F419685

General Info

Members Datasets Scaffolds Average Seq Length
354 189 354 83

Family's Representative Sequence

Representative Sequence 3300005578|Ga0068854_101068934|Ga0068854_1010689342
Length 83
Sequence MKVRYFAWMKRTVGVAEEQVEPPADVRTVADLVTWLRTRSGGHAEALAEGAAFGAAVDHRTAPFDTPLTGAEEVAFFPPFTGG

Samples

Sample ID Description Type Environment
1 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
34 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
35 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
36 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
37 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
38 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
66 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
67 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
110 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
111 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
112 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
113 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
114 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
115 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
116 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
117 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
118 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
119 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
120 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
121 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
122 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
123 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
124 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
125 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
126 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
127 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
128 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
129 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
130 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
131 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
133 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
134 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
135 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
136 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
137 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
138 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
139 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
140 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
141 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
142 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
143 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
144 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
145 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
146 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
147 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
148 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
149 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
150 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
151 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
152 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
153 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
154 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
155 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
156 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
157 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
158 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
171 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
172 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
173 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
174 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
175 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
176 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
179 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
180 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
181 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
182 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
183 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
184 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
185 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
186 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
187 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
188 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
189 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.8
Nodule 0
Rhizoplane 1.69
Rhizosphere 90.96
Stem 0
Stem Tuber 0
Unclassified 2.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25405J52794_10164680 3300003911 Bacteria 508
2 Ga0070658_10009004 3300005327 Bacteria 8026
3 Ga0070658_10200296 3300005327 Bacteria 1684
4 Ga0070658_10340578 3300005327 Bacteria 1282
5 Ga0070658_11035023 3300005327 Bacteria 714
6 Ga0070658_11121662 3300005327 Bacteria 684
7 Ga0070676_10365148 3300005328 Bacteria 996
8 Ga0070676_10459473 3300005328 Bacteria 897
