F419874

General Info

Members Datasets Scaffolds Average Seq Length
354 230 319 155

Family's Representative Sequence

Representative Sequence 3300046660|Ga0495625_0154421|Ga0495625_0154421_229_741
Length 170
Sequence MFLQHNEDQNKQKTGGEIMELKFRVAGRIAKPVSEVFEAVVNPAQLSRYFTTGGAKGRIETGATVTWDFHDFPGAFPVKVVDVVKDRKIVFQWAANEGSPQPVDYDTTVTMTFEPLDDGRTLVAITEEGWPETPGGLKGSYGNCEGWTGALCAMKVWLEHGLNLREGFYK

Samples

Sample ID Description Type Environment
1 2508501050 Microvirga lupini Lut6 Isolate Nodule
2 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
3 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
4 2524614857 Deinococcus ficus DSM 19119 Isolate Rhizosphere
5 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
6 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
7 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
8 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
9 2643221575 Microbacterium sp. Root61 Isolate Unclassified
10 2643221607 Rhizobium sp. Root73 Isolate Unclassified
11 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
12 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
13 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
14 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
15 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
16 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
17 2643221688 Rhizobium sp. Root482 Isolate Unclassified
18 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
19 2643221718 Rhizobium sp. Root268 Isolate Unclassified
20 2739367875 Deinococcus ficus CC-FR2-10 Isolate Unclassified
21 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
22 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
23 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
24 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
25 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
26 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified
27 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
28 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
29 2897561785 Pseudoclavibacter endophyticus EGI 60007 Isolate Unclassified
30 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
31 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
32 2932398195 Dietzia sp. 2505 Isolate Rhizosphere
33 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
34 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
35 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
36 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
37 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
38 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
39 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
40 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
41 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
42 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
43 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
44 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
45 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
46 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
47 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
48 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
49 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
50 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
51 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
52 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
53 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
54 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
55 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
56 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
57 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
58 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
59 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
60 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
61 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
62 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
63 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
64 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
65 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
66 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
67 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
68 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
69 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
70 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
71 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
72 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
73 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
74 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
75 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
80 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
81 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
82 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
83 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
84 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
85 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
87 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
88 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
110 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
111 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
112 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
114 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
155 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
156 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
157 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
158 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
159 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
160 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
161 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
162 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
163 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
