F419933

General Info

Members Datasets Scaffolds Average Seq Length
354 253 708 215

Family's Representative Sequence

Representative Sequence 3300050515|nmdc:mga0a205_440749_c1|nmdc:mga0a205_440749_c1_25_732
Length 230
Sequence VSDTEHPGRRDVSRRAAPDASATASVVFVVDDDASVRDSLGRLISSVGFKVETFANARAFLGARRPDAPGCLVLDVRLPGLSGLDLQRELAETDAALPIVFLTGHGDIPMSVQAMKAGAVEFLTKPFRQQDLLDAIRSAIERDRTMRADELRRRYASLTPRERDVLAWIVAGLLNKQIAAELGTSEATVKEQRGHVMAKMQAGSVAELVRFASRLGVTPAGRASSPPKAG

Samples

Sample ID Description Type Environment
1 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
57 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
58 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
59 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
64 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
75 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
142 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
143 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
144 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
145 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
146 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
147 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
148 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
149 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
150 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
151 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
152 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
153 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
154 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
155 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
156 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
157 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
158 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
159 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
160 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
161 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
162 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
163 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
164 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
165 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
166 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
167 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
168 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
169 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
170 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
171 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
172 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
173 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
174 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
175 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
176 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
177 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
178 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
179 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
180 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
181 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
182 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
183 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
184 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
185 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
186 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
187 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
188 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
189 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
190 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
191 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
192 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
193 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
194 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
195 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
196 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
197 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
198 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
199 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
200 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
201 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
202 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
203 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
204 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
205 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
206 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
207 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
