F420071

General Info

Members Datasets Scaffolds Average Seq Length
355 257 710 284

Family's Representative Sequence

Representative Sequence 3300006048|Ga0075363_100014801|Ga0075363_1000148013
Length 313
Sequence MTTDSIPVQATDARPKTARKTSKAAPSGARRRQLFRHPGAGRQHHAGPVAYILLGLAALVSLFPLYWTMVAASTDNTRVTQTPPPFLPGPHLLENLGKAWQDAALGKAMLNSLIVAGAIALSTVLFATLAGFAFAKLRFKGRNILLMLVIGTMMVPPQLGVVPLFMMMTELGWGQKLPAVIFPTLVSAVGVFFMRQYLSEALPDELVEAGRVDGAHSLRIFWSIVLPIARPPMAVLFMITFVHAWNDFFWPFIVLDMTNPTVPVALTQLSAGYVRDQSLIMAGALLGTLPLLALFVVFGRQIVGGIMQGAVKG

Samples

Sample ID Description Type Environment
1 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
34 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
50 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
63 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
65 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
66 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
67 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
68 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
69 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
70 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
71 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
72 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
73 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
74 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
75 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
76 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
77 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
78 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
79 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
80 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
81 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
82 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
83 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
84 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
85 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
86 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
87 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
88 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
89 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
90 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
91 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
92 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
93 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
94 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
95 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
96 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
97 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
98 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
99 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
100 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
101 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
102 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
103 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
104 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
105 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
106 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
107 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
108 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
109 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
110 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
111 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
112 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
113 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
114 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
115 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
116 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
117 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
118 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
119 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
120 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
121 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
122 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
123 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
124 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
125 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
126 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
127 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
128 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
129 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
130 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