164 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
165 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
166 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
167 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
168 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
169 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
170 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
171 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
172 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
174 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
175 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
176 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
177 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
178 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
179 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
180 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
181 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
182 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
183 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
184 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
185 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
186 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
187 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
188 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
189 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
190 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
191 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
192 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
193 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
194 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
195 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
196 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
197 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
198 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
199 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
200 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
201 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
202 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
203 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
204 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
205 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
206 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
207 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
208 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
209 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
210 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
211 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
212 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
213 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
214 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
219 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
220 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
221 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
222 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
223 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
224 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
225 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
226 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
227 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
228 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
229 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
230 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 89.83
Metatranscriptomes 0.28
Isolates 9.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.76
Nodule 1.98
Rhizoplane 2.82
Rhizosphere 77.4
Stem 0
Stem Tuber 0
Unclassified 9.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1003205 3300001976 Bacteria 2158
2 JGI25152J39213_1000312 3300002773 Bacteria 31247
3 JGI25150J39212_1000221 3300002774 Bacteria 31248
4 JGI25151J46595_10000093 3300003187 Bacteria 121884
5 JGI25153J46596_10000061 3300003215 Bacteria 131624
6 Ga0055526_1000509 3300003771 Bacteria 30962
7 Ga0055524_1023129 3300003775 Bacteria 2009
8 Ga0055530_10032714 3300003791 Bacteria 1349
9 Ga0065704_10106589 3300005289 Bacteria 2078
10 Ga0065715_10122409 3300005293 Bacteria 2193
11 Ga0070658_10090046 3300005327 Bacteria 2527
12 Ga0070658_11535707 3300005327 Bacteria 577
13 Ga0070658_11726788 3300005327 Bacteria 542
14 Ga0070683_100154288 3300005329 Bacteria 2178
15 Ga0070683_100184470 3300005329 Bacteria 1981
16 Ga0070670_100000075 3300005331 Bacteria 97494
17 Ga0070677_10000600 3300005333 Bacteria 12160
18 Ga0070680_100226741 3300005336 Bacteria 1578
19 Ga0070680_100399068 3300005336 Bacteria 1172
20 Ga0070680_100511914 3300005336 Bacteria 1027
21 Ga0070660_100125727 3300005339 Bacteria 2049
22 Ga0070660_100343592 3300005339 Bacteria 1228
23 Ga0070661_100151012 3300005344 Bacteria 1756
24 Ga0070668_100037714 3300005347 Bacteria 3692
25 Ga0070668_100038020 3300005347 Bacteria 3677
26 Ga0070668_100918719 3300005347 Bacteria 783
27 Ga0070669_100044937 3300005353 Bacteria 3218
28 Ga0070669_101083978 3300005353 Bacteria 689
29 Ga0070675_100002352 3300005354 Bacteria 14063
30 Ga0070674_100073539 3300005356 Bacteria 2423
31 Ga0070674_100364672 3300005356 Bacteria 1171
32 Ga0070659_100017978 3300005366 Bacteria 5328
33 Ga0070659_100146835 3300005366 Bacteria 1922
34 Ga0070667_100000039 3300005367 Bacteria 170228
35 Ga0070667_101531895 3300005367 Bacteria 626
36 Ga0070700_100687163 3300005441 Bacteria 812
37 Ga0070663_101238390 3300005455 Bacteria 657
38 Ga0070678_100368174 3300005456 Bacteria 1240
39 Ga0070662_100002989 3300005457 Bacteria 10511
40 Ga0070662_100057552 3300005457 Bacteria 2825
41 Ga0070681_10155830 3300005458 Bacteria 2209
42 Ga0070681_10302619 3300005458 Bacteria 1508
43 Ga0070685_10409890 3300005466 Bacteria 940
44 Ga0070707_100010629 3300005468 Bacteria 8574