208 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
209 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
210 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
211 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
212 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
213 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
214 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
215 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
216 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
217 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
218 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
219 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
220 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
221 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
222 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
223 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
224 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
225 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
226 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
227 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
228 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
229 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
230 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
231 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
232 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
233 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
234 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
235 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
236 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
237 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
238 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
239 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
240 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
241 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
242 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
243 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
244 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
245 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
246 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
247 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
248 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
249 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
250 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
251 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
252 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
253 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.46
Metatranscriptomes 0.56
Isolates 1.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.21
Nodule 0.28
Rhizoplane 8.47
Rhizosphere 80.23
Stem 0
Stem Tuber 0
Unclassified 1.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0a205_440749_c1 3300050515 Bacteria 1163
2 MRS1b_contig_9343368 2162886011 Bacteria 1577
3 JGI24740J21852_10013414 3300001979 Bacteria 3057
4 rootL2_10001940 3300003322 Bacteria 18701
5 Ga0065704_10136084 3300005289 Bacteria 1569
6 Ga0065712_10077611 3300005290 Bacteria 3463
7 Ga0070670_100058687 3300005331 Bacteria 3303
8 Ga0068869_100009007 3300005334 Bacteria 6466
9 Ga0068869_100376316 3300005334 Bacteria 1163
10 Ga0070666_10205456 3300005335 Bacteria 1386
11 Ga0070666_10244566 3300005335 Bacteria 1269
12 Ga0070680_100001242 3300005336 Bacteria 18375
13 Ga0070680_100480606 3300005336 Bacteria 1062
14 Ga0070682_100020338 3300005337 Bacteria 3905
15 Ga0070660_100198175 3300005339 Bacteria 1628
16 Ga0070691_10007234 3300005341 Bacteria 5081
17 Ga0070691_10022863 3300005341 Bacteria 2902
18 Ga0070668_100003661 3300005347 Bacteria 11341
19 Ga0070668_100686664 3300005347 Bacteria 902
20 Ga0070669_100024144 3300005353 Bacteria 4357
21 Ga0070669_100040243 3300005353 Bacteria 3398
22 Ga0070671_100047326 3300005355 Bacteria 3577
23 Ga0070674_100459140 3300005356 Bacteria 1053
24 Ga0070673_100240505 3300005364 Bacteria 1574
25 Ga0070659_100037763 3300005366 Bacteria 3766
26 Ga0070667_100005134 3300005367 Bacteria 10961
27 Ga0070667_100827674 3300005367 Bacteria 860
28 Ga0070703_10002169 3300005406 Bacteria 5709
29 Ga0070705_100000519 3300005440 Bacteria 22285
30 Ga0070705_100025237 3300005440 Bacteria 3220
31 Ga0070700_100000510 3300005441 Bacteria 19345
32 Ga0070700_100127169 3300005441 Bacteria 1715
33 Ga0070694_100046968 3300005444 Bacteria 2900
34 Ga0070708_100024299 3300005445 Bacteria 5167
35 Ga0070708_100026161 3300005445 Bacteria 4992
36 Ga0070663_100033745 3300005455 Bacteria 3538
37 Ga0070663_100046617 3300005455 Bacteria 3068