131 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
132 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
133 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
134 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
135 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
136 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
137 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
138 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
139 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
140 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
141 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
142 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
143 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
144 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
145 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
146 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
147 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
148 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
149 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
150 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
151 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
152 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
153 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
154 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
155 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
156 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
157 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
158 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
159 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
160 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
161 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
162 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
163 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
177 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
178 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
179 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
180 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
181 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
182 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
183 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
184 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
185 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
186 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
189 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
190 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
191 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
192 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
193 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
194 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
195 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
196 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
197 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
198 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
199 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
200 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
202 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
203 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
204 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
205 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
206 2643221575 Microbacterium sp. Root61 Isolate Unclassified
207 2671180694 Paenibacillus sp. A3 Isolate Unclassified
208 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
209 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
210 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
211 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
212 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
213 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
214 2808606448 Streptomyces sp. 193411 Isolate Unclassified
215 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
216 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
217 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
218 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
219 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
220 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
221 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
222 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
223 2867428634 Streptomyces sp. RP5T Isolate Unclassified
224 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
225 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
226 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
227 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
228 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
229 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
230 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
231 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
232 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
233 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
234 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
235 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
236 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
237 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
238 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
239 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
240 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
241 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
242 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
243 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
244 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
245 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
246 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
247 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
248 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
249 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
250 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
251 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
252 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
253 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
254 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
255 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
256 8054280661 Metabacillus kandeliae GX 13764 Isolate Rhizosphere
257 8054795415 Paenibacillus periandrae PM10 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 82.54
Metatranscriptomes 0.56
Isolates 16.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.54
Nodule 0.56
Rhizoplane 5.92
Rhizosphere 78.87
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075363_100014801 3300006048 Bacteria 3822
2 JGI24735J21928_10032268 3300002067 Bacteria 1551
3 JGI25406J46586_10000703 3300003203 Bacteria 15622
4 rootH2_10051798 3300003320 Bacteria 4275
5 rootH1_10031393 3300003323 Bacteria 1607
6 Ga0055541_1001239 3300003841 Bacteria 5634
7 Ga0065715_10114750 3300005293 Bacteria 2439
8 Ga0065707_10094032 3300005295 Bacteria 3547
9 Ga0070658_10358769 3300005327 Bacteria 1248
10 Ga0070683_100004739 3300005329 Bacteria 11254
11 Ga0070683_100669481 3300005329 Bacteria 994
12 Ga0070680_100174281 3300005336 Bacteria 1811
13 Ga0070682_100353173 3300005337 Bacteria 1097
14 Ga0070668_100278524 3300005347 Bacteria 1396
15 Ga0070674_100146277 3300005356 Bacteria 1779
16 Ga0070714_100008946 3300005435 Bacteria 7837
17 Ga0070713_100025319 3300005436 Bacteria 4638
18 Ga0070678_100378619 3300005456 Bacteria 1224
19 Ga0070681_10541155 3300005458 Bacteria 1078
20 Ga0068867_100392151 3300005459 Bacteria 1169
21 Ga0070679_100427275 3300005530 Bacteria 1270
22 Ga0070684_100659426 3300005535 Bacteria 974
23 Ga0068853_100036638 3300005539 Bacteria 4173
24 Ga0070665_100018383 3300005548 Bacteria 7005
25 Ga0070665_100023797 3300005548 Bacteria 6170
26 Ga0068855_100005701 3300005563 Bacteria 15212
27 Ga0068856_100048495 3300005614 Bacteria 4186
28 Ga0068852_100007612 3300005616 Bacteria 7920
29 Ga0068852_100969124 3300005616 Bacteria 869
30 Ga0068870_10106456 3300005840 Bacteria 1594
31 Ga0068863_100009355 3300005841 Bacteria 9562
32 Ga0081539_10000286 3300005985 Bacteria 114239
33 Ga0070717_10000727 3300006028 Bacteria 21428
34 Ga0075428_100007485 3300006844 Bacteria 12101
35 Ga0075431_100018048 3300006847 Bacteria 7177
36 Ga0075429_100070992 3300006880 Bacteria 3032
37 Ga0105244_10060088 3300009036 Bacteria 1915
38 Ga0105240_10013170 3300009093 Bacteria 11377
39 Ga0111539_10000093 3300009094 Bacteria 94060
40 Ga0105243_10541305 3300009148 Bacteria 1111
41 Ga0105241_10002382 3300009174 Bacteria 14113
42 Ga0105248_10094891 3300009177 Bacteria 3358
43 Ga0105237_10113366 3300009545 Bacteria 2704
44 Ga0105238_10022662 3300009551 Bacteria 6400
45 Ga0105239_10034741 3300010375 Bacteria 5538
46 Ga0105239_10822873 3300010375 Bacteria 1064
47 Ga0157369_10061530 3300013105 Bacteria 4047
48 Ga0157374_10018252 3300013296 Bacteria 6189
49 Ga0157374_10331614 3300013296 Bacteria 1509
50 Ga0163162_10301278 3300013306 Bacteria 1735
51 Ga0157372_10479911 3300013307 Bacteria 1449
52 Ga0157372_10560764 3300013307 Bacteria 1331
53 Ga0206353_11717966 3300020082 Bacteria 1930