45 Ga0070679_100118902 3300005530 Bacteria 2627
46 Ga0068853_100006458 3300005539 Bacteria 9319
47 Ga0068853_100189579 3300005539 Bacteria 1868
48 Ga0068853_101139094 3300005539 Bacteria 753
49 Ga0070672_100169097 3300005543 Bacteria 1817
50 Ga0070672_101014008 3300005543 Bacteria 736
51 Ga0070665_100020440 3300005548 Bacteria 6650
52 Ga0070665_100132453 3300005548 Bacteria 2495
53 Ga0068855_100174964 3300005563 Bacteria 2429
54 Ga0068855_100270918 3300005563 Bacteria 1888
55 Ga0070664_100091443 3300005564 Bacteria 2634
56 Ga0070664_100094460 3300005564 Bacteria 2593
57 Ga0070664_100571606 3300005564 Bacteria 1047
58 Ga0068854_100743555 3300005578 Bacteria 850
59 Ga0070702_100482862 3300005615 Bacteria 906
60 Ga0068852_101823371 3300005616 Bacteria 631
61 Ga0068864_100000016 3300005618 Bacteria 292454
62 Ga0068851_10210629 3300005834 Bacteria 1088
63 Ga0068863_100000033 3300005841 Bacteria 170238
64 Ga0068858_100747326 3300005842 Bacteria 953
65 Ga0068858_100941867 3300005842 Bacteria 845
66 Ga0068862_100000040 3300005844 Bacteria 167832
67 Ga0081455_10745397 3300005937 Bacteria 619
68 Ga0075363_100001468 3300006048 Bacteria 8960
69 Ga0075364_10248762 3300006051 Bacteria 1208
70 Ga0075362_10000033 3300006177 Bacteria 50782
71 Ga0075369_10000589 3300006186 Bacteria 11494
72 Ga0075366_10000058 3300006195 Bacteria 40618
73 Ga0097621_100560351 3300006237 Bacteria 1041
74 Ga0097621_100628465 3300006237 Bacteria 984
75 Ga0097621_100991311 3300006237 Bacteria 786
76 Ga0068871_100310747 3300006358 Bacteria 1386
77 Ga0079104_1035244 3300006946 Bacteria 1209
78 Ga0105251_10001444 3300009011 Bacteria 20434
79 Ga0111539_10499487 3300009094 Bacteria 1417
80 Ga0105247_10198752 3300009101 Bacteria 1346
81 Ga0105243_10060733 3300009148 Bacteria 3020
82 Ga0105241_11142495 3300009174 Bacteria 735
83 Ga0105248_10000021 3300009177 Bacteria 276159
84 Ga0105237_11701779 3300009545 Bacteria 638
85 Ga0105238_10110370 3300009551 Bacteria 2731
86 Ga0105238_11120713 3300009551 Bacteria 810
87 Ga0105249_10002603 3300009553 Bacteria 15632
88 Ga0105249_10802515 3300009553 Bacteria 1005
89 Ga0105239_10122221 3300010375 Bacteria 2893
90 Ga0105239_10614535 3300010375 Bacteria 1240
91 Ga0157373_10641395 3300013100 Bacteria 775
92 Ga0157371_10077133 3300013102 Bacteria 2360
93 Ga0157371_10212538 3300013102 Bacteria 1388
94 Ga0157370_10717470 3300013104 Bacteria 912
95 Ga0157370_11124473 3300013104 Bacteria 710
96 Ga0163162_10512857 3300013306 Bacteria 1329
97 Ga0163162_11000808 3300013306 Bacteria 945
98 Ga0157372_10044754 3300013307 Bacteria 4906
99 Ga0157372_12461998 3300013307 Bacteria 598
100 Ga0163163_12012903 3300014325 Bacteria 637
101 Ga0157380_10070104 3300014326 Bacteria 2832
102 Ga0157380_10608088 3300014326 Bacteria 1083
103 Ga0182008_10227632 3300014497 Bacteria 956
104 Ga0157379_10337248 3300014968 Bacteria 1378
105 Ga0163161_10293078 3300017792 Bacteria 1279
106 Ga0206349_1382037 3300020075 Bacteria 1432
107 Ga0207425_1000015 3300025245 Bacteria 466368
108 Ga0209129_1000131 3300025258 Bacteria 127801
109 Ga0209025_1000002 3300025294 Bacteria 1393142
110 Ga0209025_1153525 3300025294 Bacteria 632
111 Ga0209564_1000065 3300025295 Bacteria 315205
112 Ga0209758_1000003 3300025297 Bacteria 1398533
113 Ga0209758_1045507 3300025297 Bacteria 1593
114 Ga0209050_1001666 3300025298 Bacteria 22438
115 Ga0209256_1000266 3300025299 Bacteria 92357
116 Ga0207713_1007763 3300025735 Bacteria 6265
117 Ga0207682_10002530 3300025893 Bacteria 8177
118 Ga0207682_10120717 3300025893 Bacteria 1162
119 Ga0207705_10230196 3300025909 Bacteria 1410
120 Ga0207705_10396481 3300025909 Bacteria 1067
121 Ga0207654_10149169 3300025911 Bacteria 1499
122 Ga0207707_10162630 3300025912 Bacteria 1951
123 Ga0207660_10041770 3300025917 Bacteria 3215
124 Ga0207657_10015490 3300025919 Bacteria 7386
125 Ga0207657_10219027 3300025919 Bacteria 1525
126 Ga0207649_10029345 3300025920 Bacteria 3247
127 Ga0207652_10109537 3300025921 Bacteria 2449
128 Ga0207646_10052057 3300025922 Bacteria 3664
129 Ga0207681_10191695 3300025923 Bacteria 1564
130 Ga0207681_11512873 3300025923 Bacteria 563
131 Ga0207694_10497374 3300025924 Bacteria 1021
132 Ga0207650_10000069 3300025925 Bacteria 138442
133 Ga0207659_10049103 3300025926 Bacteria 2991
134 Ga0207690_10057979 3300025932 Bacteria 2618
135 Ga0207690_10215011 3300025932 Bacteria 1468
136 Ga0207690_10353868 3300025932 Bacteria 1162
137 Ga0207690_11345676 3300025932 Bacteria 597
138 Ga0207706_10028309 3300025933 Bacteria 5005
139 Ga0207706_10088024 3300025933 Bacteria 2731
140 Ga0207706_10301642 3300025933 Bacteria 1395
141 Ga0207709_10035157 3300025935 Bacteria 2960
142 Ga0207669_10075641 3300025937 Bacteria 2134
143 Ga0207669_10569521 3300025937 Bacteria 917
144 Ga0207691_10146413 3300025940 Bacteria 2079
145 Ga0207691_10817798 3300025940 Bacteria 782
146 Ga0207691_11289239 3300025940 Bacteria 603
147 Ga0207711_10000025 3300025941 Bacteria 289972
148 Ga0207661_10081451 3300025944 Bacteria 2674
149 Ga0207661_10175329 3300025944 Bacteria 1869
150 Ga0207679_10047566 3300025945 Bacteria 3117
151 Ga0207679_10125471 3300025945 Bacteria 2051
152 Ga0207679_10170141 3300025945 Bacteria 1793
153 Ga0207667_10444251 3300025949 Bacteria 1318
154 Ga0207712_10002020 3300025961 Bacteria 13317
155 Ga0207668_10135028 3300025972 Bacteria 1889
156 Ga0207668_10436620 3300025972 Bacteria 1114
157 Ga0207640_10135401 3300025981 Bacteria 1787
158 Ga0207658_10000652 3300025986 Bacteria 30347
159 Ga0207639_10425366 3300026041 Bacteria 1201
160 Ga0207639_10612256 3300026041 Bacteria 1005
161 Ga0207708_11133350 3300026075 Bacteria 683
162 Ga0207641_10000002 3300026088 Bacteria 981004
163 Ga0207676_10000044 3300026095 Bacteria 161679
164 Ga0207676_11243505 3300026095 Bacteria 739
165 Ga0207674_10014728 3300026116 Bacteria 8626
166 Ga0207674_10279136 3300026116 Bacteria 1618
167 Ga0207675_100997117 3300026118 Bacteria 856
168 Ga0207683_10406799 3300026121 Bacteria 1252
