bacteria 2392
296 Ga0501044_0144729 3300049823 Bacteria 2363
297 nmdc:mga0n895_545521_c1 3300050512 Bacteria 1165
298 Ga0500569_004552 3300053109 Bacteria 2921
299 Ga0500604_0000260 3300053151 Bacteria 14903
300 Ga0500616_0034463 3300053153 Bacteria 2757
301 Ga0500634_0000002 3300053161 Bacteria 252372
302 Ga0501084_0078793 3300054114 Bacteria 2761
303 Ga0587066_002827 3300059490 Bacteria 1966
304 Ga0587070_005511 3300059491 Bacteria 1663
305 Ga0587073_0023587 3300059492 Bacteria 1206
306 Ga0587077_001864 3300059493 Bacteria 2377
307 Ga0587077_003499 3300059493 Bacteria 1981
308 Ga0587077_005136 3300059493 Bacteria 1771
309 Ga0587080_014106 3300059503 Bacteria 1232
310 Ga0587080_016774 3300059503 Bacteria 1160
311 Ga0587082_002596 3300059504 Bacteria 2064
312 Ga0587082_010786 3300059504 Bacteria 1326
313 Ga0587082_017661 3300059504 Bacteria 1127
314 Ga0587083_0000224 3300059505 Bacteria 4272
315 Ga0587083_0001483 3300059505 Bacteria 2656
316 Ga0587083_0026068 3300059505 Bacteria 1126
317 Ga0587086_008743 3300059507 Bacteria 1190
318 Ga0587088_002421 3300059508 Bacteria 2120
319 Ga0587090_005927 3300059510 Bacteria 1553
320 Ga0587091_010099 3300059511 Bacteria 1437
321 Ga0587091_019195 3300059511 Bacteria 1172
322 Ga0587092_015355 3300059512 Bacteria 1120
323 Ga0587098_006848 3300059604 Bacteria 1168
324 Ga0587106_000625 3300059605 Bacteria 2642
325 Ga0587106_000739 3300059605 Bacteria 2529
326 Ga0587125_003706 3300059607 Bacteria 1318
327 Ga0587131_001734 3300059609 Bacteria 1109
328 Ga0587099_005668 3300059622 Bacteria 1131
329 Ga0587117_005240 3300059627 Bacteria 1393
330 Ga0587127_001905 3300059629 Bacteria 1220
331 Ga0587128_013344 3300059630 Bacteria 1158
332 Ga0587130_003677 3300059631 Bacteria 1308
333 Ga0587068_020427 3300059641 Bacteria 1082
334 Ga0587072_005500 3300059643 Bacteria 1893
335 Ga0587072_009885 3300059643 Bacteria 1532
336 Ga0587075_001986 3300059644 Bacteria 2093
337 Ga0587076_017884 3300059645 Bacteria 1135
338 Ga0587079_003798 3300059647 Bacteria 2002
339 Ga0587105_000807 3300059651 Bacteria 1448
340 Ga0587107_005398 3300059652 Bacteria 1350
341 Ga0587110_000795 3300059654 Bacteria 2045
342 Ga0587114_008203 3300059655 Bacteria 1220
343 Ga0587111_0002428 3300060346 Bacteria 2483