54 Ga0209566_100046 3300025225 Bacteria 247053
55 Ga0209437_100483 3300025233 Bacteria 30009
56 Ga0207654_10002767 3300025911 Bacteria 8907
57 Ga0207695_10003124 3300025913 Bacteria 23688
58 Ga0207671_10000170 3300025914 Bacteria 99729
59 Ga0207652_10339654 3300025921 Bacteria 1356
60 Ga0207694_10003270 3300025924 Bacteria 12912
61 Ga0207664_10007595 3300025929 Bacteria 7522
62 Ga0207670_10056902 3300025936 Bacteria 2650
63 Ga0207661_10052412 3300025944 Bacteria 3260
64 Ga0207667_10021927 3300025949 Bacteria 7070
65 Ga0207639_10005566 3300026041 Bacteria 8519
66 Ga0207702_10075674 3300026078 Bacteria 2909
67 Ga0207698_10007361 3300026142 Bacteria 6897
68 Ga0207428_10000147 3300027907 Bacteria 95314
69 Ga0268266_10041714 3300028379 Bacteria 3917
70 Ga0307517_10009904 3300028786 Bacteria 13423
71 Ga0307515_10210359 3300028794 Bacteria 1791
72 Ga0307512_10005602 3300030522 Bacteria 13026
73 Ga0307513_10005762 3300031456 Bacteria 16293
74 Ga0307513_10084610 3300031456 Bacteria 3257
75 Ga0307513_10152774 3300031456 Bacteria 2214
76 Ga0307514_10001390 3300031649 Bacteria 30145
77 Ga0307405_10222734 3300031731 Bacteria 1385
78 Ga0307413_10003628 3300031824 Bacteria 6548
79 Ga0307409_100198221 3300031995 Bacteria 1794
80 Ga0307415_100110943 3300032126 Bacteria 2035
81 Ga0395899_0292693 3300037312 Bacteria 1104
82 Ga0395900_0011199 3300037418 Bacteria 9173
83 Ga0395898_0211923 3300037466 Bacteria 1848
84 Ga0395898_0308059 3300037466 Bacteria 1511
85 Ga0395898_0617116 3300037466 Bacteria 1027
86 Ga0395901_0037302 3300038443 Bacteria 5027
87 Ga0451853_1301325 3300041512 Bacteria 7962
88 Ga0439442_002982 3300042002 Bacteria 3340
89 Ga0439448_0007801 3300042005 Bacteria 3111
90 Ga0439449_0000183 3300042007 Bacteria 21770
91 Ga0439450_027491 3300042008 Bacteria 1260
92 Ga0439457_000427 3300042014 Bacteria 12122
93 Ga0439457_002796 3300042014 Bacteria 4880
94 Ga0439457_007440 3300042014 Bacteria 2627
95 Ga0439462_0018330 3300042015 Bacteria 1818
96 Ga0450894_000879 3300042131 Bacteria 4797
97 Ga0450894_011721 3300042131 Bacteria 1142
98 Ga0450895_001067 3300042132 Bacteria 1822
99 Ga0450896_003786 3300042133 Bacteria 2028
100 Ga0450898_007744 3300042134 Bacteria 1678
101 Ga0450899_001242 3300042135 Bacteria 2889
102 Ga0450900_013898 3300042136 Bacteria 1069
103 Ga0450903_000760 3300042138 Bacteria 6322
104 Ga0450903_006326 3300042138 Bacteria 1970
105 Ga0450906_002992 3300042145 Bacteria 3667
106 Ga0450906_005896 3300042145 Bacteria 2496
107 Ga0439458_0002656 3300042157 Bacteria 4310
108 Ga0466969_0004480 3300044656 Bacteria 7438
109 Ga0466965_0018876 3300044683 Bacteria 3308
110 Ga0466966_0004131 3300044684 Bacteria 9587
111 Ga0466961_0005459 3300044693 Bacteria 8020
112 Ga0466961_0023247 3300044693 Bacteria 3988
113 Ga0466963_0100940 3300044694 Bacteria 1975
114 Ga0466971_0190820 3300044719 Bacteria 965
115 Ga0466970_0001976 3300044765 Bacteria 9917
116 Ga0466970_0041068 3300044765 Bacteria 2457
117 Ga0466957_0232303 3300044842 Bacteria 1221
118 Ga0466960_0127322 3300044901 Bacteria 1340
119 Ga0466959_0004355 3300045049 Bacteria 9469
120 Ga0466959_0048721 3300045049 Bacteria 3114
121 Ga0466967_0014947 3300045976 Bacteria 6070
122 Ga0466967_0026600 3300045976 Bacteria 4794
123 Ga0466967_0032186 3300045976 Bacteria 4425
124 Ga0466967_0047267 3300045976 Bacteria 3751
125 Ga0466967_0083570 3300045976 Bacteria 2887
126 Ga0495617_091326 3300046452 Bacteria 993
127 Ga0495592_0094596 3300046454 Bacteria 2138
128 Ga0495592_0096390 3300046454 Bacteria 2114
129 Ga0495603_0018653 3300046455 Bacteria 4197
130 Ga0495603_0207919 3300046455 Bacteria 1130
131 Ga0495638_0091145 3300046460 Bacteria 1836
132 Ga0495641_0064215 3300046461 Bacteria 1654
133 Ga0495641_0076528 3300046461 Bacteria 1500
134 Ga0495651_0000176 3300046462 Bacteria 47308
135 Ga0495651_0099742 3300046462 Bacteria 2165
136 Ga0495580_0057076 3300046472 Bacteria 2748
137 Ga0495582_0064038 3300046473 Bacteria 2030
138 Ga0495605_0040546 3300046474 Bacteria 2323
139 Ga0495594_0007586 3300046499 Bacteria 5584
140 Ga0495607_0011532 3300046501 Bacteria 5879
141 Ga0495606_0007008 3300046507 Bacteria 10229
142 Ga0495616_0026651 3300046513 Bacteria 3073
143 Ga0495620_0119119 3300046515 Bacteria 1041
144 Ga0495628_0008457 3300046516 Bacteria 8824
145 Ga0495631_0013426 3300046518 Bacteria 3976
146 Ga0495648_0023170 3300046524 Bacteria 4259
147 Ga0495652_0001006 3300046529 Bacteria 32271
148 Ga0495654_0039995 3300046530 Bacteria 2338
149 Ga0495640_0017241 3300046533 Bacteria 5385
150 Ga0495609_0047569 3300046538 Bacteria 1919
151 Ga0495645_0069422 3300046543 Bacteria 2544
152 Ga0495635_0024352 3300046663 Bacteria 4219