169 Ga0207698_10274733 3300026142 Bacteria 1555
170 Ga0207698_10628164 3300026142 Bacteria 1062
171 Ga0209974_10016080 3300027876 Bacteria 2484
172 Ga0268266_10059598 3300028379 Bacteria 3289
173 Ga0268266_10291785 3300028379 Bacteria 1519
174 Ga0268265_10000003 3300028380 Bacteria 949201
175 Ga0307515_10000860 3300028794 Bacteria 69854
176 Ga0307515_10052151 3300028794 Bacteria 6076
177 Ga0307515_10357170 3300028794 Bacteria 1104
178 Ga0307513_10002143 3300031456 Bacteria 27633
179 Ga0307408_100117396 3300031548 Bacteria 2055
180 Ga0307408_100194705 3300031548 Bacteria 1636
181 Ga0307408_101646862 3300031548 Bacteria 610
182 Ga0307405_10028431 3300031731 Bacteria 3256
183 Ga0307405_10150063 3300031731 Bacteria 1637
184 Ga0307405_10552705 3300031731 Bacteria 932
185 Ga0307405_11185364 3300031731 Bacteria 660
186 Ga0307413_10008368 3300031824 Bacteria 4880
187 Ga0307413_10019834 3300031824 Bacteria 3562
188 Ga0307413_10098545 3300031824 Bacteria 1925
189 Ga0307413_10253143 3300031824 Bacteria 1308
190 Ga0307413_10301447 3300031824 Bacteria 1215
191 Ga0307413_10495901 3300031824 Bacteria 979
192 Ga0307413_10673745 3300031824 Bacteria 856
193 Ga0307413_10912467 3300031824 Bacteria 747
194 Ga0307413_11180575 3300031824 Bacteria 665
195 Ga0307413_11242819 3300031824 Bacteria 649
196 Ga0307410_10025207 3300031852 Bacteria 3727
197 Ga0307410_10084136 3300031852 Bacteria 2242
198 Ga0307410_10085590 3300031852 Bacteria 2225
199 Ga0307410_10145430 3300031852 Bacteria 1759
200 Ga0307410_10373037 3300031852 Bacteria 1146
201 Ga0307410_10383252 3300031852 Bacteria 1132
202 Ga0307410_10988987 3300031852 Bacteria 725
203 Ga0307406_10094381 3300031901 Bacteria 2022
204 Ga0307406_10501926 3300031901 Bacteria 984
205 Ga0307406_10995290 3300031901 Bacteria 719
206 Ga0307407_10032176 3300031903 Bacteria 2849
207 Ga0307412_10019162 3300031911 Bacteria 4136
208 Ga0307412_10072163 3300031911 Bacteria 2359
209 Ga0307412_10159729 3300031911 Bacteria 1673
210 Ga0307412_10281660 3300031911 Bacteria 1306
211 Ga0307412_10477405 3300031911 Bacteria 1033
212 Ga0307412_11957780 3300031911 Bacteria 542
213 Ga0307409_100035151 3300031995 Bacteria 3668
214 Ga0307409_100069691 3300031995 Bacteria 2788
215 Ga0307409_100082523 3300031995 Bacteria 2602
216 Ga0307409_100167156 3300031995 Bacteria 1932
217 Ga0307409_100224574 3300031995 Bacteria 1698
218 Ga0307409_101603533 3300031995 Bacteria 679
219 Ga0307409_101761104 3300031995 Bacteria 648
220 Ga0307416_100014578 3300032002 Bacteria 5395
221 Ga0307416_100082842 3300032002 Bacteria 2719
222 Ga0307416_100431452 3300032002 Bacteria 1365
223 Ga0307416_100758892 3300032002 Bacteria 1063
224 Ga0307416_102042884 3300032002 Bacteria 675
225 Ga0307414_10036346 3300032004 Bacteria 3288
226 Ga0307414_10098192 3300032004 Bacteria 2196
227 Ga0307414_10103770 3300032004 Bacteria 2146
228 Ga0307414_10141227 3300032004 Bacteria 1886
229 Ga0307414_10203876 3300032004 Bacteria 1611
230 Ga0307414_10224063 3300032004 Bacteria 1545
231 Ga0307414_10280604 3300032004 Bacteria 1399
232 Ga0307414_10412048 3300032004 Bacteria 1176
233 Ga0307414_10544913 3300032004 Bacteria 1033
234 Ga0307414_10622484 3300032004 Bacteria 970
235 Ga0307414_10864573 3300032004 Bacteria 827
236 Ga0307414_11631637 3300032004 Bacteria 601
237 Ga0307411_10006109 3300032005 Bacteria 5991
238 Ga0307411_10068716 3300032005 Bacteria 2389
239 Ga0307411_10314463 3300032005 Bacteria 1262
240 Ga0307411_10938321 3300032005 Bacteria 771
241 Ga0307411_11334248 3300032005 Bacteria 654
242 Ga0307411_12181149 3300032005 Bacteria 519
243 Ga0307415_100211123 3300032126 Bacteria 1549
244 Ga0307415_100299510 3300032126 Bacteria 1331
245 Ga0307415_101098592 3300032126 Bacteria 744
246 Ga0373948_0084071 3300034817 Bacteria 730
247 Ga0373949_0187097 3300035090 Bacteria 616
248 Ga0373939_0119905 3300035114 Bacteria 927
249 Ga0373960_0138271 3300035121 Bacteria 823
250 Ga0373925_0246792 3300037068 Bacteria 1431
251 Ga0395905_1028648 3300037471 Bacteria 727
252 Ga0237819_00066 3300038705 Bacteria 37717
253 Ga0439436_0030162 3300041404 Bacteria 1576
254 Ga0439438_024814 3300041405 Bacteria 1639
255 Ga0439465_0011348 3300041413 Bacteria 2796
256 Ga0451793_0604479 3300041452 Unclassified 611
257 Ga0451797_1185708 3300041453 Bacteria 789
258 Ga0451837_1009394 3300041494 Bacteria 899
259 Ga0451837_1403123 3300041494 Bacteria 1117
260 Ga0451853_0923419 3300041512 Bacteria 1924
261 Ga0451853_3227068 3300041512 Bacteria 2488
262 Ga0439431_0105371 3300041997 Bacteria 777
263 Ga0439449_0050857 3300042007 Bacteria 1533
264 Ga0439462_0001137 3300042015 Bacteria 5779
265 Ga0450920_007756 3300042122 Bacteria 1949
266 Ga0439434_0033026 3300042435 Bacteria 1576
267 Ga0439435_0207226 3300042436 Bacteria 648
268 Ga0450918_039135 3300042531 Bacteria 849
269 Ga0453683_0031213 3300044673 Bacteria 3367
270 Ga0495603_0184554 3300046455 Bacteria 1207
271 Ga0495596_0003163 3300046500 Bacteria 8485
272 Ga0495606_0030764 3300046507 Bacteria 3743
273 Ga0495610_0001516 3300046512 Bacteria 20442
274 Ga0495620_0282838 3300046515 Bacteria 631
275 Ga0495643_0066749 3300046522 Bacteria 1897
276 Ga0495625_0154421 3300046660 Bacteria 1541
277 Ga0495625_0555568 3300046660 Bacteria 695
278 Ga0495625_0742276 3300046660 Bacteria 576
279 Ga0495647_0284359 3300046681 Bacteria 742
280 Ga0495670_0018541 3300046691 Bacteria 3426
281 Ga0495672_0539655 3300047320 Bacteria 513
282 Ga0495615_0175908 3300048090 Bacteria 650
283 Ga0495626_0002831 3300048091 Bacteria 11592
284 Ga0496101_0565919 3300048904 Bacteria 899
285 Ga0496103_0023096 3300048906 Bacteria 3749
286 Ga0496104_1709377 3300048907 Bacteria 532
287 Ga0496105_0511382 3300048908 Bacteria 942
288 Ga0496108_0432378 3300048911 Bacteria 1150
289 Ga0496109_0520262 3300048912 Bacteria 1123
290 Ga0496110_1820709 3300048913 Bacteria 519
291 Ga0496114_1762638 3300048917 Bacteria 507
292 Ga0496117_0010397 3300048920 Bacteria 8489
293 Ga0496118_0002436 3300048921 Bacteria 25049