38 Ga0070662_100169218 3300005457 Bacteria 1715
39 Ga0070681_10567644 3300005458 Bacteria 1048
40 Ga0068867_100622904 3300005459 Bacteria 944
41 Ga0070706_100057930 3300005467 Bacteria 3575
42 Ga0070706_100341625 3300005467 Bacteria 1396
43 Ga0070698_100010554 3300005471 Bacteria 9845
44 Ga0070698_100046799 3300005471 Bacteria 4423
45 Ga0070699_100000444 3300005518 Bacteria 39757
46 Ga0070699_100110672 3300005518 Bacteria 2411
47 Ga0070699_100184505 3300005518 Bacteria 1852
48 Ga0070679_100014128 3300005530 Bacteria 7658
49 Ga0070679_100369598 3300005530 Bacteria 1381
50 Ga0070684_100478573 3300005535 Bacteria 1152
51 Ga0070697_100074893 3300005536 Bacteria 2782
52 Ga0068853_100015623 3300005539 Bacteria 6236
53 Ga0070695_100000988 3300005545 Bacteria 15456
54 Ga0070696_100000123 3300005546 Bacteria 40797
55 Ga0070696_100004509 3300005546 Bacteria 9296
56 Ga0070693_100003700 3300005547 Bacteria 7150
57 Ga0070693_100078848 3300005547 Bacteria 1958
58 Ga0070665_100008091 3300005548 Bacteria 10643
59 Ga0070665_100028444 3300005548 Bacteria 5628
60 Ga0070704_100005152 3300005549 Bacteria 7598
61 Ga0070664_100259116 3300005564 Bacteria 1565
62 Ga0070664_100327998 3300005564 Bacteria 1388
63 Ga0068857_100042287 3300005577 Bacteria 4042
64 Ga0068854_100215307 3300005578 Bacteria 1517
65 Ga0068854_100325440 3300005578 Bacteria 1251
66 Ga0070702_100015364 3300005615 Bacteria 3908
67 Ga0068852_100208142 3300005616 Bacteria 1854
68 Ga0068859_100002383 3300005617 Bacteria 19138
69 Ga0068859_100216770 3300005617 Bacteria 2001
70 Ga0068864_100093581 3300005618 Bacteria 2655
71 Ga0068861_100005283 3300005719 Bacteria 8714
72 Ga0068870_10165590 3300005840 Bacteria 1315
73 Ga0068863_100036926 3300005841 Bacteria 4652
74 Ga0068858_100375575 3300005842 Bacteria 1364
75 Ga0068860_100011427 3300005843 Bacteria 8746
76 Ga0068860_100056891 3300005843 Bacteria 3717
77 Ga0068862_100003284 3300005844 Bacteria 13994
78 Ga0068862_100523160 3300005844 Bacteria 1129
79 Ga0081455_10130655 3300005937 Bacteria 1964
80 Ga0081538_10033043 3300005981 Bacteria 3452
81 Ga0081538_10039878 3300005981 Bacteria 3004
82 Ga0081540_1007979 3300005983 Bacteria 7456
83 Ga0075368_10003457 3300006042 Bacteria 5275
84 Ga0075368_10015211 3300006042 Bacteria 2851
85 Ga0075363_100017127 3300006048 Bacteria 3588
86 Ga0075364_10075501 3300006051 Bacteria 2224
87 Ga0075362_10002685 3300006177 Bacteria 6049
88 Ga0075362_10012622 3300006177 Bacteria 3361
89 Ga0075362_10023460 3300006177 Bacteria 2610
90 Ga0075367_10044964 3300006178 Bacteria 2590
91 Ga0075369_10154923 3300006186 Bacteria 1049
92 Ga0075370_10006089 3300006353 Bacteria 6047
93 Ga0075428_100602132 3300006844 Bacteria 1174
94 Ga0075430_100000103 3300006846 Bacteria 51038
95 Ga0075431_100000717 3300006847 Bacteria 28547
96 Ga0075431_100014803 3300006847 Bacteria 7897
97 Ga0075431_100083446 3300006847 Bacteria 3299
98 Ga0075431_100710864 3300006847 Bacteria 982
99 Ga0075433_10038795 3300006852 Bacteria 4115
100 Ga0075433_10651250 3300006852 Bacteria 923
101 Ga0075434_100032346 3300006871 Bacteria 5158
102 Ga0075429_100000019 3300006880 Bacteria 70971
103 Ga0075429_100475718 3300006880 Bacteria 1095
104 Ga0075429_100614820 3300006880 Bacteria 952
105 Ga0075436_100284367 3300006914 Bacteria 1183
106 Ga0097620_100002383 3300006931 Bacteria 19138
107 Ga0097620_100216756 3300006931 Bacteria 2001
108 Ga0075435_100026327 3300007076 Bacteria 4536
109 Ga0099794_10017852 3300007265 Bacteria 3170
110 Ga0105244_10000073 3300009036 Bacteria 115279
111 Ga0105240_10128126 3300009093 Unclassified 3047
112 Ga0105245_10247507 3300009098 Bacteria 1731
113 Ga0105245_10471136 3300009098 Bacteria 1268
114 Ga0114129_10003921 3300009147 Bacteria 20999
115 Ga0114129_10005794 3300009147 Bacteria 17494
116 Ga0114129_10014011 3300009147 Bacteria 11421
117 Ga0114129_10142520 3300009147 Bacteria 3284
118 Ga0105243_10002841 3300009148 Bacteria 14376
119 Ga0105243_10041365 3300009148 Bacteria 3604
120 Ga0105243_10329188 3300009148 Bacteria 1395
121 Ga0105243_10389411 3300009148 Bacteria 1291
122 Ga0105242_10269012 3300009176 Bacteria 1543
123 Ga0105248_10619700 3300009177 Bacteria 1221
124 Ga0105237_10008020 3300009545 Bacteria 11493
125 Ga0105238_10363394 3300009551 Unclassified 1437
126 Ga0105238_11272145 3300009551 Bacteria 761
127 Ga0105249_10001925 3300009553 Bacteria 18020
128 Ga0105249_10117338 3300009553 Bacteria 2524
129 Ga0099796_10064924 3300010159 Bacteria 1304
130 Ga0105239_10191679 3300010375 Bacteria 2288
131 Ga0105239_10312280 3300010375 Bacteria 1772
132 Ga0105239_10560984 3300010375 Bacteria 1301
133 Ga0105246_10003816 3300011119 Bacteria 9134
134 Ga0105246_10009061 3300011119 Bacteria 6128