153 Ga0495661_0017810 3300046665 Bacteria 4682
154 Ga0495657_0122133 3300046675 Bacteria 1639
155 Ga0495658_0011719 3300046683 Bacteria 4418
156 Ga0495613_0084312 3300046689 Bacteria 2307
157 Ga0495624_0003563 3300046690 Bacteria 11529
158 Ga0495670_0059210 3300046691 Bacteria 1923
159 Ga0495600_0041688 3300046809 Bacteria 2992
160 Ga0495604_0057609 3300047317 Bacteria 2987
161 Ga0495604_0075623 3300047317 Bacteria 2535
162 Ga0495674_0387241 3300047319 Bacteria 1130
163 Ga0495672_0117572 3300047320 Bacteria 1418
164 Ga0495676_0007630 3300047321 Bacteria 9922
165 Ga0495676_0118799 3300047321 Bacteria 1927
166 Ga0495680_0040129 3300047322 Bacteria 3730
167 Ga0495675_0053517 3300047444 Bacteria 2562
168 Ga0495677_0024588 3300047445 Bacteria 2185
169 Ga0495685_037385 3300047447 Bacteria 1664
170 Ga0495686_0005810 3300047472 Bacteria 9621
171 Ga0495686_0016827 3300047472 Bacteria 4945
172 Ga0495686_0095109 3300047472 Bacteria 1804
173 Ga0495593_0084688 3300047673 Bacteria 1636
174 Ga0495626_0006240 3300048091 Bacteria 6808
175 Ga0496101_0029003 3300048904 Bacteria 3869
176 Ga0496101_0385226 3300048904 Bacteria 1103
177 Ga0496102_0157886 3300048905 Bacteria 2133
178 Ga0496102_0227477 3300048905 Bacteria 1759
179 Ga0496104_0098738 3300048907 Bacteria 2795
180 Ga0496105_0113514 3300048908 Bacteria 2235
181 Ga0496105_0161262 3300048908 Bacteria 1841
182 Ga0496105_0191145 3300048908 Bacteria 1674
183 Ga0496107_0058965 3300048910 Bacteria 2777
184 Ga0496108_0024491 3300048911 Bacteria 4970
185 Ga0496108_0487256 3300048911 Bacteria 1077
186 Ga0496109_0021616 3300048912 Bacteria 5692
187 Ga0496110_0024103 3300048913 Bacteria 5185
188 Ga0496110_0069022 3300048913 Bacteria 3129
189 Ga0496110_0114322 3300048913 Bacteria 2429
190 Ga0496111_0030478 3300048914 Bacteria 3836
191 Ga0496111_0148111 3300048914 Bacteria 1741
192 Ga0496111_0151548 3300048914 Bacteria 1720
193 Ga0496112_0508583 3300048915 Bacteria 1140
194 Ga0496114_0020294 3300048917 Bacteria 5392
195 Ga0496114_0276340 3300048917 Bacteria 1480
196 Ga0496116_0001250 3300048919 Bacteria 29519
197 Ga0496121_0141263 3300048924 Bacteria 1786
198 Ga0496122_0084344 3300048925 Bacteria 2198
199 Ga0496124_0027690 3300048927 Bacteria 5081
200 Ga0496124_0109655 3300048927 Bacteria 2224
201 Ga0496125_0006592 3300048928 Bacteria 12500
202 Ga0495678_099541 3300049459 Bacteria 1009
203 Ga0495682_0021324 3300049460 Bacteria 2428
204 Ga0501031_0004116 3300049568 Bacteria 9395
205 Ga0501032_0003847 3300049569 Bacteria 11400
206 Ga0501032_0007622 3300049569 Bacteria 7892
207 Ga0501032_0009566 3300049569 Bacteria 7028
208 Ga0501032_0248406 3300049569 Bacteria 1155
209 Ga0501033_0000784 3300049570 Bacteria 29162
210 Ga0501033_0005502 3300049570 Bacteria 10027
211 Ga0501033_0039628 3300049570 Bacteria 3519
212 Ga0501034_0002409 3300049571 Bacteria 22644
213 Ga0501034_0029852 3300049571 Bacteria 5541
214 Ga0501034_0033531 3300049571 Bacteria 5208
215 Ga0501034_0155605 3300049571 Bacteria 2260
216 Ga0501034_0158458 3300049571 Bacteria 2236
217 Ga0501036_0012153 3300049572 Bacteria 7133
218 Ga0501036_0014955 3300049572 Bacteria 6473
219 Ga0501036_0078839 3300049572 Bacteria 2786
220 Ga0501037_0000913 3300049573 Bacteria 22000
221 Ga0501037_0007103 3300049573 Bacteria 8184
222 Ga0501037_0246812 3300049573 Bacteria 1250
223 Ga0501038_0000102 3300049574 Bacteria 72409
224 Ga0501038_0007717 3300049574 Bacteria 9920
225 Ga0501038_0026125 3300049574 Bacteria 5202
226 Ga0501038_0028864 3300049574 Bacteria 4924
227 Ga0501039_0010095 3300049575 Bacteria 7193
228 Ga0501039_0019617 3300049575 Bacteria 5185
229 Ga0501039_0047580 3300049575 Bacteria 3315
230 Ga0501039_0241608 3300049575 Bacteria 1420
231 Ga0501042_0006531 3300049578 Bacteria 7577
232 Ga0501043_0005199 3300049579 Bacteria 10530
233 Ga0501043_0012423 3300049579 Bacteria 6660
234 Ga0501043_0024944 3300049579 Bacteria 4691
235 Ga0501043_0068911 3300049579 Bacteria 2778
236 Ga0501046_0001819 3300049580 Bacteria 20318
237 Ga0501046_0002795 3300049580 Bacteria 16250
238 Ga0501046_0024366 3300049580 Bacteria 4966
239 Ga0501047_0010290 3300049581 Bacteria 8846
240 Ga0501047_0015302 3300049581 Bacteria 7309
241 Ga0501047_0020417 3300049581 Bacteria 6361
242 Ga0501047_0046198 3300049581 Bacteria 4208
243 Ga0501047_0080078 3300049581 Bacteria 3140
244 Ga0501047_0086158 3300049581 Bacteria 3018
245 Ga0501047_0113662 3300049581 Bacteria 2590
246 Ga0501048_0005540 3300049582 Bacteria 9602
247 Ga0501067_0001326 3300049583 Bacteria 13400
248 Ga0501068_0007378 3300049584 Bacteria 6089
249 Ga0501068_0069511 3300049584 Bacteria 2147
250 Ga0501068_0268941 3300049584 Bacteria 1088