294 Ga0496120_0211008 3300048923 Bacteria 934
295 Ga0496124_0015670 3300048927 Bacteria 7251
296 Ga0501031_0633971 3300049568 Bacteria 687
297 Ga0501033_0335205 3300049570 Bacteria 1061
298 Ga0501034_0002424 3300049571 Bacteria 22556
299 Ga0501034_0069338 3300049571 Bacteria 3537
300 Ga0501034_0073614 3300049571 Bacteria 3425
301 Ga0501034_0463000 3300049571 Bacteria 1184
302 Ga0501034_0514045 3300049571 Bacteria 1110
303 Ga0501034_0584845 3300049571 Bacteria 1023
304 Ga0501034_0713860 3300049571 Bacteria 900
305 Ga0501034_0938638 3300049571 Bacteria 751
306 Ga0501037_0311851 3300049573 Bacteria 1090
307 Ga0501037_0378629 3300049573 Bacteria 973
308 Ga0501041_0013765 3300049577 Bacteria 4797
309 nmdc:mga03683_32_c1 3300050489 Bacteria 68182
310 nmdc:mga03n38_10579_c1 3300050490 Bacteria 3402
311 nmdc:mga0k408_7_c1 3300050493 Bacteria 164270
312 nmdc:mga04h51_169064_c1 3300050495 Bacteria 845
313 nmdc:mga0sz30_1297_c1 3300050516 Bacteria 8890
314 Ga0495655_0160542 3300053083 Bacteria 713
315 Ga0500643_000001 3300053087 Bacteria 1440111
316 Ga0500555_056781 3300053103 Bacteria 1061
317 Ga0500568_0224920 3300053139 Bacteria 685
318 Ga0500620_175612 3300053155 Bacteria 739
319 Ga0500622_0122165 3300053156 Bacteria 1262

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006048 Ga0075363_100001468 Ga0075363_1000014682 130
2 3300006177 Ga0075362_10000033 Ga0075362_1000003328 130
3 3300006186 Ga0075369_10000589 Ga0075369_100005897 130
4 3300046681 Ga0495647_0284359 Ga0495647_0284359_53_526 140
5 3300048923 Ga0496120_0211008 Ga0496120_0211008_294_770 140
6 3300009551 Ga0105238_10110370 Ga0105238_101103702 141
7 3300026095 Ga0207676_11243505 Ga0207676_112435051 143
8 3300041494 Ga0451837_1009394 Ga0451837_1009394_110_583 143
9 3300041512 Ga0451853_3227068 Ga0451853_3227068_259_732 143
10 3300044673 Ga0453683_0031213 Ga0453683_0031213_508_945 144
11 3300047320 Ga0495672_0539655 Ga0495672_0539655_32_472 144
12 iso_pu_bacteria 2524614857 2526062742 144
13 iso_pu_bacteria 2739367875 2740062076 144
14 iso_pu_bacteria 2840878972 2840881227 144
15 3300005468 Ga0070707_100010629 Ga0070707_1000106295 145
16 3300006051 Ga0075364_10248762 Ga0075364_102487622 145
17 3300025922 Ga0207646_10052057 Ga0207646_100520572 145
18 3300049577 Ga0501041_0013765 Ga0501041_0013765_11_448 145
19 3300050489 nmdc:mga03683_32_c1 nmdc:mga03683_32_c1_57697_58134 145
20 3300050490 nmdc:mga03n38_10579_c1 nmdc:mga03n38_10579_c1_1385_1822 145
21 3300050516 nmdc:mga0sz30_1297_c1 nmdc:mga0sz30_1297_c1_4311_4748 145
22 iso_pu_bacteria 2898795034 2898798994 145
23 3300050495 nmdc:mga04h51_169064_c1 nmdc:mga04h51_169064_c1_80_559 146
24 iso_pu_bacteria 2508501114 2509079157 146
25 iso_pu_bacteria 2835312727 2835315566 146
26 iso_pu_bacteria 2929199973 2929202041 146
27 iso_pu_bacteria 8055909800 8055911040 146
28 3300005616 Ga0068852_101823371 Ga0068852_1018233711 147
29 3300005842 Ga0068858_100941867 Ga0068858_1009418671 147
30 3300006195 Ga0075366_10000058 Ga0075366_1000005828 147
31 3300009094 Ga0111539_10499487 Ga0111539_104994871 147
32 3300013306 Ga0163162_11000808 Ga0163162_110008082 147
33 3300014325 Ga0163163_12012903 Ga0163163_120129031 147
34 3300026142 Ga0207698_10628164 Ga0207698_106281643 147
35 3300048904 Ga0496101_0565919 Ga0496101_0565919_158_601 147
36 3300048907 Ga0496104_1709377 Ga0496104_1709377_29_472 147
37 3300048912 Ga0496109_0520262 Ga0496109_0520262_402_845 147
38 3300048913 Ga0496110_1820709 Ga0496110_1820709_21_464 147
39 3300048917 Ga0496114_1762638 Ga0496114_1762638_54_497 147
40 3300050493 nmdc:mga0k408_7_c1 nmdc:mga0k408_7_c1_145480_145923 147
41 iso_pu_bacteria 2643221688 2644494367 147
42 3300031824 Ga0307413_10253143 Ga0307413_102531432 148
43 3300031911 Ga0307412_10477405 Ga0307412_104774053 148
44 3300032002 Ga0307416_100082842 Ga0307416_1000828424 148
45 3300032004 Ga0307414_10141227 Ga0307414_101412273 148
46 3300049571 Ga0501034_0938638 Ga0501034_0938638_175_636 148
47 3300049573 Ga0501037_0378629 Ga0501037_0378629_329_790 148
48 3300053155 Ga0500620_175612 Ga0500620_175612_255_719 148
49 iso_pu_bacteria 2582581306 2585270293 148
50 iso_pu_bacteria 2582581865 2585388732 148
51 iso_pu_bacteria 2643221637 2644208355 148
52 iso_pu_bacteria 2643221718 2644651606 148
53 iso_pu_bacteria 2932398195 2932400069 148
54 iso_pu_bacteria 2946033335 2946035553 148
55 3300005329 Ga0070683_100184470 Ga0070683_1001844704 149
56 3300005336 Ga0070680_100226741 Ga0070680_1002267414 149
57 3300005336 Ga0070680_100399068 Ga0070680_1003990682 149
58 3300005336 Ga0070680_100511914 Ga0070680_1005119142 149
59 3300005339 Ga0070660_100125727 Ga0070660_1001257272 149
60 3300005339 Ga0070660_100343592 Ga0070660_1003435922 149
61 3300005344 Ga0070661_100151012 Ga0070661_1001510123 149
62 3300005347 Ga0070668_100918719 Ga0070668_1009187192 149
63 3300005353 Ga0070669_101083978 Ga0070669_1010839781 149
64 3300005356 Ga0070674_100364672 Ga0070674_1003646722 149
65 3300005457 Ga0070662_100057552 Ga0070662_1000575523 149
66 3300005458 Ga0070681_10155830 Ga0070681_101558302 149
67 3300005458 Ga0070681_10302619 Ga0070681_103026192 149
68 3300005466 Ga0070685_10409890 Ga0070685_104098901 149
69 3300005530 Ga0070679_100118902 Ga0070679_1001189024 149
70 3300005539 Ga0068853_100189579 Ga0068853_1001895793 149
71 3300005543 Ga0070672_101014008 Ga0070672_1010140082 149
72 3300005564 Ga0070664_100091443 Ga0070664_1000914433 149
73 3300005615 Ga0070702_100482862 Ga0070702_1004828622 149
74 3300006237 Ga0097621_100628465 Ga0097621_1006284652 149
75 3300009148 Ga0105243_10060733 Ga0105243_100607334 149
76 3300009551 Ga0105238_11120713 Ga0105238_111207132 149
77 3300009553 Ga0105249_10802515 Ga0105249_108025152 149
78 3300013100 Ga0157373_10641395 Ga0157373_106413951 149
79 3300014326 Ga0157380_10070104 Ga0157380_100701043 149
80 3300017792 Ga0163161_10293078 Ga0163161_102930783 149
81 3300025909 Ga0207705_10396481 Ga0207705_103964812 149
82 3300025912 Ga0207707_10162630 Ga0207707_101626302 149