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005844 Ga0068862_100084954 Ga0068862_1000849542 283
2 3300005347 Ga0070668_100068027 Ga0070668_1000680272 287
3 3300025972 Ga0207668_10006469 Ga0207668_100064693 287
4 3300041456 Ga0451795_0977500 Ga0451795_0977500_51_944 292
5 3300046471 Ga0495650_0035630 Ga0495650_0035630_1029_2105 296
6 3300049574 Ga0501038_0048499 Ga0501038_0048499_2249_3229 296
7 3300049586 Ga0501070_0092004 Ga0501070_0092004_577_1557 296
8 3300049822 Ga0501035_0069914 Ga0501035_0069914_1713_2693 296
9 3300005985 Ga0081539_10000625 Ga0081539_1000062518 304
10 3300013307 Ga0157372_10449512 Ga0157372_104495122 304
11 3300031456 Ga0307513_10000004 Ga0307513_10000004462 304
12 3300031730 Ga0307516_10081209 Ga0307516_100812092 304
13 3300041456 Ga0451795_0989321 Ga0451795_0989321_828_1874 304
14 3300049823 Ga0501044_0009388 Ga0501044_0009388_2064_3125 305
15 3300005327 Ga0070658_10146122 Ga0070658_101461222 306
16 3300005718 Ga0068866_10039864 Ga0068866_100398642 306
17 3300005719 Ga0068861_100253545 Ga0068861_1002535452 306
18 3300009094 Ga0111539_10141357 Ga0111539_101413572 306
19 3300009176 Ga0105242_10085276 Ga0105242_100852763 306
20 3300025909 Ga0207705_10083427 Ga0207705_100834272 306
21 3300025934 Ga0207686_10071337 Ga0207686_100713372 306
22 3300026075 Ga0207708_10012373 Ga0207708_100123735 306
23 3300028794 Ga0307515_10032128 Ga0307515_100321282 306
24 3300031730 Ga0307516_10062773 Ga0307516_100627732 306
25 3300048917 Ga0496114_0032178 Ga0496114_0032178_1640_2728 306
26 3300059493 Ga0587077_001864 Ga0587077_001864_302_1384 306
27 3300059505 Ga0587083_0001483 Ga0587083_0001483_526_1611 306
28 3300059605 Ga0587106_000625 Ga0587106_000625_996_2078 306
29 3300059651 Ga0587105_000807 Ga0587105_000807_165_1250 306
30 3300014325 Ga0163163_10085665 Ga0163163_100856651 307
31 3300020077 Ga0206351_10760914 Ga0206351_107609141 307
32 3300032126 Ga0307415_100010755 Ga0307415_1000107553 307
33 3300005719 Ga0068861_100261233 Ga0068861_1002612331 308
34 3300010375 Ga0105239_10547420 Ga0105239_105474201 308
35 3300011119 Ga0105246_10126819 Ga0105246_101268192 308
36 3300013307 Ga0157372_10128722 Ga0157372_101287223 308
37 3300026118 Ga0207675_100228371 Ga0207675_1002283712 308
38 3300035207 Ga0373942_0008089 Ga0373942_0008089_524_1537 308
39 3300035242 Ga0373962_0014526 Ga0373962_0014526_167_1180 308
40 3300049822 Ga0501035_0078276 Ga0501035_0078276_783_1796 308
41 3300009093 Ga0105240_10512028 Ga0105240_105120281 309
42 3300031852 Ga0307410_10216341 Ga0307410_102163412 309
43 3300031903 Ga0307407_10022445 Ga0307407_100224452 309
44 3300031911 Ga0307412_10225630 Ga0307412_102256302 309
45 3300032002 Ga0307416_100124744 Ga0307416_1001247442 309
46 3300032126 Ga0307415_100052709 Ga0307415_1000527092 309
47 3300003575 Ga0007409J51694_1022246 Ga0007409J51694_10222461 310
48 3300005366 Ga0070659_100221008 Ga0070659_1002210082 310
49 3300005441 Ga0070700_100117411 Ga0070700_1001174112 310
50 3300005578 Ga0068854_100126131 Ga0068854_1001261312 310
51 3300005616 Ga0068852_100476599 Ga0068852_1004765992 310
52 3300020078 Ga0206352_10445410 Ga0206352_104454102 310
53 3300020078 Ga0206352_10532224 Ga0206352_105322241 310
54 3300025899 Ga0207642_10162150 Ga0207642_101621501 310
55 3300025933 Ga0207706_10086365 Ga0207706_100863651 310
56 3300025937 Ga0207669_10117933 Ga0207669_101179332 310
57 3300025940 Ga0207691_10078229 Ga0207691_100782292 310
58 3300025945 Ga0207679_10063067 Ga0207679_100630673 310
59 3300026075 Ga0207708_10115870 Ga0207708_101158702 310
60 3300026142 Ga0207698_10091441 Ga0207698_100914413 310