251 Ga0501069_0021677 3300049585 Bacteria 3490
252 Ga0501070_0004857 3300049586 Bacteria 11487
253 Ga0501070_0035518 3300049586 Bacteria 4165
254 Ga0501070_0270169 3300049586 Bacteria 1389
255 Ga0501070_0379911 3300049586 Bacteria 1144
256 Ga0501072_0002640 3300049588 Bacteria 13435
257 Ga0501072_0110317 3300049588 Bacteria 2190
258 Ga0501073_0001706 3300049589 Bacteria 16294
259 Ga0501073_0002396 3300049589 Bacteria 14029
260 Ga0501073_0003306 3300049589 Bacteria 12112
261 Ga0501073_0004066 3300049589 Bacteria 10985
262 Ga0501074_0002526 3300049590 Bacteria 12773
263 Ga0501074_0006743 3300049590 Bacteria 8284
264 Ga0501074_0391406 3300049590 Bacteria 986
265 Ga0501077_0016736 3300049593 Bacteria 4623
266 Ga0501079_0020058 3300049741 Bacteria 5107
267 Ga0501080_0003895 3300049742 Bacteria 13213
268 Ga0501080_0015799 3300049742 Bacteria 6964
269 Ga0501080_0017467 3300049742 Bacteria 6635
270 Ga0501080_0080979 3300049742 Bacteria 3017
271 Ga0501080_0127533 3300049742 Bacteria 2356
272 Ga0501035_0002549 3300049822 Bacteria 17819
273 Ga0501035_0017325 3300049822 Bacteria 6643
274 Ga0501035_0065871 3300049822 Bacteria 3215
275 Ga0501035_0181604 3300049822 Bacteria 1812
276 Ga0501035_0204146 3300049822 Bacteria 1694
277 Ga0501044_0005275 3300049823 Bacteria 14373
278 Ga0501044_0016096 3300049823 Bacteria 8039
279 Ga0501044_0034845 3300049823 Bacteria 5276
280 Ga0501044_0042732 3300049823 Bacteria 4712
281 Ga0501044_0188751 3300049823 Bacteria 2024
282 Ga0501045_0027776 3300049824 Bacteria 4080
283 nmdc:mga03n38_6528_c1 3300050490 Bacteria 4060
284 nmdc:mga09592_168030_c1 3300050508 Bacteria 1896
285 nmdc:mga06r32_1857_c1 3300050510 Bacteria 18803
286 nmdc:mga08y16_58_c1 3300050511 Bacteria 94206
287 Ga0495601_0069942 3300053077 Bacteria 2239
288 Ga0495655_0025579 3300053083 Bacteria 1382
289 Ga0500560_000647 3300053107 Bacteria 5136
290 Ga0500614_032459 3300053123 Bacteria 1285
291 Ga0500628_023946 3300053129 Bacteria 1264
292 Ga0500573_0040972 3300053140 Bacteria 2674
293 Ga0590075_011434 3300059424 Bacteria 2146
294 Ga0587067_020709 3300059640 Bacteria 1127
295 Ga0501082_0008562 3300060353 Bacteria 8823
296 2512732048 2512564039 Bacteria 8739048
297 2547405675 2547132111 Bacteria 8013147
298 2595320403 2593339198 Bacteria 7267884
299 2616697601 2616644814 Bacteria 11555299
300 2643887445 2643221575 Bacteria 4022601
301 2673819041 2671180694 Bacteria 7506943
302 2784585725 2784132148 Bacteria 8627943
303 2785344003 2784746763 Bacteria 9783172
304 2785346178 2784746763 Bacteria 9783172
305 2786674018 2786546132 Bacteria 10419719
306 2791913513 2791354901 Bacteria 8322202
307 2804847356 2802429296 Bacteria 7227771
308 2808918800 2808606375 Bacteria 9466072
309 2809229223 2808606448 Bacteria 8656184
310 2812481057 2811994917 Bacteria 7761064
311 2812482896 2811994917 Bacteria 7761064
312 2862281696 2862281513 Bacteria 9621493
313 2862294003 2862290372 Bacteria 7471434
314 2862511520 2862507626 Bacteria 9425308
315 2862515759 2862507626 Bacteria 9425308
316 2862708196 2862705112 Bacteria 6563286
317 2863410546 2863404153 Bacteria 9672205
318 2864737146 2864733723 Bacteria 6770668
319 2864998511 2864997549 Bacteria 5139696
320 2867430175 2867428634 Bacteria 9590268
321 2889045020 2889042446 Bacteria 7618936
322 2889298721 2889295896 Bacteria 4704906
323 2904491910 2904490793 Bacteria 7046938
324 2912764865 2912757875 Bacteria 7940295
325 2919161149 2919160200 Bacteria 6929020
326 2931388454 2931384279 Bacteria 7299545
327 2939682561 2939679117 Bacteria 6921672
328 2945992953 2945991243 Bacteria 7008369
329 2946055695 2946053406 Bacteria 6978655
330 2954681395 2954673503 Bacteria 9685905
331 2954682763 2954682443 Bacteria 9862841
332 2954719635 2954711539 Bacteria 10867210
333 2954729670 2954721474 Bacteria 10456478
334 2954732138 2954731030 Bacteria 10243860
335 2954748574 2954740390 Bacteria 10229294
336 2954751079 2954749733 Bacteria 10366972
337 2954767701 2954759201 Bacteria 9358192
338 2980126273 2980125574 Bacteria 5567337
339 2981288241 2981284811 Bacteria 4641497
340 2981293062 2981289755 Bacteria 4641509
341 2981983796 2981980479 Bacteria 4641628
342 2981988716 2981985349 Bacteria 4641497
343 2990045030 2990044586 Bacteria 6603797
344 2990065561 2990059506 Bacteria 9321252
345 3006429433 3006425503 Bacteria 6491253
346 8008488087 8008485437 Bacteria 7198341
347 8008559785 8008558824 Bacteria 10610750
348 8023626506 8023623736 Bacteria 8593882
349 8025416793 8025413630 Bacteria 7014048
350 8025527875 8025524527 Bacteria 7197316
351 8025538463 8025530807 Bacteria 8495698
352 8048411395 8048406513 Bacteria 8936924