135 Ga0105246_10026806 3300011119 Bacteria 3771
136 Ga0157369_10000167 3300013105 Bacteria 93483
137 Ga0157369_10509571 3300013105 Bacteria 1245
138 Ga0157378_10063904 3300013297 Bacteria 3290
139 Ga0163162_10161111 3300013306 Bacteria 2365
140 Ga0163162_11197345 3300013306 Bacteria 862
141 Ga0157372_10893197 3300013307 Bacteria 1031
142 Ga0157375_10180411 3300013308 Bacteria 2262
143 Ga0163163_10245268 3300014325 Bacteria 1841
144 Ga0163163_10501663 3300014325 Bacteria 1275
145 Ga0157377_10009783 3300014745 Bacteria 4722
146 Ga0157376_10014087 3300014969 Bacteria 5989
147 Ga0183362_10002 3300015683 Bacteria 1432711
148 Ga0163161_10085282 3300017792 Bacteria 2330
149 Ga0206354_10598322 3300020081 Bacteria 1663
150 Ga0224712_10120716 3300022467 Bacteria 1135
151 Ga0207655_1001534 3300025728 Bacteria 20925
152 Ga0207653_10000831 3300025885 Bacteria 10307
153 Ga0207682_10053607 3300025893 Bacteria 1673
154 Ga0207680_10554571 3300025903 Bacteria 820
155 Ga0207647_10007334 3300025904 Bacteria 7974
156 Ga0207684_10004648 3300025910 Bacteria 12889
157 Ga0207684_10187735 3300025910 Bacteria 1782
158 Ga0207684_10577506 3300025910 Bacteria 961
159 Ga0207707_10061154 3300025912 Bacteria 3277
160 Ga0207695_10063042 3300025913 Unclassified 3823
161 Ga0207671_10195892 3300025914 Bacteria 1577
162 Ga0207660_10009339 3300025917 Bacteria 6347
163 Ga0207657_10013452 3300025919 Bacteria 8027
164 Ga0207652_10062545 3300025921 Bacteria 3216
165 Ga0207646_10001806 3300025922 Bacteria 25880
166 Ga0207681_10118901 3300025923 Bacteria 1935
167 Ga0207694_10300148 3300025924 Bacteria 1322
168 Ga0207694_10329913 3300025924 Unclassified 1260
169 Ga0207659_10037652 3300025926 Bacteria 3360
170 Ga0207644_10032941 3300025931 Bacteria 3619
171 Ga0207686_10409705 3300025934 Bacteria 1034
172 Ga0207670_10426639 3300025936 Bacteria 1065
173 Ga0207669_10461974 3300025937 Bacteria 1008
174 Ga0207711_10127377 3300025941 Bacteria 2279
175 Ga0207689_10337399 3300025942 Bacteria 1252
176 Ga0207679_10317699 3300025945 Bacteria 1347
177 Ga0207712_10002410 3300025961 Bacteria 12093
178 Ga0207712_10089291 3300025961 Bacteria 2265
179 Ga0207668_10001706 3300025972 Bacteria 12856
180 Ga0207668_10148954 3300025972 Bacteria 1809
181 Ga0207640_10286550 3300025981 Bacteria 1296
182 Ga0207658_10003569 3300025986 Bacteria 10981
183 Ga0207639_10036106 3300026041 Bacteria 3660
184 Ga0207678_10000262 3300026067 Bacteria 47571
185 Ga0207678_10035485 3300026067 Bacteria 4342
186 Ga0207708_10000488 3300026075 Bacteria 30463
187 Ga0207641_10110724 3300026088 Bacteria 2434
188 Ga0207648_10227009 3300026089 Bacteria 1660
189 Ga0207648_10286551 3300026089 Bacteria 1474
190 Ga0207676_10068034 3300026095 Bacteria 2847
191 Ga0207676_10090144 3300026095 Bacteria 2515
192 Ga0207674_10003015 3300026116 Bacteria 20879
193 Ga0207674_10482044 3300026116 Bacteria 1199
194 Ga0207683_10267560 3300026121 Bacteria 1561
195 Ga0207698_10652535 3300026142 Bacteria 1042
196 Ga0209588_1010116 3300027671 Bacteria 2831
197 Ga0209813_10004129 3300027866 Bacteria 3449
198 Ga0209813_10031007 3300027866 Bacteria 1575
199 Ga0268266_10006521 3300028379 Bacteria 10678
200 Ga0268265_10002300 3300028380 Bacteria 14544
201 Ga0268264_10004584 3300028381 Bacteria 11746
202 Ga0268264_10039627 3300028381 Bacteria 3892
203 Ga0265334_10030982 3300028573 Bacteria 2139
204 Ga0307515_10104671 3300028794 Bacteria 3378
205 Ga0265338_10024131 3300028800 Bacteria 6224
206 Ga0307513_10127660 3300031456 Bacteria 2495
207 Ga0307408_100248737 3300031548 Bacteria 1465
208 Ga0307406_10275815 3300031901 Bacteria 1280
209 Ga0307406_10486979 3300031901 Bacteria 997
210 Ga0307412_10079141 3300031911 Bacteria 2267
211 Ga0307412_10276904 3300031911 Bacteria 1315
212 Ga0307416_100059178 3300032002 Bacteria 3111
213 Ga0395900_0130395 3300037418 Bacteria 2577
214 Ga0395898_0000264 3300037466 Bacteria 128758
215 Ga0395901_0005883 3300038443 Bacteria 12410
216 Ga0439436_0002162 3300041404 Bacteria 5880
217 Ga0439439_0005193 3300041406 Bacteria 2965
218 Ga0439447_002958 3300041407 Bacteria 6088
219 Ga0439461_0005818 3300041410 Bacteria 2122
220 Ga0439466_0010599 3300041411 Bacteria 3426
221 Ga0439465_0000869 3300041413 Bacteria 9529
222 Ga0451797_1139930 3300041453 Bacteria 880
223 Ga0451798_1091213 3300041458 Bacteria 698
224 Ga0451807_0103388 3300041486 Bacteria 6989
225 Ga0451837_0061015 3300041494 Bacteria 9941
226 Ga0439431_0000132 3300041997 Bacteria 13291
227 Ga0439433_0000526 3300041999 Bacteria 7214
228 Ga0439445_0002026 3300042004 Bacteria 4470
229 Ga0439432_009416 3300042006 Bacteria 3407
230 Ga0439449_0000894 3300042007 Bacteria 11639
231 Ga0439449_0001211 3300042007 Bacteria 10127