61 3300049571 Ga0501034_0114500 Ga0501034_0114500_1046_2020 310
62 3300049581 Ga0501047_0207736 Ga0501047_0207736_681_1655 310
63 3300049584 Ga0501068_0165777 Ga0501068_0165777_71_1045 310
64 3300049586 Ga0501070_0085562 Ga0501070_0085562_830_1804 310
65 3300049589 Ga0501073_0018748 Ga0501073_0018748_3632_4606 310
66 3300049590 Ga0501074_0158650 Ga0501074_0158650_373_1347 310
67 3300049741 Ga0501079_0311004 Ga0501079_0311004_94_1068 310
68 3300049823 Ga0501044_0056678 Ga0501044_0056678_813_1787 310
69 3300042016 Ga0439463_020397 Ga0439463_020397_294_1361 311
70 3300048911 Ga0496108_0000136 Ga0496108_0000136_45760_46773 311
71 3300003203 JGI25406J46586_10012758 JGI25406J46586_100127583 312
72 3300003575 Ga0007409J51694_1015741 Ga0007409J51694_10157411 312
73 3300005353 Ga0070669_100185642 Ga0070669_1001856421 312
74 3300005985 Ga0081539_10000637 Ga0081539_1000063710 312
75 3300005985 Ga0081539_10011985 Ga0081539_100119856 312
76 3300013307 Ga0157372_10456826 Ga0157372_104568262 312
77 3300031456 Ga0307513_10003112 Ga0307513_1000311213 312
78 3300031456 Ga0307513_10117695 Ga0307513_101176953 312
79 3300049128 Ga0501308_005731 Ga0501308_005731_139_1212 312
80 3300049571 Ga0501034_0000066 Ga0501034_0000066_25299_26351 312
81 3300005339 Ga0070660_100074904 Ga0070660_1000749042 313
82 3300005347 Ga0070668_100029857 Ga0070668_1000298572 313
83 3300005364 Ga0070673_100231990 Ga0070673_1002319902 313
84 3300005367 Ga0070667_100180147 Ga0070667_1001801471 313
85 3300005539 Ga0068853_100112447 Ga0068853_1001124472 313
86 3300005617 Ga0068859_100050436 Ga0068859_1000504364 313
87 3300005840 Ga0068870_10021921 Ga0068870_100219212 313
88 3300005841 Ga0068863_100236377 Ga0068863_1002363772 313
89 3300006881 Ga0068865_100019996 Ga0068865_1000199964 313
90 3300006931 Ga0097620_100050436 Ga0097620_1000504364 313
91 3300009177 Ga0105248_10106197 Ga0105248_101061973 313
92 3300020070 Ga0206356_10938532 Ga0206356_109385322 313
93 3300025901 Ga0207688_10045019 Ga0207688_100450191 313
94 3300025907 Ga0207645_10117316 Ga0207645_101173162 313
95 3300025908 Ga0207643_10033378 Ga0207643_100333783 313
96 3300025919 Ga0207657_10320489 Ga0207657_103204891 313
97 3300025942 Ga0207689_10005049 Ga0207689_100050499 313
98 3300025961 Ga0207712_10007694 Ga0207712_100076943 313
99 3300026116 Ga0207674_10054248 Ga0207674_100542482 313
100 3300026118 Ga0207675_100111130 Ga0207675_1001111302 313
101 3300026121 Ga0207683_10165989 Ga0207683_101659892 313
102 3300028380 Ga0268265_10021966 Ga0268265_100219661 313
103 3300038443 Ga0395901_0216411 Ga0395901_0216411_771_1772 313
104 3300042436 Ga0439435_0011139 Ga0439435_0011139_60_1049 313
105 3300044712 Ga0453684_0288839 Ga0453684_0288839_265_1344 313
106 3300048911 Ga0496108_0284459 Ga0496108_0284459_325_1413 313
107 3300049571 Ga0501034_0016038 Ga0501034_0016038_1774_2805 313
108 3300049579 Ga0501043_0029814 Ga0501043_0029814_2418_3449 313
109 3300049580 Ga0501046_0123090 Ga0501046_0123090_254_1285 313
110 3300049581 Ga0501047_0010891 Ga0501047_0010891_3620_4651 313
111 3300049586 Ga0501070_0014927 Ga0501070_0014927_3241_4272 313
112 3300049742 Ga0501080_0197742 Ga0501080_0197742_211_1242 313
113 3300049822 Ga0501035_0005035 Ga0501035_0005035_5284_6315 313
114 3300049823 Ga0501044_0141710 Ga0501044_0141710_698_1729 313
115 3300060346 Ga0587111_0002428 Ga0587111_0002428_1325_2434 313
116 3300035114 Ga0373939_0029750 Ga0373939_0029750_249_1268 314
117 3300049568 Ga0501031_0013840 Ga0501031_0013840_2710_3738 314
118 3300049568 Ga0501031_0074719 Ga0501031_0074719_36_1067 314