83 3300025917 Ga0207660_10041770 Ga0207660_100417702 149
84 3300025919 Ga0207657_10219027 Ga0207657_102190272 149
85 3300025921 Ga0207652_10109537 Ga0207652_101095372 149
86 3300025923 Ga0207681_11512873 Ga0207681_115128731 149
87 3300025932 Ga0207690_10057979 Ga0207690_100579791 149
88 3300025932 Ga0207690_10353868 Ga0207690_103538682 149
89 3300025933 Ga0207706_10301642 Ga0207706_103016423 149
90 3300025937 Ga0207669_10569521 Ga0207669_105695212 149
91 3300025940 Ga0207691_10817798 Ga0207691_108177982 149
92 3300025940 Ga0207691_11289239 Ga0207691_112892391 149
93 3300025944 Ga0207661_10175329 Ga0207661_101753293 149
94 3300025945 Ga0207679_10125471 Ga0207679_101254713 149
95 3300026041 Ga0207639_10425366 Ga0207639_104253662 149
96 3300026116 Ga0207674_10279136 Ga0207674_102791361 149
97 3300026118 Ga0207675_100997117 Ga0207675_1009971172 149
98 3300027876 Ga0209974_10016080 Ga0209974_100160802 149
99 3300046455 Ga0495603_0184554 Ga0495603_0184554_578_1051 149
100 iso_pu_bacteria 2582581283 2585169760 149
101 iso_pu_bacteria 2643221607 2644050371 149
102 iso_pu_bacteria 2643221636 2644203853 149
103 iso_pu_bacteria 2643221686 2644483290 149
104 iso_pu_bacteria 2643221689 2644499498 149
105 3300005327 Ga0070658_11726788 Ga0070658_117267881 150
106 3300005367 Ga0070667_101531895 Ga0070667_1015318951 150
107 3300013102 Ga0157371_10077133 Ga0157371_100771332 150
108 3300013307 Ga0157372_12461998 Ga0157372_124619981 150
109 3300025909 Ga0207705_10230196 Ga0207705_102301961 150
110 3300025932 Ga0207690_11345676 Ga0207690_113456761 150
111 3300025935 Ga0207709_10035157 Ga0207709_100351574 150
112 3300041452 Ga0451793_0604479 Ga0451793_0604479_99_587 150
113 3300041453 Ga0451797_1185708 Ga0451797_1185708_108_584 150
114 3300041494 Ga0451837_1403123 Ga0451837_1403123_445_918 150
115 3300048908 Ga0496105_0511382 Ga0496105_0511382_317_784 150
116 3300053087 Ga0500643_000001 Ga0500643_000001_549025_549477 150
117 3300053139 Ga0500568_0224920 Ga0500568_0224920_174_626 150
118 iso_pu_bacteria 2643221575 2643885002 150
119 iso_pu_bacteria 2842888712 2842891188 150
120 iso_pu_bacteria 2897561785 2897563652 150
121 3300028794 Ga0307515_10000860 Ga0307515_1000086013 151
122 3300031456 Ga0307513_10002143 Ga0307513_100021434 151
123 3300031824 Ga0307413_10495901 Ga0307413_104959011 151
124 3300031824 Ga0307413_11180575 Ga0307413_111805751 151
125 3300032004 Ga0307414_10098192 Ga0307414_100981922 151
126 3300032004 Ga0307414_10203876 Ga0307414_102038763 151
127 3300032004 Ga0307414_10864573 Ga0307414_108645732 151
128 3300049568 Ga0501031_0633971 Ga0501031_0633971_141_596 151
129 iso_pu_bacteria 2818991438 2819552528 151
130 3300028794 Ga0307515_10052151 Ga0307515_100521518 152
131 3300046660 Ga0495625_0154421 Ga0495625_0154421_229_741 152
132 3300046660 Ga0495625_0742276 Ga0495625_0742276_60_554 152
133 iso_pu_bacteria 2513237159 2513997809 152
134 iso_pu_bacteria 2582581866 2585395556 152
135 iso_pu_bacteria 2842521101 2842521942 152
136 3300002773 JGI25152J39213_1000312 JGI25152J39213_10003122 153
137 3300002774 JGI25150J39212_1000221 JGI25150J39212_100022130 153
138 3300003187 JGI25151J46595_10000093 JGI25151J46595_1000009366 153
139 3300003215 JGI25153J46596_10000061 JGI25153J46596_1000006172 153
140 3300020075 Ga0206349_1382037 Ga0206349_13820372 153
141 3300025245 Ga0207425_1000015 Ga0207425_1000015385 153
142 3300025258 Ga0209129_1000131 Ga0209129_100013183 153
143 3300025294 Ga0209025_1000002 Ga0209025_10000021284 153
144 3300025297 Ga0209758_1000003 Ga0209758_10000031291 153
145 3300032005 Ga0307411_12181149 Ga0307411_121811491 153
146 3300038705 Ga0237819_00066 Ga0237819_00066_15668_16129 153
147 iso_pu_bacteria 2831935698 2831940644 153
148 iso_pu_bacteria 2887375801 2887380712 153
149 3300046500 Ga0495596_0003163 Ga0495596_0003163_7289_7753 154
150 iso_pu_bacteria 2508501050 2508734224 154
151 iso_pu_bacteria 2643221614 2644087415 154
152 iso_pu_bacteria 2643221661 2644344541 154
153 iso_pu_bacteria 2643221666 2644366775 154
154 iso_pu_bacteria 2894232714 2894232919 154
155 iso_pu_bacteria 2996310559 2996311526 154
156 3300003771 Ga0055526_1000509 Ga0055526_100050932 155
157 3300003775 Ga0055524_1023129 Ga0055524_10231292 155
158 3300003791 Ga0055530_10032714 Ga0055530_100327141 155
159 3300005327 Ga0070658_10090046 Ga0070658_100900462 155
160 3300005327 Ga0070658_11535707 Ga0070658_115357071 155
161 3300005329 Ga0070683_100154288 Ga0070683_1001542881 155
162 3300005366 Ga0070659_100017978 Ga0070659_1000179785 155
163 3300005366 Ga0070659_100146835 Ga0070659_1001468353 155
164 3300005455 Ga0070663_101238390 Ga0070663_1012383901 155
165 3300005539 Ga0068853_101139094 Ga0068853_1011390941 155
166 3300005548 Ga0070665_100132453 Ga0070665_1001324534 155
167 3300005563 Ga0068855_100174964 Ga0068855_1001749643 155
168 3300005563 Ga0068855_100270918 Ga0068855_1002709183 155
169 3300005564 Ga0070664_100571606 Ga0070664_1005716062 155
170 3300005834 Ga0068851_10210629 Ga0068851_102106292 155
171 3300005842 Ga0068858_100747326 Ga0068858_1007473261 155
172 3300005937 Ga0081455_10745397 Ga0081455_107453971 155
173 3300006237 Ga0097621_100560351 Ga0097621_1005603511 155
174 3300006237 Ga0097621_100991311 Ga0097621_1009913112 155
175 3300006358 Ga0068871_100310747 Ga0068871_1003107472 155
176 3300010375 Ga0105239_10122221 Ga0105239_101222212 155
177 3300010375 Ga0105239_10614535 Ga0105239_106145353 155
178 3300013104 Ga0157370_10717470 Ga0157370_107174701 155
179 3300013307 Ga0157372_10044754 Ga0157372_100447544 155
180 3300014497 Ga0182008_10227632 Ga0182008_102276322 155
181 3300025295 Ga0209564_1000065 Ga0209564_1000065262 155
182 3300025298 Ga0209050_1001666 Ga0209050_100166620 155
183 3300025299 Ga0209256_1000266 Ga0209256_100026668 155
184 3300025911 Ga0207654_10149169 Ga0207654_101491693 155
185 3300025919 Ga0207657_10015490 Ga0207657_100154909 155
186 3300025920 Ga0207649_10029345 Ga0207649_100293454 155