353 8048413304 8048406513 Bacteria 8936924
354 8054281801 8054280661 Bacteria 4232245
355 8054795677 8054795415 Bacteria 9785225
356 Ga0075363_100014801
357 JGI24735J21928_10032268
358 JGI25406J46586_10000703
359 rootH2_10051798
360 rootH1_10031393
361 Ga0055541_1001239
362 Ga0065715_10114750
363 Ga0065707_10094032
364 Ga0070658_10358769
365 Ga0070683_100004739
366 Ga0070683_100669481
367 Ga0070680_100174281
368 Ga0070682_100353173
369 Ga0070668_100278524
370 Ga0070674_100146277
371 Ga0070714_100008946
372 Ga0070713_100025319
373 Ga0070678_100378619
374 Ga0070681_10541155
375 Ga0068867_100392151
376 Ga0070679_100427275
377 Ga0070684_100659426
378 Ga0068853_100036638
379 Ga0070665_100018383
380 Ga0070665_100023797
381 Ga0068855_100005701
382 Ga0068856_100048495
383 Ga0068852_100007612
384 Ga0068852_100969124
385 Ga0068870_10106456
386 Ga0068863_100009355
387 Ga0081539_10000286
388 Ga0070717_10000727
389 Ga0075428_100007485
390 Ga0075431_100018048
391 Ga0075429_100070992
392 Ga0105244_10060088
393 Ga0105240_10013170
394 Ga0111539_10000093
395 Ga0105243_10541305
396 Ga0105241_10002382
397 Ga0105248_10094891
398 Ga0105237_10113366
399 Ga0105238_10022662
400 Ga0105239_10034741
401 Ga0105239_10822873
402 Ga0157369_10061530
403 Ga0157374_10018252
404 Ga0157374_10331614
405 Ga0163162_10301278
406 Ga0157372_10479911
407 Ga0157372_10560764
408 Ga0206353_11717966
409 Ga0209566_100046
410 Ga0209437_100483
411 Ga0207654_10002767
412 Ga0207695_10003124
413 Ga0207671_10000170
414 Ga0207652_10339654
415 Ga0207694_10003270
416 Ga0207664_10007595
417 Ga0207670_10056902
418 Ga0207661_10052412
419 Ga0207667_10021927
420 Ga0207639_10005566
421 Ga0207702_10075674
422 Ga0207698_10007361
423 Ga0207428_10000147
424 Ga0268266_10041714
425 Ga0307517_10009904
426 Ga0307515_10210359
427 Ga0307512_10005602
428 Ga0307513_10005762
429 Ga0307513_10084610
430 Ga0307513_10152774
431 Ga0307514_10001390
432 Ga0307405_10222734
433 Ga0307413_10003628
434 Ga0307409_100198221
435 Ga0307415_100110943
436 Ga0395899_0292693
437 Ga0395900_0011199
438 Ga0395898_0211923
439 Ga0395898_0308059
440 Ga0395898_0617116
441 Ga0395901_0037302
442 Ga0451853_1301325
443 Ga0439442_002982
444 Ga0439448_0007801
445 Ga0439449_0000183
446 Ga0439450_027491
447 Ga0439457_000427
448 Ga0439457_002796
449 Ga0439457_007440
450 Ga0439462_0018330
451 Ga0450894_000879
452 Ga0450894_011721
453 Ga0450895_001067
454 Ga0450896_003786
455 Ga0450898_007744
456 Ga0450899_001242
457 Ga0450900_013898
458 Ga0450903_000760
459 Ga0450903_006326
460 Ga0450906_002992
461 Ga0450906_005896
462 Ga0439458_0002656
463 Ga0466969_0004480
464 Ga0466965_0018876
465 Ga0466966_0004131
466 Ga0466961_0005459
467 Ga0466961_0023247
468 Ga0466963_0100940
469 Ga0466971_0190820
470 Ga0466970_0001976
471 Ga0466970_0041068
472 Ga0466957_0232303
473 Ga0466960_0127322
474 Ga0466959_0004355
475 Ga0466959_0048721
476 Ga0466967_0014947
477 Ga0466967_0026600
478 Ga0466967_0032186
479 Ga0466967_0047267
480 Ga0466967_0083570
481 Ga0495617_091326
482 Ga0495592_0094596
483 Ga0495592_0096390
484 Ga0495603_0018653
485 Ga0495603_0207919
486 Ga0495638_0091145
487 Ga0495641_0064215
488 Ga0495641_0076528
489 Ga0495651_0000176
490 Ga0495651_0099742
491 Ga0495580_0057076
492 Ga0495582_0064038
493 Ga0495605_0040546
494 Ga0495594_0007586
495 Ga0495607_0011532
496 Ga0495606_0007008
497 Ga0495616_0026651
498 Ga0495620_0119119
499 Ga0495628_0008457
500 Ga0495631_0013426
501 Ga0495648_0023170
502 Ga0495652_0001006
503 Ga0495654_0039995
504 Ga0495640_0017241
505 Ga0495609_0047569
506 Ga0495645_0069422
507 Ga0495635_0024352
508 Ga0495661_0017810
509 Ga0495657_0122133
510 Ga0495658_0011719
511 Ga0495613_0084312
512 Ga0495624_0003563
513 Ga0495670_0059210
514 Ga0495600_0041688
515 Ga0495604_0057609
516 Ga0495604_0075623
517 Ga0495674_0387241
518 Ga0495672_0117572
519 Ga0495676_0007630
520 Ga0495676_0118799
521 Ga0495680_0040129
522 Ga0495675_0053517
523 Ga0495677_0024588
524 Ga0495685_037385
525 Ga0495686_0005810
526 Ga0495686_0016827
527 Ga0495686_0095109
528 Ga0495593_0084688
529 Ga0495626_0006240
530 Ga0496101_0029003
531 Ga0496101_0385226
532 Ga0496102_0157886
533 Ga0496102_0227477
534 Ga0496104_0098738
535 Ga0496105_0113514
536 Ga0496105_0161262
537 Ga0496105_0191145
538 Ga0496107_0058965
539 Ga0496108_0024491
540 Ga0496108_0487256
541 Ga0496109_0021616
542 Ga0496110_0024103
543 Ga0496110_0069022
544 Ga0496110_0114322
545 Ga0496111_0030478
546 Ga0496111_0148111
547 Ga0496111_0151548
548 Ga0496112_0508583
549 Ga0496114_0020294
550 Ga0496114_0276340
551 Ga0496116_0001250
552 Ga0496121_0141263
553 Ga0496122_0084344
554 Ga0496124_0027690