232 Ga0439449_0081707 3300042007 Bacteria 1191
233 Ga0439452_003739 3300042010 Bacteria 5242
234 Ga0439452_020811 3300042010 Bacteria 1716
235 Ga0439457_002147 3300042014 Bacteria 5723
236 Ga0439462_0054845 3300042015 Bacteria 1074
237 Ga0450894_002374 3300042131 Bacteria 2538
238 Ga0450896_010583 3300042133 Bacteria 1295
239 Ga0450898_000826 3300042134 Bacteria 3844
240 Ga0450906_010139 3300042145 Bacteria 1787
241 Ga0439446_0114244 3300042156 Bacteria 864
242 Ga0450908_009910 3300042184 Bacteria 1763
243 Ga0439434_0010202 3300042435 Bacteria 2768
244 Ga0439434_0012288 3300042435 Bacteria 2534
245 Ga0451577_0053615 3300042876 Bacteria 3599
246 Ga0466965_0011520 3300044683 Bacteria 4148
247 Ga0466966_0004473 3300044684 Bacteria 9219
248 Ga0466963_0008760 3300044694 Bacteria 6076
249 Ga0453684_0159603 3300044712 Bacteria 2668
250 Ga0466971_0007910 3300044719 Bacteria 4630
251 Ga0466957_0284545 3300044842 Bacteria 1107
252 Ga0466960_0175308 3300044901 Bacteria 1159
253 Ga0451576_0167055 3300045051 Bacteria 2296
254 Ga0495638_0010969 3300046460 Bacteria 6266
255 Ga0495638_0024070 3300046460 Bacteria 3975
256 Ga0495651_0058339 3300046462 Bacteria 2962
257 Ga0495650_0001371 3300046471 Bacteria 24045
258 Ga0495650_0040468 3300046471 Bacteria 2000
259 Ga0495585_0000360 3300046492 Bacteria 44156
260 Ga0495607_0000083 3300046501 Bacteria 96690
261 Ga0495606_0000136 3300046507 Bacteria 125611
262 Ga0495606_0052432 3300046507 Bacteria 2652
263 Ga0495610_0068146 3300046512 Bacteria 1668
264 Ga0495616_0000003 3300046513 Bacteria 290178
265 Ga0495631_0000267 3300046518 Bacteria 36464
266 Ga0495632_0002853 3300046519 Bacteria 12755
267 Ga0495632_0006266 3300046519 Bacteria 7688
268 Ga0495648_0004160 3300046524 Bacteria 12442
269 Ga0495668_0076939 3300046616 Bacteria 1832
270 Ga0495611_0000113 3300046648 Bacteria 56814
271 Ga0495625_0024550 3300046660 Bacteria 4586
272 Ga0495635_0392240 3300046663 Bacteria 923
273 Ga0495659_0139512 3300046664 Bacteria 967
274 Ga0495670_0002072 3300046691 Bacteria 9885
275 Ga0495660_0000390 3300046810 Bacteria 37896
276 Ga0495683_0003265 3300047323 Bacteria 9476
277 Ga0495673_0000101 3300047469 Bacteria 173409
278 Ga0495686_0000180 3300047472 Bacteria 121204
279 Ga0495686_0012461 3300047472 Bacteria 5946
280 Ga0495686_0065113 3300047472 Bacteria 2254
281 Ga0495686_0108282 3300047472 Bacteria 1669
282 Ga0496100_0055226 3300048903 Bacteria 2594
283 Ga0496100_0295447 3300048903 Bacteria 1211
284 Ga0496101_0051564 3300048904 Bacteria 2965
285 Ga0496102_0001822 3300048905 Bacteria 18397
286 Ga0496102_0113761 3300048905 Bacteria 2525
287 Ga0496102_0115503 3300048905 Bacteria 2504
288 Ga0496102_0534223 3300048905 Bacteria 1095
289 Ga0496103_0043675 3300048906 Bacteria 2760
290 Ga0496104_0002007 3300048907 Bacteria 17665
291 Ga0496104_0239433 3300048907 Bacteria 1727
292 Ga0496104_0364274 3300048907 Bacteria 1358
293 Ga0496105_0080635 3300048908 Bacteria 2688
294 Ga0496105_0110522 3300048908 Bacteria 2269
295 Ga0496106_0000402 3300048909 Bacteria 30717
296 Ga0496106_0002603 3300048909 Bacteria 13430
297 Ga0496107_0004577 3300048910 Bacteria 9375
298 Ga0496108_0030951 3300048911 Bacteria 4436
299 Ga0496108_0388489 3300048911 Bacteria 1219
300 Ga0496109_0055016 3300048912 Bacteria 3630
301 Ga0496109_0147074 3300048912 Bacteria 2205
302 Ga0496110_0066891 3300048913 Bacteria 3178
303 Ga0496112_0030122 3300048915 Bacteria 5252
304 Ga0496113_0178079 3300048916 Bacteria 1685
305 Ga0496113_0198211 3300048916 Bacteria 1595
306 Ga0496115_0004809 3300048918 Bacteria 9800
307 Ga0496115_0032424 3300048918 Bacteria 4121
308 Ga0496121_0001227 3300048924 Bacteria 44616
309 Ga0496121_0079734 3300048924 Bacteria 2598
310 Ga0496122_0038025 3300048925 Bacteria 3863
311 Ga0496122_0092467 3300048925 Bacteria 2056
312 Ga0496123_0069822 3300048926 Bacteria 2203
313 Ga0496124_0104901 3300048927 Bacteria 2285
314 Ga0496124_0161458 3300048927 Bacteria 1746
315 Ga0496125_0019024 3300048928 Bacteria 6498
316 Ga0495678_140225 3300049459 Bacteria 792
317 Ga0501291_047407 3300049514 Unclassified 773
318 Ga0501292_035727 3300049515 Unclassified 846
319 Ga0501296_009266 3300049519 Unclassified 1152
320 nmdc:mga03683_64464_c1 3300050489 Bacteria 1555
321 nmdc:mga00v17_41219_c1 3300050491 Bacteria 2772
322 nmdc:mga0yw44_73092_c1 3300050492 Bacteria 2133
323 nmdc:mga06z11_37450_c1 3300050494 Bacteria 2402
324 nmdc:mga04h51_11699_c1 3300050495 Bacteria 2444
325 nmdc:mga07m45_1446_c1 3300050496 Bacteria 10887
326 nmdc:mga05p37_1010_c1 3300050507 Bacteria 32048
327 nmdc:mga05p37_18031_c1 3300050507 Bacteria 8526
328 nmdc:mga05p37_209381_c1 3300050507 Bacteria 2358
329 nmdc:mga05p37_79600_c1 3300050507 Bacteria 4035