187 3300025924 Ga0207694_10497374 Ga0207694_104973742 155
188 3300025932 Ga0207690_10215011 Ga0207690_102150113 155
189 3300025933 Ga0207706_10028309 Ga0207706_100283095 155
190 3300025944 Ga0207661_10081451 Ga0207661_100814513 155
191 3300025945 Ga0207679_10170141 Ga0207679_101701413 155
192 3300025949 Ga0207667_10444251 Ga0207667_104442512 155
193 3300025981 Ga0207640_10135401 Ga0207640_101354013 155
194 3300026041 Ga0207639_10612256 Ga0207639_106122562 155
195 3300026116 Ga0207674_10014728 Ga0207674_100147286 155
196 3300026142 Ga0207698_10274733 Ga0207698_102747332 155
197 3300028379 Ga0268266_10291785 Ga0268266_102917852 155
198 3300028794 Ga0307515_10357170 Ga0307515_103571702 155
199 3300031852 Ga0307410_10145430 Ga0307410_101454302 155
200 3300031995 Ga0307409_100167156 Ga0307409_1001671563 155
201 3300034817 Ga0373948_0084071 Ga0373948_0084071_103_573 155
202 3300035090 Ga0373949_0187097 Ga0373949_0187097_127_597 155
203 3300035114 Ga0373939_0119905 Ga0373939_0119905_190_660 155
204 3300035121 Ga0373960_0138271 Ga0373960_0138271_44_514 155
205 3300037068 Ga0373925_0246792 Ga0373925_0246792_532_1002 155
206 3300037471 Ga0395905_1028648 Ga0395905_1028648_191_661 155
207 3300042436 Ga0439435_0207226 Ga0439435_0207226_118_585 155
208 3300046507 Ga0495606_0030764 Ga0495606_0030764_24_491 155
209 3300046512 Ga0495610_0001516 Ga0495610_0001516_14583_15050 155
210 3300046522 Ga0495643_0066749 Ga0495643_0066749_1275_1742 155
211 3300046660 Ga0495625_0555568 Ga0495625_0555568_30_497 155
212 3300048091 Ga0495626_0002831 Ga0495626_0002831_9771_10238 155
213 3300048911 Ga0496108_0432378 Ga0496108_0432378_360_830 155
214 3300048927 Ga0496124_0015670 Ga0496124_0015670_6175_6642 155
215 3300049570 Ga0501033_0335205 Ga0501033_0335205_527_1006 155
216 3300049571 Ga0501034_0069338 Ga0501034_0069338_2372_2845 155
217 3300049571 Ga0501034_0073614 Ga0501034_0073614_2279_2749 155
218 3300049571 Ga0501034_0463000 Ga0501034_0463000_653_1126 155
219 3300049571 Ga0501034_0514045 Ga0501034_0514045_348_854 155
220 3300049571 Ga0501034_0584845 Ga0501034_0584845_383_853 155
221 3300049571 Ga0501034_0713860 Ga0501034_0713860_332_829 155
222 3300049573 Ga0501037_0311851 Ga0501037_0311851_517_1023 155
223 3300053103 Ga0500555_056781 Ga0500555_056781_331_819 155
224 3300053156 Ga0500622_0122165 Ga0500622_0122165_647_1117 155
225 3300025294 Ga0209025_1153525 Ga0209025_11535252 156
226 3300025297 Ga0209758_1045507 Ga0209758_10455072 156
227 3300031548 Ga0307408_100117396 Ga0307408_1001173962 156
228 3300031731 Ga0307405_11185364 Ga0307405_111853642 156
229 3300031911 Ga0307412_10072163 Ga0307412_100721631 156
230 3300031995 Ga0307409_100069691 Ga0307409_1000696915 156
231 3300032002 Ga0307416_102042884 Ga0307416_1020428841 156
232 3300032004 Ga0307414_10544913 Ga0307414_105449132 156
233 3300041404 Ga0439436_0030162 Ga0439436_0030162_571_1044 156
234 3300041405 Ga0439438_024814 Ga0439438_024814_930_1403 156
235 3300041413 Ga0439465_0011348 Ga0439465_0011348_1253_1726 156
236 3300041997 Ga0439431_0105371 Ga0439431_0105371_278_751 156
237 3300042435 Ga0439434_0033026 Ga0439434_0033026_618_1091 156
238 3300042531 Ga0450918_039135 Ga0450918_039135_246_719 156
239 3300005347 Ga0070668_100037714 Ga0070668_1000377143 157
240 3300005539 Ga0068853_100006458 Ga0068853_1000064585 157
241 3300006946 Ga0079104_1035244 Ga0079104_10352442 157
242 3300009174 Ga0105241_11142495 Ga0105241_111424951 157
243 3300009545 Ga0105237_11701779 Ga0105237_117017791 157
244 3300025972 Ga0207668_10135028 Ga0207668_101350282 157
245 3300031852 Ga0307410_10988987 Ga0307410_109889871 157
246 3300032004 Ga0307414_11631637 Ga0307414_116316372 157
247 3300001976 JGI24752J21851_1003205 JGI24752J21851_10032052 158
248 3300005289 Ga0065704_10106589 Ga0065704_101065892 158
249 3300005293 Ga0065715_10122409 Ga0065715_101224091 158
250 3300005331 Ga0070670_100000075 Ga0070670_10000007582 158
251 3300005333 Ga0070677_10000600 Ga0070677_100006008 158
252 3300005347 Ga0070668_100038020 Ga0070668_1000380205 158
253 3300005353 Ga0070669_100044937 Ga0070669_1000449374 158
254 3300005354 Ga0070675_100002352 Ga0070675_10000235211 158
255 3300005356 Ga0070674_100073539 Ga0070674_1000735393 158
256 3300005367 Ga0070667_100000039 Ga0070667_10000003956 158
257 3300005441 Ga0070700_100687163 Ga0070700_1006871632 158
258 3300005456 Ga0070678_100368174 Ga0070678_1003681742 158
259 3300005457 Ga0070662_100002989 Ga0070662_1000029895 158
260 3300005543 Ga0070672_100169097 Ga0070672_1001690973 158
261 3300005548 Ga0070665_100020440 Ga0070665_1000204406 158
262 3300005564 Ga0070664_100094460 Ga0070664_1000944603 158
263 3300005578 Ga0068854_100743555 Ga0068854_1007435552 158
264 3300005618 Ga0068864_100000016 Ga0068864_100000016196 158
265 3300005841 Ga0068863_100000033 Ga0068863_10000003350 158
266 3300005844 Ga0068862_100000040 Ga0068862_10000004049 158
267 3300009011 Ga0105251_10001444 Ga0105251_1000144411 158
268 3300009101 Ga0105247_10198752 Ga0105247_101987523 158
269 3300009177 Ga0105248_10000021 Ga0105248_10000021161 158
270 3300009553 Ga0105249_10002603 Ga0105249_100026038 158
271 3300013102 Ga0157371_10212538 Ga0157371_102125383 158
272 3300013104 Ga0157370_11124473 Ga0157370_111244732 158
273 3300013306 Ga0163162_10512857 Ga0163162_105128573 158
274 3300014326 Ga0157380_10608088 Ga0157380_106080882 158
275 3300014968 Ga0157379_10337248 Ga0157379_103372482 158
276 3300025735 Ga0207713_1007763 Ga0207713_10077635 158
277 3300025893 Ga0207682_10002530 Ga0207682_100025305 158
278 3300025893 Ga0207682_10120717 Ga0207682_101207172 158
279 3300025923 Ga0207681_10191695 Ga0207681_101916953 158
280 3300025925 Ga0207650_10000069 Ga0207650_10000069122 158
281 3300025926 Ga0207659_10049103 Ga0207659_100491031 158
282 3300025933 Ga0207706_10088024 Ga0207706_100880244 158
283 3300025937 Ga0207669_10075641 Ga0207669_100756413 158
284 3300025940 Ga0207691_10146413 Ga0207691_101464132 158
285 3300025941 Ga0207711_10000025 Ga0207711_10000025135 158