119 3300049569 Ga0501032_0030953 Ga0501032_0030953_219_1250 314
120 3300049570 Ga0501033_0011584 Ga0501033_0011584_3690_4721 314
121 3300049571 Ga0501034_0262777 Ga0501034_0262777_620_1648 314
122 3300049573 Ga0501037_0000353 Ga0501037_0000353_2199_3230 314
123 3300049573 Ga0501037_0246324 Ga0501037_0246324_21_1049 314
124 3300049574 Ga0501038_0224696 Ga0501038_0224696_448_1476 314
125 3300049579 Ga0501043_0000022 Ga0501043_0000022_56178_57209 314
126 3300049580 Ga0501046_0052536 Ga0501046_0052536_395_1423 314
127 3300049582 Ga0501048_0252382 Ga0501048_0252382_57_1085 314
128 3300049584 Ga0501068_0012468 Ga0501068_0012468_3728_4759 314
129 3300049584 Ga0501068_0017830 Ga0501068_0017830_2762_3790 314
130 3300049585 Ga0501069_0000035 Ga0501069_0000035_56160_57191 314
131 3300049586 Ga0501070_0000103 Ga0501070_0000103_2934_3965 314
132 3300049586 Ga0501070_0006180 Ga0501070_0006180_1834_2865 314
133 3300049586 Ga0501070_0030503 Ga0501070_0030503_814_1842 314
134 3300049586 Ga0501070_0033271 Ga0501070_0033271_1204_2235 314
135 3300049587 Ga0501071_0003562 Ga0501071_0003562_2005_3036 314
136 3300049589 Ga0501073_0019725 Ga0501073_0019725_2399_3430 314
137 3300049590 Ga0501074_0000327 Ga0501074_0000327_7255_8286 314
138 3300049742 Ga0501080_0025712 Ga0501080_0025712_3789_4820 314
139 3300049822 Ga0501035_0000139 Ga0501035_0000139_31114_32145 314
140 3300049823 Ga0501044_0000578 Ga0501044_0000578_4770_5801 314
141 3300049823 Ga0501044_0071659 Ga0501044_0071659_1793_2824 314
142 3300049823 Ga0501044_0144729 Ga0501044_0144729_334_1365 314
143 3300059647 Ga0587079_003798 Ga0587079_003798_889_1968 314
144 iso_pu_bacteria 2751185782 2753272268 314
145 iso_pu_bacteria 2939669807 2939669974 314
146 3300031730 Ga0307516_10001634 Ga0307516_1000163417 315
147 3300041451 Ga0451791_0167513 Ga0451791_0167513_1920_2978 315
148 3300041453 Ga0451797_0018404 Ga0451797_0018404_190_1248 315
149 iso_pu_bacteria 2898795034 2898795786 315
150 3300032002 Ga0307416_100602650 Ga0307416_1006026501 316
151 3300041413 Ga0439465_0018416 Ga0439465_0018416_579_1616 316
152 3300041512 Ga0451853_1360360 Ga0451853_1360360_155_1240 316
153 iso_pu_bacteria 2837651117 2837653991 316
154 3300003203 JGI25406J46586_10035576 JGI25406J46586_100355762 317
155 3300004799 Ga0058863_11941704 Ga0058863_119417041 317
156 3300005985 Ga0081539_10003444 Ga0081539_100034446 317
157 3300005985 Ga0081539_10074995 Ga0081539_100749952 317
158 3300020077 Ga0206351_10089958 Ga0206351_100899582 317
159 3300028794 Ga0307515_10016695 Ga0307515_100166952 317
160 3300031507 Ga0307509_10010313 Ga0307509_100103132 317
161 3300031730 Ga0307516_10062844 Ga0307516_100628444 317
162 3300031731 Ga0307405_10247002 Ga0307405_102470021 317
163 3300031995 Ga0307409_100096008 Ga0307409_1000960082 317
164 3300032126 Ga0307415_100034981 Ga0307415_1000349812 317
165 3300034817 Ga0373948_0007197 Ga0373948_0007197_595_1644 317
166 3300037466 Ga0395898_0145109 Ga0395898_0145109_1157_2221 317
167 3300039437 Ga0436365_1202722 Ga0436365_1202722_112_1113 317
168 3300041512 Ga0451853_0199027 Ga0451853_0199027_253_1278 317
169 3300053109 Ga0500569_004552 Ga0500569_004552_500_1552 317
170 iso_pu_bacteria 2816332139 2816505472 317
171 iso_pu_bacteria 2932401849 2932402380 317
172 3300009093 Ga0105240_10116036 Ga0105240_101160361 318
173 3300015265 Ga0182005_1025826 Ga0182005_10258262 318
174 3300025294 Ga0209025_1076526 Ga0209025_10765261 318
175 3300025921 Ga0207652_10247985 Ga0207652_102479852 318
176 3300049536 Ga0501320_005339 Ga0501320_005339_38_1114 318
177 3300009551 Ga0105238_10028901 Ga0105238_100289012 319