330 nmdc:mga09592_276141_c1 3300050508 Bacteria 1457
331 nmdc:mga09592_45_c1 3300050508 Bacteria 69144
332 nmdc:mga09592_50816_c1 3300050508 Bacteria 3496
333 nmdc:mga0qj67_13718_c1 3300050509 Bacteria 6115
334 nmdc:mga0qj67_244280_c1 3300050509 Bacteria 1456
335 nmdc:mga0qj67_518987_c1 3300050509 Bacteria 957
336 nmdc:mga06r32_207006_c1 3300050510 Bacteria 1950
337 nmdc:mga06r32_211807_c1 3300050510 Bacteria 1926
338 nmdc:mga06r32_406993_c1 3300050510 Bacteria 1342
339 nmdc:mga06r32_4234_c1 3300050510 Bacteria 11791
340 nmdc:mga0n895_299953_c1 3300050512 Bacteria 1629
341 nmdc:mga08x19_359850_c1 3300050514 Bacteria 1017
342 nmdc:mga0a205_14063_c1 3300050515 Bacteria 7466
343 Ga0500641_0069470 3300053096 Bacteria 1480
344 Ga0500555_077193 3300053103 Bacteria 871
345 Ga0500616_0289576 3300053153 Bacteria 684
346 Ga0500633_0000444 3300053160 Bacteria 6529
347 Ga0466962_0004301 3300061719 Bacteria 6826
348 2599327870 2599185155 Bacteria 5827168
349 2826581674 2826581358 Bacteria 5963467
350 2842817140 2842815866 Bacteria 5947510
351 2842851972 2842849001 Bacteria 5924277
352 2846955544 2846952575 Bacteria 6587527
353 2848862993 2848858292 Bacteria 7391279
354 8024491120 8024486573 Bacteria 6540512
355 nmdc:mga0a205_440749_c1
356 MRS1b_contig_9343368
357 JGI24740J21852_10013414
358 rootL2_10001940
359 Ga0065704_10136084
360 Ga0065712_10077611
361 Ga0070670_100058687
362 Ga0068869_100009007
363 Ga0068869_100376316
364 Ga0070666_10205456
365 Ga0070666_10244566
366 Ga0070680_100001242
367 Ga0070680_100480606
368 Ga0070682_100020338
369 Ga0070660_100198175
370 Ga0070691_10007234
371 Ga0070691_10022863
372 Ga0070668_100003661
373 Ga0070668_100686664
374 Ga0070669_100024144
375 Ga0070669_100040243
376 Ga0070671_100047326
377 Ga0070674_100459140
378 Ga0070673_100240505
379 Ga0070659_100037763
380 Ga0070667_100005134
381 Ga0070667_100827674
382 Ga0070703_10002169
383 Ga0070705_100000519
384 Ga0070705_100025237
385 Ga0070700_100000510
386 Ga0070700_100127169
387 Ga0070694_100046968
388 Ga0070708_100024299
389 Ga0070708_100026161
390 Ga0070663_100033745
391 Ga0070663_100046617
392 Ga0070662_100169218
393 Ga0070681_10567644
394 Ga0068867_100622904
395 Ga0070706_100057930
396 Ga0070706_100341625
397 Ga0070698_100010554
398 Ga0070698_100046799
399 Ga0070699_100000444
400 Ga0070699_100110672
401 Ga0070699_100184505
402 Ga0070679_100014128
403 Ga0070679_100369598
404 Ga0070684_100478573
405 Ga0070697_100074893
406 Ga0068853_100015623
407 Ga0070695_100000988
408 Ga0070696_100000123
409 Ga0070696_100004509
410 Ga0070693_100003700
411 Ga0070693_100078848
412 Ga0070665_100008091
413 Ga0070665_100028444
414 Ga0070704_100005152
415 Ga0070664_100259116
416 Ga0070664_100327998
417 Ga0068857_100042287
418 Ga0068854_100215307
419 Ga0068854_100325440
420 Ga0070702_100015364
421 Ga0068852_100208142
422 Ga0068859_100002383
423 Ga0068859_100216770
424 Ga0068864_100093581
425 Ga0068861_100005283
426 Ga0068870_10165590
427 Ga0068863_100036926
428 Ga0068858_100375575
429 Ga0068860_100011427
430 Ga0068860_100056891
431 Ga0068862_100003284
432 Ga0068862_100523160
433 Ga0081455_10130655
434 Ga0081538_10033043
435 Ga0081538_10039878
436 Ga0081540_1007979
437 Ga0075368_10003457
438 Ga0075368_10015211
439 Ga0075363_100017127
440 Ga0075364_10075501
441 Ga0075362_10002685
442 Ga0075362_10012622
443 Ga0075362_10023460
444 Ga0075367_10044964
445 Ga0075369_10154923
446 Ga0075370_10006089
447 Ga0075428_100602132
448 Ga0075430_100000103
449 Ga0075431_100000717
450 Ga0075431_100014803
451 Ga0075431_100083446
452 Ga0075431_100710864
453 Ga0075433_10038795
454 Ga0075433_10651250
455 Ga0075434_100032346
456 Ga0075429_100000019
457 Ga0075429_100475718
458 Ga0075429_100614820
459 Ga0075436_100284367
460 Ga0097620_100002383
461 Ga0097620_100216756
462 Ga0075435_100026327
463 Ga0099794_10017852
464 Ga0105244_10000073
465 Ga0105240_10128126
466 Ga0105245_10247507
467 Ga0105245_10471136
468 Ga0114129_10003921
469 Ga0114129_10005794
470 Ga0114129_10014011
471 Ga0114129_10142520
472 Ga0105243_10002841
473 Ga0105243_10041365
474 Ga0105243_10329188
475 Ga0105243_10389411
476 Ga0105242_10269012
477 Ga0105248_10619700
478 Ga0105237_10008020
479 Ga0105238_10363394
480 Ga0105238_11272145
481 Ga0105249_10001925
482 Ga0105249_10117338
483 Ga0099796_10064924
484 Ga0105239_10191679
485 Ga0105239_10312280
486 Ga0105239_10560984
487 Ga0105246_10003816
488 Ga0105246_10009061
489 Ga0105246_10026806
490 Ga0157369_10000167
491 Ga0157369_10509571
492 Ga0157378_10063904
493 Ga0163162_10161111
494 Ga0163162_11197345
495 Ga0157372_10893197
496 Ga0157375_10180411
497 Ga0163163_10245268
498 Ga0163163_10501663
499 Ga0157377_10009783
500 Ga0157376_10014087
501 Ga0183362_10002