286 3300025945 Ga0207679_10047566 Ga0207679_100475663 158
287 3300025961 Ga0207712_10002020 Ga0207712_100020208 158
288 3300025972 Ga0207668_10436620 Ga0207668_104366202 158
289 3300025986 Ga0207658_10000652 Ga0207658_1000065226 158
290 3300026075 Ga0207708_11133350 Ga0207708_111333502 158
291 3300026088 Ga0207641_10000002 Ga0207641_1000000249 158
292 3300026095 Ga0207676_10000044 Ga0207676_10000044179 158
293 3300026121 Ga0207683_10406799 Ga0207683_104067992 158
294 3300028379 Ga0268266_10059598 Ga0268266_100595983 158
295 3300028380 Ga0268265_10000003 Ga0268265_10000003942 158
296 3300031548 Ga0307408_100194705 Ga0307408_1001947053 158
297 3300031548 Ga0307408_101646862 Ga0307408_1016468621 158
298 3300031731 Ga0307405_10028431 Ga0307405_100284313 158
299 3300031731 Ga0307405_10150063 Ga0307405_101500633 158
300 3300031731 Ga0307405_10552705 Ga0307405_105527052 158
301 3300031824 Ga0307413_10008368 Ga0307413_100083686 158
302 3300031824 Ga0307413_10019834 Ga0307413_100198344 158
303 3300031824 Ga0307413_10098545 Ga0307413_100985452 158
304 3300031824 Ga0307413_10301447 Ga0307413_103014472 158
305 3300031824 Ga0307413_10673745 Ga0307413_106737451 158
306 3300031824 Ga0307413_10912467 Ga0307413_109124671 158
307 3300031824 Ga0307413_11242819 Ga0307413_112428191 158
308 3300031852 Ga0307410_10025207 Ga0307410_100252073 158
309 3300031852 Ga0307410_10084136 Ga0307410_100841362 158
310 3300031852 Ga0307410_10085590 Ga0307410_100855902 158
311 3300031852 Ga0307410_10373037 Ga0307410_103730372 158
312 3300031852 Ga0307410_10383252 Ga0307410_103832521 158
313 3300031901 Ga0307406_10094381 Ga0307406_100943812 158
314 3300031901 Ga0307406_10501926 Ga0307406_105019262 158
315 3300031901 Ga0307406_10995290 Ga0307406_109952901 158
316 3300031903 Ga0307407_10032176 Ga0307407_100321761 158
317 3300031911 Ga0307412_10019162 Ga0307412_100191624 158
318 3300031911 Ga0307412_10159729 Ga0307412_101597293 158
319 3300031911 Ga0307412_10281660 Ga0307412_102816602 158
320 3300031911 Ga0307412_11957780 Ga0307412_119577801 158
321 3300031995 Ga0307409_100035151 Ga0307409_1000351515 158
322 3300031995 Ga0307409_100082523 Ga0307409_1000825233 158
323 3300031995 Ga0307409_100224574 Ga0307409_1002245743 158
324 3300031995 Ga0307409_101603533 Ga0307409_1016035331 158
325 3300031995 Ga0307409_101761104 Ga0307409_1017611041 158
326 3300032002 Ga0307416_100014578 Ga0307416_1000145785 158
327 3300032002 Ga0307416_100431452 Ga0307416_1004314522 158
328 3300032002 Ga0307416_100758892 Ga0307416_1007588922 158
329 3300032004 Ga0307414_10036346 Ga0307414_100363465 158
330 3300032004 Ga0307414_10103770 Ga0307414_101037704 158
331 3300032004 Ga0307414_10224063 Ga0307414_102240633 158
332 3300032004 Ga0307414_10280604 Ga0307414_102806041 158
333 3300032004 Ga0307414_10412048 Ga0307414_104120481 158
334 3300032004 Ga0307414_10622484 Ga0307414_106224842 158
335 3300032005 Ga0307411_10006109 Ga0307411_100061093 158
336 3300032005 Ga0307411_10068716 Ga0307411_100687163 158
337 3300032005 Ga0307411_10314463 Ga0307411_103144633 158
338 3300032005 Ga0307411_10938321 Ga0307411_109383212 158
339 3300032005 Ga0307411_11334248 Ga0307411_113342481 158
340 3300032126 Ga0307415_100211123 Ga0307415_1002111233 158
341 3300032126 Ga0307415_100299510 Ga0307415_1002995102 158
342 3300032126 Ga0307415_101098592 Ga0307415_1010985922 158
343 3300041512 Ga0451853_0923419 Ga0451853_0923419_1400_1879 158
344 3300042007 Ga0439449_0050857 Ga0439449_0050857_90_581 158
345 3300042015 Ga0439462_0001137 Ga0439462_0001137_4230_4715 158
346 3300042122 Ga0450920_007756 Ga0450920_007756_1439_1930 158
347 3300046515 Ga0495620_0282838 Ga0495620_0282838_67_549 158
348 3300046691 Ga0495670_0018541 Ga0495670_0018541_885_1367 158
349 3300048090 Ga0495615_0175908 Ga0495615_0175908_54_536 158
350 3300048906 Ga0496103_0023096 Ga0496103_0023096_592_1068 158
351 3300048920 Ga0496117_0010397 Ga0496117_0010397_4385_4861 158
352 3300048921 Ga0496118_0002436 Ga0496118_0002436_6377_6853 158
353 3300049571 Ga0501034_0002424 Ga0501034_0002424_2278_2766 158
354 3300053083 Ga0495655_0160542 Ga0495655_0160542_91_573 158

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

30

159

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
8es5-assembly1.cif.gz_B aha1 domain protein from pseudomonas aeruginosa 0.9062 1 155
3q6a-assembly1.cif.gz_A x-ray crystal structure of the protein ssp2350 from staphylococcus saprophyticus, northeast structural genomics consortium target syr116 0.9003 3 153
3q6a-assembly1.cif.gz_D x-ray crystal structure of the protein ssp2350 from staphylococcus saprophyticus, northeast structural genomics consortium target syr116 0.8916 3 153
6v04-assembly1.cif.gz_A dynu16 crystal structure, a putative protein in the dynemicin biosynthetic locus 0.8882 4 149
3q63-assembly2.cif.gz_D x-ray crystal structure of protein mll2253 from mesorhizobium loti, northeast structural genomics consortium target mlr404. 0.8632 3 143
ID Description Score Start End Superfamily
3q6aA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.886 6 153 3.30.530.20
2nn5A00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8597 2 149 3.30.530.20
3q63F00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8559 2 143 3.30.530.20
af_O53773_104_241_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8549 5 149 3.30.530.20
af_Q8N9S3_197_326_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8455 1 147 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A1Q3JP40-F1-model_v4 ATPase 0.9638 1 155
AF-A0A7T9FY88-F1-model_v4 deleted 0.9602 1 155
AF-A0A6I7LXQ3-F1-model_v4 Activator of Hsp90 ATPase 1 family protein 0.9526 1 157
AF-A0A085ER11-F1-model_v4 Activator of Hsp90 ATPase 1-like protein 0.9467 1 158
AF-A0A0D6L765-F1-model_v4 Activator of Hsp90 ATPase homologue 1/2-like C-terminal domain-containing protein 0.9453 1 153

Feature Viewer

pLDDT pTM Quality
92.05 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map