178 3300028794 Ga0307515_10031929 Ga0307515_100319296 319
179 3300031730 Ga0307516_10009002 Ga0307516_100090022 319
180 3300031731 Ga0307405_10086286 Ga0307405_100862862 319
181 3300031852 Ga0307410_10271259 Ga0307410_102712591 319
182 3300031903 Ga0307407_10022238 Ga0307407_100222382 319
183 3300031911 Ga0307412_10022169 Ga0307412_100221692 319
184 3300031995 Ga0307409_100052931 Ga0307409_1000529312 319
185 3300032004 Ga0307414_10122708 Ga0307414_101227081 319
186 3300048914 Ga0496111_0041994 Ga0496111_0041994_749_1768 319
187 3300048928 Ga0496125_0001401 Ga0496125_0001401_15708_16727 319
188 iso_pu_bacteria 2599185301 2599939899 319
189 iso_pu_bacteria 2791355123 2792750792 319
190 iso_pu_bacteria 2869162929 2869168109 319
191 iso_pu_bacteria 2937822353 2937828414 319
192 iso_pu_bacteria 2958064165 2958066147 319
193 3300005367 Ga0070667_100026653 Ga0070667_1000266533 320
194 3300005456 Ga0070678_100227081 Ga0070678_1002270812 320
195 3300005985 Ga0081539_10011727 Ga0081539_100117272 320
196 3300009174 Ga0105241_10070558 Ga0105241_100705581 320
197 3300025942 Ga0207689_10030336 Ga0207689_100303362 320
198 3300025986 Ga0207658_10064346 Ga0207658_100643463 320
199 3300026121 Ga0207683_10032231 Ga0207683_100322312 320
200 3300028786 Ga0307517_10074881 Ga0307517_100748812 320
201 3300028794 Ga0307515_10004370 Ga0307515_1000437023 320
202 3300028794 Ga0307515_10072941 Ga0307515_100729412 320
203 3300030522 Ga0307512_10025405 Ga0307512_100254053 320
204 3300031456 Ga0307513_10034606 Ga0307513_100346062 320
205 3300031730 Ga0307516_10010387 Ga0307516_100103877 320
206 3300031730 Ga0307516_10214297 Ga0307516_102142972 320
207 3300039453 Ga0436362_0756631 Ga0436362_0756631_269_1291 320
208 3300005327 Ga0070658_10002384 Ga0070658_1000238413 321
209 3300005339 Ga0070660_100073407 Ga0070660_1000734073 321
210 3300005344 Ga0070661_100002956 Ga0070661_1000029563 321
211 3300005344 Ga0070661_100177155 Ga0070661_1001771551 321
212 3300005366 Ga0070659_100025829 Ga0070659_1000258292 321
213 3300005458 Ga0070681_10138204 Ga0070681_101382042 321
214 3300005518 Ga0070699_100245579 Ga0070699_1002455791 321
215 3300005548 Ga0070665_100256309 Ga0070665_1002563092 321
216 3300005578 Ga0068854_100056539 Ga0068854_1000565393 321
217 3300005614 Ga0068856_100029490 Ga0068856_1000294903 321
218 3300005616 Ga0068852_100005219 Ga0068852_1000052193 321
219 3300006163 Ga0070715_10027339 Ga0070715_100273391 321
220 3300006175 Ga0070712_100220412 Ga0070712_1002204122 321
221 3300009545 Ga0105237_10001906 Ga0105237_100019065 321
222 3300010375 Ga0105239_10095224 Ga0105239_100952243 321
223 3300013102 Ga0157371_10013041 Ga0157371_100130415 321
224 3300013102 Ga0157371_10052221 Ga0157371_100522212 321
225 3300013104 Ga0157370_10009366 Ga0157370_100093665 321
226 3300013104 Ga0157370_10013336 Ga0157370_100133364 321
227 3300013105 Ga0157369_10019547 Ga0157369_100195477 321
228 3300014968 Ga0157379_10373573 Ga0157379_103735731 321
229 3300020070 Ga0206356_11281493 Ga0206356_112814931 321
230 3300025905 Ga0207685_10118503 Ga0207685_101185031 321
231 3300025910 Ga0207684_10072784 Ga0207684_100727843 321
232 3300025913 Ga0207695_10043453 Ga0207695_100434532 321
233 3300025914 Ga0207671_10000168 Ga0207671_1000016847 321
234 3300025919 Ga0207657_10074907 Ga0207657_100749072 321
235 3300025920 Ga0207649_10013572 Ga0207649_100135724 321
236 3300025949 Ga0207667_10008878 Ga0207667_100088783 321
237 3300025981 Ga0207640_10061579 Ga0207640_100615792 321
238 3300026067 Ga0207678_10091943 Ga0207678_100919433 321