502 Ga0163161_10085282
503 Ga0206354_10598322
504 Ga0224712_10120716
505 Ga0207655_1001534
506 Ga0207653_10000831
507 Ga0207682_10053607
508 Ga0207680_10554571
509 Ga0207647_10007334
510 Ga0207684_10004648
511 Ga0207684_10187735
512 Ga0207684_10577506
513 Ga0207707_10061154
514 Ga0207695_10063042
515 Ga0207671_10195892
516 Ga0207660_10009339
517 Ga0207657_10013452
518 Ga0207652_10062545
519 Ga0207646_10001806
520 Ga0207681_10118901
521 Ga0207694_10300148
522 Ga0207694_10329913
523 Ga0207659_10037652
524 Ga0207644_10032941
525 Ga0207686_10409705
526 Ga0207670_10426639
527 Ga0207669_10461974
528 Ga0207711_10127377
529 Ga0207689_10337399
530 Ga0207679_10317699
531 Ga0207712_10002410
532 Ga0207712_10089291
533 Ga0207668_10001706
534 Ga0207668_10148954
535 Ga0207640_10286550
536 Ga0207658_10003569
537 Ga0207639_10036106
538 Ga0207678_10000262
539 Ga0207678_10035485
540 Ga0207708_10000488
541 Ga0207641_10110724
542 Ga0207648_10227009
543 Ga0207648_10286551
544 Ga0207676_10068034
545 Ga0207676_10090144
546 Ga0207674_10003015
547 Ga0207674_10482044
548 Ga0207683_10267560
549 Ga0207698_10652535
550 Ga0209588_1010116
551 Ga0209813_10004129
552 Ga0209813_10031007
553 Ga0268266_10006521
554 Ga0268265_10002300
555 Ga0268264_10004584
556 Ga0268264_10039627
557 Ga0265334_10030982
558 Ga0307515_10104671
559 Ga0265338_10024131
560 Ga0307513_10127660
561 Ga0307408_100248737
562 Ga0307406_10275815
563 Ga0307406_10486979
564 Ga0307412_10079141
565 Ga0307412_10276904
566 Ga0307416_100059178
567 Ga0395900_0130395
568 Ga0395898_0000264
569 Ga0395901_0005883
570 Ga0439436_0002162
571 Ga0439439_0005193
572 Ga0439447_002958
573 Ga0439461_0005818
574 Ga0439466_0010599
575 Ga0439465_0000869
576 Ga0451797_1139930
577 Ga0451798_1091213
578 Ga0451807_0103388
579 Ga0451837_0061015
580 Ga0439431_0000132
581 Ga0439433_0000526
582 Ga0439445_0002026
583 Ga0439432_009416
584 Ga0439449_0000894
585 Ga0439449_0001211
586 Ga0439449_0081707
587 Ga0439452_003739
588 Ga0439452_020811
589 Ga0439457_002147
590 Ga0439462_0054845
591 Ga0450894_002374
592 Ga0450896_010583
593 Ga0450898_000826
594 Ga0450906_010139
595 Ga0439446_0114244
596 Ga0450908_009910
597 Ga0439434_0010202
598 Ga0439434_0012288
599 Ga0451577_0053615
600 Ga0466965_0011520
601 Ga0466966_0004473
602 Ga0466963_0008760
603 Ga0453684_0159603
604 Ga0466971_0007910
605 Ga0466957_0284545
606 Ga0466960_0175308
607 Ga0451576_0167055
608 Ga0495638_0010969
609 Ga0495638_0024070
610 Ga0495651_0058339
611 Ga0495650_0001371
612 Ga0495650_0040468
613 Ga0495585_0000360
614 Ga0495607_0000083
615 Ga0495606_0000136
616 Ga0495606_0052432
617 Ga0495610_0068146
618 Ga0495616_0000003
619 Ga0495631_0000267
620 Ga0495632_0002853
621 Ga0495632_0006266
622 Ga0495648_0004160
623 Ga0495668_0076939
624 Ga0495611_0000113
625 Ga0495625_0024550
626 Ga0495635_0392240
627 Ga0495659_0139512
628 Ga0495670_0002072
629 Ga0495660_0000390
630 Ga0495683_0003265
631 Ga0495673_0000101
632 Ga0495686_0000180
633 Ga0495686_0012461
634 Ga0495686_0065113
635 Ga0495686_0108282
636 Ga0496100_0055226
637 Ga0496100_0295447
638 Ga0496101_0051564
639 Ga0496102_0001822
640 Ga0496102_0113761
641 Ga0496102_0115503
642 Ga0496102_0534223
643 Ga0496103_0043675
644 Ga0496104_0002007
645 Ga0496104_0239433
646 Ga0496104_0364274
647 Ga0496105_0080635
648 Ga0496105_0110522
649 Ga0496106_0000402
650 Ga0496106_0002603
651 Ga0496107_0004577
652 Ga0496108_0030951
653 Ga0496108_0388489
654 Ga0496109_0055016
655 Ga0496109_0147074
656 Ga0496110_0066891
657 Ga0496112_0030122
658 Ga0496113_0178079
659 Ga0496113_0198211
660 Ga0496115_0004809
661 Ga0496115_0032424
662 Ga0496121_0001227
663 Ga0496121_0079734
664 Ga0496122_0038025
665 Ga0496122_0092467
666 Ga0496123_0069822
667 Ga0496124_0104901
668 Ga0496124_0161458
669 Ga0496125_0019024
670 Ga0495678_140225
671 Ga0501291_047407
672 Ga0501292_035727
673 Ga0501296_009266
674 nmdc:mga03683_64464_c1
675 nmdc:mga00v17_41219_c1
676 nmdc:mga0yw44_73092_c1
677 nmdc:mga06z11_37450_c1
678 nmdc:mga04h51_11699_c1
679 nmdc:mga07m45_1446_c1
680 nmdc:mga05p37_1010_c1
681 nmdc:mga05p37_18031_c1
682 nmdc:mga05p37_209381_c1
683 nmdc:mga05p37_79600_c1
684 nmdc:mga09592_276141_c1
685 nmdc:mga09592_45_c1
686 nmdc:mga09592_50816_c1
687 nmdc:mga0qj67_13718_c1
688 nmdc:mga0qj67_244280_c1
689 nmdc:mga0qj67_518987_c1
690 nmdc:mga06r32_207006_c1
691 nmdc:mga06r32_211807_c1
692 nmdc:mga06r32_406993_c1
693 nmdc:mga06r32_4234_c1
694 nmdc:mga0n895_299953_c1
695 nmdc:mga08x19_359850_c1
696 nmdc:mga0a205_14063_c1
697 Ga0500641_0069470
698 Ga0500555_077193
699 Ga0500616_0289576
700 Ga0500633_0000444
701 Ga0466962_0004301
702 2599327870
703 2826581674
704 2842817140
705 2842851972
706 2846955544
707 2848862993
708 8024491120