555 Ga0496124_0109655
556 Ga0496125_0006592
557 Ga0495678_099541
558 Ga0495682_0021324
559 Ga0501031_0004116
560 Ga0501032_0003847
561 Ga0501032_0007622
562 Ga0501032_0009566
563 Ga0501032_0248406
564 Ga0501033_0000784
565 Ga0501033_0005502
566 Ga0501033_0039628
567 Ga0501034_0002409
568 Ga0501034_0029852
569 Ga0501034_0033531
570 Ga0501034_0155605
571 Ga0501034_0158458
572 Ga0501036_0012153
573 Ga0501036_0014955
574 Ga0501036_0078839
575 Ga0501037_0000913
576 Ga0501037_0007103
577 Ga0501037_0246812
578 Ga0501038_0000102
579 Ga0501038_0007717
580 Ga0501038_0026125
581 Ga0501038_0028864
582 Ga0501039_0010095
583 Ga0501039_0019617
584 Ga0501039_0047580
585 Ga0501039_0241608
586 Ga0501042_0006531
587 Ga0501043_0005199
588 Ga0501043_0012423
589 Ga0501043_0024944
590 Ga0501043_0068911
591 Ga0501046_0001819
592 Ga0501046_0002795
593 Ga0501046_0024366
594 Ga0501047_0010290
595 Ga0501047_0015302
596 Ga0501047_0020417
597 Ga0501047_0046198
598 Ga0501047_0080078
599 Ga0501047_0086158
600 Ga0501047_0113662
601 Ga0501048_0005540
602 Ga0501067_0001326
603 Ga0501068_0007378
604 Ga0501068_0069511
605 Ga0501068_0268941
606 Ga0501069_0021677
607 Ga0501070_0004857
608 Ga0501070_0035518
609 Ga0501070_0270169
610 Ga0501070_0379911
611 Ga0501072_0002640
612 Ga0501072_0110317
613 Ga0501073_0001706
614 Ga0501073_0002396
615 Ga0501073_0003306
616 Ga0501073_0004066
617 Ga0501074_0002526
618 Ga0501074_0006743
619 Ga0501074_0391406
620 Ga0501077_0016736
621 Ga0501079_0020058
622 Ga0501080_0003895
623 Ga0501080_0015799
624 Ga0501080_0017467
625 Ga0501080_0080979
626 Ga0501080_0127533
627 Ga0501035_0002549
628 Ga0501035_0017325
629 Ga0501035_0065871
630 Ga0501035_0181604
631 Ga0501035_0204146
632 Ga0501044_0005275
633 Ga0501044_0016096
634 Ga0501044_0034845
635 Ga0501044_0042732
636 Ga0501044_0188751
637 Ga0501045_0027776
638 nmdc:mga03n38_6528_c1
639 nmdc:mga09592_168030_c1
640 nmdc:mga06r32_1857_c1
641 nmdc:mga08y16_58_c1
642 Ga0495601_0069942
643 Ga0495655_0025579
644 Ga0500560_000647
645 Ga0500614_032459
646 Ga0500628_023946
647 Ga0500573_0040972
648 Ga0590075_011434
649 Ga0587067_020709
650 Ga0501082_0008562
651 2512732048
652 2547405675
653 2595320403
654 2616697601
655 2643887445
656 2673819041
657 2784585725
658 2785344003
659 2785346178
660 2786674018
661 2791913513
662 2804847356
663 2808918800
664 2809229223
665 2812481057
666 2812482896
667 2862281696
668 2862294003
669 2862511520
670 2862515759
671 2862708196
672 2863410546
673 2864737146
674 2864998511
675 2867430175
676 2889045020
677 2889298721
678 2904491910
679 2912764865
680 2919161149
681 2931388454
682 2939682561
683 2945992953
684 2946055695
685 2954681395
686 2954682763
687 2954719635
688 2954729670
689 2954732138
690 2954748574
691 2954751079
692 2954767701
693 2980126273
694 2981288241
695 2981293062
696 2981983796
697 2981988716
698 2990045030
699 2990065561
700 3006429433
701 8008488087
702 8008559785
703 8023626506
704 8025416793
705 8025527875
706 8025538463
707 8048411395
708 8048413304
709 8054281801
710 8054795677

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

123

302

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
2r6g-assembly1.cif.gz_G the crystal structure of the e. coli maltose transporter 0.8563 36 289
4tqu-assembly1.cif.gz_N crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate 0.8556 36 287
4jbw-assembly2.cif.gz_I crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.8397 36 288
3rlf-assembly1.cif.gz_G crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to mgamppnp 0.8394 36 300
8hpn-assembly1.cif.gz_B lpqy-sugabc in state 3 0.8217 36 291
ID Description Score Start End Superfamily
af_I6Y1U3_2_266_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9385 36 290 1.10.3720.10
af_O53483_6_271_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9354 36 290 1.10.3720.10
af_P10906_2_274_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9266 36 290 1.10.3720.10
af_I6Y1U3_2_266_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9013 36 290 1.10.3720.10
af_P77716_1_267_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8992 37 287 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A4V2EL48-F1-model_v4 Carbohydrate ABC transporter permease 0.9603 50 299 GO:0005886
GO:0055085
AF-A0A0B0HCC5-F1-model_v4 deleted 0.9599 36 276
AF-A0A1C4QQ99-F1-model_v4 Cellobiose transport system permease protein 0.9598 58 300 GO:0005886
GO:0055085
AF-A0A7V2RWS1-F1-model_v4 Carbohydrate ABC transporter permease 0.9588 36 285 GO:0005886
GO:0055085
AF-A0A841CQE1-F1-model_v4 Cellobiose transport system permease protein 0.9547 31 292 GO:0005886
GO:0055085

Map