239 3300026078 Ga0207702_10008133 Ga0207702_100081335 321
240 3300026078 Ga0207702_10034572 Ga0207702_100345723 321
241 3300026142 Ga0207698_10009753 Ga0207698_100097533 321
242 3300028379 Ga0268266_10000691 Ga0268266_1000069119 321
243 3300036401 Ga0373937_0197433 Ga0373937_0197433_185_1216 321
244 3300037312 Ga0395899_0121916 Ga0395899_0121916_167_1183 321
245 3300048928 Ga0496125_0144314 Ga0496125_0144314_290_1318 321
246 3300053151 Ga0500604_0000260 Ga0500604_0000260_1923_2960 321
247 3300053161 Ga0500634_0000002 Ga0500634_0000002_178785_179813 321
248 3300059652 Ga0587107_005398 Ga0587107_005398_49_1077 321
249 3300004799 Ga0058863_10002528 Ga0058863_100025281 322
250 3300004800 Ga0058861_11870310 Ga0058861_118703101 322
251 3300005327 Ga0070658_10068797 Ga0070658_100687971 322
252 3300005366 Ga0070659_100045728 Ga0070659_1000457283 322
253 3300005563 Ga0068855_100043568 Ga0068855_1000435682 322
254 3300013104 Ga0157370_10411834 Ga0157370_104118341 322
255 3300013105 Ga0157369_10214144 Ga0157369_102141442 322
256 3300013296 Ga0157374_10032892 Ga0157374_100328922 322
257 3300025261 Ga0209233_1001631 Ga0209233_10016317 322
258 3300025904 Ga0207647_10027394 Ga0207647_100273942 322
259 3300025909 Ga0207705_10003617 Ga0207705_100036174 322
260 3300025919 Ga0207657_10003579 Ga0207657_100035799 322
261 3300025949 Ga0207667_10023438 Ga0207667_100234385 322
262 3300026067 Ga0207678_10056960 Ga0207678_100569602 322
263 3300031235 Ga0265330_10046612 Ga0265330_100466122 322
264 3300031247 Ga0265340_10000264 Ga0265340_100002643 322
265 3300031344 Ga0265316_10009686 Ga0265316_100096868 322
266 3300031595 Ga0265313_10006384 Ga0265313_100063845 322
267 3300031712 Ga0265342_10007507 Ga0265342_100075075 322
268 3300031824 Ga0307413_10120912 Ga0307413_101209122 322
269 3300037418 Ga0395900_0007854 Ga0395900_0007854_4301_5329 322
270 3300037466 Ga0395898_0020956 Ga0395898_0020956_21_1049 322
271 3300038443 Ga0395901_0013798 Ga0395901_0013798_1939_2967 322
272 3300042006 Ga0439432_033292 Ga0439432_033292_591_1613 322
273 3300049572 Ga0501036_0144698 Ga0501036_0144698_808_1845 322
274 3300049579 Ga0501043_0162219 Ga0501043_0162219_525_1562 322
275 3300049586 Ga0501070_0142908 Ga0501070_0142908_177_1205 322
276 3300049589 Ga0501073_0095824 Ga0501073_0095824_292_1329 322
277 3300059641 Ga0587068_020427 Ga0587068_020427_26_1045 322
278 3300002705 JGI25156J39149_1005825 JGI25156J39149_10058252 323
279 3300002741 JGI25157J39369_1001027 JGI25157J39369_10010275 323
280 3300003203 JGI25406J46586_10004820 JGI25406J46586_100048205 323
281 3300003214 JGI25165J46597_1000016 JGI25165J46597_1000016130 323
282 3300003575 Ga0007409J51694_1043664 Ga0007409J51694_10436641 323
283 3300005455 Ga0070663_100007652 Ga0070663_1000076524 323
284 3300005548 Ga0070665_100025941 Ga0070665_1000259415 323
285 3300005549 Ga0070704_100198708 Ga0070704_1001987082 323
286 3300005983 Ga0081540_1029022 Ga0081540_10290222 323
287 3300005985 Ga0081539_10003049 Ga0081539_100030497 323
288 3300006038 Ga0075365_10054896 Ga0075365_100548962 323
289 3300009551 Ga0105238_10033342 Ga0105238_100333424 323
290 3300013105 Ga0157369_10104502 Ga0157369_101045022 323
291 3300017792 Ga0163161_10093954 Ga0163161_100939542 323
292 3300020078 Ga0206352_11166553 Ga0206352_111665531 323
293 3300020080 Ga0206350_10552220 Ga0206350_105522201 323
294 3300025250 Ga0209026_1000005 Ga0209026_1000005236 323
295 3300025256 Ga0209759_1000106 Ga0209759_1000106119 323
296 3300025261 Ga0209233_1000068 Ga0209233_1000068131 323
297 3300025911 Ga0207654_10113149 Ga0207654_101131492 323