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

27

137

0.99

PF00196

GerE

Bacterial regulatory proteins, luxR family

156

212

0.98

PF06490

FleQ

Flagellar regulatory protein FleQ

26

141

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ve5-assembly1.cif.gz_B c-terminal domain of vrar 0.93 147 210
1je8-assembly2.cif.gz_E two-component response regulator narl/dna complex: dna bending found in a high affinity site 0.9266 149 209
3qp5-assembly2.cif.gz_D crystal structure of cvir bound to antagonist chlorolactone (cl) 0.9224 151 204
7r3h-assembly2.cif.gz_C pross optimitzed variant of rhlr (75 mutations) in complex with native autoinducer c4-hsl 0.9113 151 208
4wsz-assembly1.cif.gz_B crystal structure of the dna binding domains of wild type liar from e. faecalis 0.9087 147 211
ID Description Score Start End Superfamily
1zn2A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9941 150 207 1.10.10.10
1yioA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9918 150 207 1.10.10.10
1zn2A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9613 150 207 1.10.10.10
1yioA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9591 150 207 1.10.10.10
af_P06993_830_894_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9553 150 208 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A0D1P8S4-F1-model_v4 deleted 0.986 12 211
AF-A0A2E1YW51-F1-model_v4 deleted 0.9828 29 209
AF-A0A2T2QCR9-F1-model_v4 deleted 0.979 9 211
AF-A0A661R2E3-F1-model_v4 DNA-binding response regulator 0.9782 9 209 GO:0000160
GO:0003677
GO:0006355
AF-A0A7R7H8S8-F1-model_v4 DNA-binding response regulator 0.9781 25 210 GO:0000160
GO:0003677
GO:0006355

Map