298 3300025913 Ga0207695_10117850 Ga0207695_101178503 323
299 3300025914 Ga0207671_10251866 Ga0207671_102518661 323
300 3300025924 Ga0207694_10013184 Ga0207694_100131842 323
301 3300026041 Ga0207639_10001998 Ga0207639_100019982 323
302 3300026041 Ga0207639_10115273 Ga0207639_101152732 323
303 3300026067 Ga0207678_10021057 Ga0207678_100210574 323
304 3300026067 Ga0207678_10023358 Ga0207678_100233583 323
305 3300028379 Ga0268266_10004502 Ga0268266_100045026 323
306 3300031548 Ga0307408_100390225 Ga0307408_1003902251 323
307 3300037418 Ga0395900_0430451 Ga0395900_0430451_32_1060 323
308 3300039450 Ga0436363_0844810 Ga0436363_0844810_1589_2626 323
309 3300047472 Ga0495686_0090755 Ga0495686_0090755_363_1382 323
310 3300048913 Ga0496110_0340884 Ga0496110_0340884_299_1354 323
311 3300048923 Ga0496120_0008764 Ga0496120_0008764_450_1514 323
312 3300048929 Ga0496126_0030068 Ga0496126_0030068_3831_4895 323
313 3300049571 Ga0501034_0156010 Ga0501034_0156010_836_1879 323
314 3300049581 Ga0501047_0024456 Ga0501047_0024456_2123_3166 323
315 3300049581 Ga0501047_0175886 Ga0501047_0175886_160_1188 323
316 3300049585 Ga0501069_0034369 Ga0501069_0034369_1331_2374 323
317 3300049742 Ga0501080_0079920 Ga0501080_0079920_1193_2236 323
318 3300049822 Ga0501035_0037518 Ga0501035_0037518_2286_3329 323
319 3300050512 nmdc:mga0n895_545521_c1 nmdc:mga0n895_545521_c1_90_1145 323
320 3300053153 Ga0500616_0034463 Ga0500616_0034463_1023_2042 323
321 3300054114 Ga0501084_0078793 Ga0501084_0078793_1173_2216 323
322 3300059490 Ga0587066_002827 Ga0587066_002827_868_1932 323
323 3300059491 Ga0587070_005511 Ga0587070_005511_34_1098 323
324 3300059492 Ga0587073_0023587 Ga0587073_0023587_112_1176 323
325 3300059493 Ga0587077_003499 Ga0587077_003499_896_1933 323
326 3300059493 Ga0587077_005136 Ga0587077_005136_669_1733 323
327 3300059503 Ga0587080_014106 Ga0587080_014106_147_1184 323
328 3300059503 Ga0587080_016774 Ga0587080_016774_34_1098 323
329 3300059504 Ga0587082_002596 Ga0587082_002596_38_1102 323
330 3300059504 Ga0587082_010786 Ga0587082_010786_228_1292 323
331 3300059504 Ga0587082_017661 Ga0587082_017661_40_1077 323
332 3300059505 Ga0587083_0000224 Ga0587083_0000224_3170_4234 323
333 3300059505 Ga0587083_0026068 Ga0587083_0026068_39_1076 323
334 3300059507 Ga0587086_008743 Ga0587086_008743_104_1141 323
335 3300059508 Ga0587088_002421 Ga0587088_002421_1035_2072 323
336 3300059510 Ga0587090_005927 Ga0587090_005927_468_1505 323
337 3300059511 Ga0587091_010099 Ga0587091_010099_52_1089 323
338 3300059511 Ga0587091_019195 Ga0587091_019195_73_1101 323
339 3300059512 Ga0587092_015355 Ga0587092_015355_49_1086 323
340 3300059604 Ga0587098_006848 Ga0587098_006848_76_1140 323
341 3300059605 Ga0587106_000739 Ga0587106_000739_1352_2416 323
342 3300059607 Ga0587125_003706 Ga0587125_003706_34_1098 323
343 3300059609 Ga0587131_001734 Ga0587131_001734_17_1081 323
344 3300059622 Ga0587099_005668 Ga0587099_005668_29_1093 323
345 3300059627 Ga0587117_005240 Ga0587117_005240_295_1359 323
346 3300059629 Ga0587127_001905 Ga0587127_001905_122_1186 323
347 3300059630 Ga0587128_013344 Ga0587128_013344_73_1110 323
348 3300059631 Ga0587130_003677 Ga0587130_003677_28_1092 323
349 3300059643 Ga0587072_005500 Ga0587072_005500_28_1092 323
350 3300059643 Ga0587072_009885 Ga0587072_009885_449_1486 323
351 3300059644 Ga0587075_001986 Ga0587075_001986_51_1088 323
352 3300059645 Ga0587076_017884 Ga0587076_017884_52_1089 323
353 3300059654 Ga0587110_000795 Ga0587110_000795_34_1098 323
354 3300059655 Ga0587114_008203 Ga0587114_008203_122_1186 323
355 iso_pu_bacteria 2503198000 2503203516 323

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13407

Peripla_BP_4

Periplasmic binding protein domain

71

344

0.91

PF00532

Peripla_BP_1

Periplasmic binding proteins and sugar binding domain of LacI family

68

347

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
7e7m-assembly4.cif.gz_D crystal structure analysis of the streptococcus agalactiae ribose binding protein rbsb 0.8848 23 302
5dte-assembly3.cif.gz_C crystal structure of an abc transporter periplasmic solute binding protein (ipr025997) from actinobacillus succinogenes 130z(asuc_0081, target efi-511065) with bound d-allose 0.8823 26 302
4ry9-assembly2.cif.gz_B crystal structure of carbohydrate transporter solute binding protein veis_2079 from verminephrobacter eiseniae ef01-2, target efi-511009, a complex with d-talitol 0.8807 25 302
4zjp-assembly1.cif.gz_A structure of an abc-transporter solute binding protein (sbp_ipr025997) from actinobacillus succinogenes (asuc_0197, target efi-511067) with bound beta-d-ribopyranose 0.8801 23 302
2gx6-assembly1.cif.gz_A rational stabilization of e. coli ribose binding protein 0.8765 25 302
ID Description Score Start End Superfamily
4ry9B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9093 25 118 3.40.50.2300
4rxmB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9081 25 105 3.40.50.2300
4wzzA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9064 24 116 3.40.50.2300
5dteD02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.904 116 268 3.40.50.2300
3brsB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9028 23 118 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A528B2M1-F1-model_v4 Sugar ABC transporter substrate-binding protein 0.9755 117 323 GO:0030246
GO:0030313
AF-A0A382UPX3-F1-model_v4 Periplasmic binding protein domain-containing protein 0.9702 24 311 GO:0030246
GO:0030313
AF-A0A531LN69-F1-model_v4 Sugar ABC transporter substrate-binding protein 0.97 81 193
AF-A0A528WHR5-F1-model_v4 Sugar ABC transporter substrate-binding protein 0.9658 126 323 GO:0030246
GO:0030313
AF-A0A531LN69-F1-model_v4 Sugar ABC transporter substrate-binding protein 0.9617 81 193

Feature Viewer

pLDDT pTM Quality
89.33 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map