9 Ga0070670_101751404 3300005331 Bacteria 572
10 Ga0070666_10864004 3300005335 Bacteria 668
11 Ga0070680_100707020 3300005336 Bacteria 867
12 Ga0068868_100339660 3300005338 Bacteria 1284
13 Ga0070660_100013616 3300005339 Bacteria 5843
14 Ga0070660_100023063 3300005339 Bacteria 4608
15 Ga0070660_100205191 3300005339 Bacteria 1599
16 Ga0070660_100232958 3300005339 Bacteria 1498
17 Ga0070660_100972485 3300005339 Bacteria 717
18 Ga0070691_10650356 3300005341 Bacteria 627
19 Ga0070661_100043785 3300005344 Bacteria 3270
20 Ga0070661_100056721 3300005344 Bacteria 2870
21 Ga0070661_100120178 3300005344 Bacteria 1967
22 Ga0070668_100079275 3300005347 Bacteria 2571
23 Ga0070668_100152277 3300005347 Bacteria 1871
24 Ga0070669_101263993 3300005353 Bacteria 639
25 Ga0070675_100468171 3300005354 Bacteria 1132
26 Ga0070674_100006232 3300005356 Bacteria 6941
27 Ga0070673_101227869 3300005364 Bacteria 703
28 Ga0070659_100078196 3300005366 Bacteria 2639
29 Ga0070659_100140552 3300005366 Bacteria 1966
30 Ga0070663_100198929 3300005455 Bacteria 1563
31 Ga0070678_100063442 3300005456 Bacteria 2734
32 Ga0070678_100254962 3300005456 Bacteria 1472
33 Ga0070662_100439812 3300005457 Bacteria 1081
34 Ga0070681_10402686 3300005458 Bacteria 1280
35 Ga0068867_100088670 3300005459 Bacteria 2345
36 Ga0070679_100310059 3300005530 Bacteria 1528
37 Ga0068853_100000881 3300005539 Bacteria 20956
38 Ga0070665_100050501 3300005548 Bacteria 4173
39 Ga0070665_100069291 3300005548 Bacteria 3535
40 Ga0070665_100156228 3300005548 Bacteria 2283
41 Ga0070665_100276432 3300005548 Bacteria 1681
42 Ga0070665_101516993 3300005548 Bacteria 679
43 Ga0068855_100315691 3300005563 Bacteria 1728
44 Ga0068855_100675121 3300005563 Bacteria 1107
45 Ga0068855_100861262 3300005563 Bacteria 959
46 Ga0068855_101656283 3300005563 Bacteria 653
47 Ga0070664_100140272 3300005564 Bacteria 2128
48 Ga0068857_100074112 3300005577 Bacteria 3033
49 Ga0068854_100113296 3300005578 Bacteria 2049
50 Ga0068854_101068934 3300005578 Bacteria 718
51 Ga0068856_100021310 3300005614 Bacteria 6298
52 Ga0068856_100154142 3300005614 Bacteria 2307
53 Ga0068856_101061754 3300005614 Bacteria 828
54 Ga0068856_101165864 3300005614 Bacteria 787
55 Ga0068852_100003738 3300005616 Bacteria 10675
56 Ga0068852_100029913 3300005616 Bacteria 4478
57 Ga0068852_100542699 3300005616 Bacteria 1162
58 Ga0068852_101098435 3300005616 Bacteria 815
59 Ga0068859_101010164 3300005617 Bacteria 914
60 Ga0068861_100050234 3300005719 Bacteria 3161
61 Ga0068851_10388246 3300005834 Bacteria 819
62 Ga0068870_10515190 3300005840 Bacteria 799
63 Ga0075362_10031010 3300006177 Bacteria 2312
64 Ga0075367_10134145 3300006178 Bacteria 1531
65 Ga0075367_10752358 3300006178 Bacteria 620
66 Ga0075369_10416478 3300006186 Bacteria 634
67 Ga0075366_10022514 3300006195 Bacteria 3666
68 Ga0097621_100734696 3300006237 Unclassified 911
69 Ga0075370_10368568 3300006353 Bacteria 859
70 Ga0068871_100291604 3300006358 Bacteria 1430
71 Ga0075428_102345203 3300006844 Bacteria 549
72 Ga0068865_100148452 3300006881 Bacteria 1776
73 Ga0068865_100335288 3300006881 Bacteria 1221
74 Ga0097620_101010189 3300006931 Bacteria 914
75 Ga0105240_10099279 3300009093 Bacteria 3543
76 Ga0105240_12352727 3300009093 Unclassified 552
77 Ga0111539_10897952 3300009094 Bacteria 1031
78 Ga0105245_10414503 3300009098 Bacteria 1349
79 Ga0105245_10738275 3300009098 Bacteria 1020
80 Ga0105245_12191654 3300009098 Bacteria 606
81 Ga0105241_10262634 3300009174 Bacteria 1468
82 Ga0105241_10283394 3300009174 Bacteria 1416
83 Ga0105241_10551005 3300009174 Bacteria 1035
84 Ga0105241_11560495 3300009174 Bacteria 637
85 Ga0105241_11641714 3300009174 Bacteria 623
86 Ga0105242_11444995 3300009176 Bacteria 717
87 Ga0105237_10001389 3300009545 Bacteria 31975
88 Ga0105237_10516114 3300009545 Bacteria 1201
89 Ga0105237_10758802 3300009545 Unclassified 977
90 Ga0105237_11449702 3300009545 Bacteria 693
91 Ga0105238_10125572 3300009551 Bacteria 2545
92 Ga0105238_10314176 3300009551 Bacteria 1552
93 Ga0105238_10690903 3300009551 Unclassified 1032
94 Ga0105238_10729504 3300009551 Bacteria 1004
95 Ga0105238_12048375 3300009551 Bacteria 606
96 Ga0105238_12493194 3300009551 Bacteria 553
97 Ga0105239_10001103 3300010375 Bacteria 37309
98 Ga0105239_10358999 3300010375 Bacteria 1645
99 Ga0105239_11414855 3300010375 Bacteria 803
100 Ga0105239_13395157 3300010375 Unclassified 518
101 Ga0105246_10319550 3300011119 Bacteria 1261
102 Ga0105246_10359105 3300011119 Bacteria 1196
103 Ga0105246_11284519 3300011119 Bacteria 678
104 Ga0157373_10712576 3300013100 Bacteria 736
105 Ga0157371_10080515 3300013102 Bacteria 2306
106 Ga0157370_10178362 3300013104 Bacteria 1975
107 Ga0157370_10237603 3300013104 Bacteria 1686
108 Ga0157370_10468534 3300013104 Bacteria 1158
109 Ga0157370_10949627 3300013104 Bacteria 779
110 Ga0157370_11096577 3300013104 Bacteria 719
111 Ga0157370_11187993 3300013104 Bacteria 688
112 Ga0157369_10137109 3300013105 Bacteria 2590
113 Ga0157369_10184181 3300013105 Bacteria 2196
114 Ga0157369_10722534 3300013105 Bacteria 1025
115 Ga0157374_10425171 3300013296 Bacteria 1327
116 Ga0157374_10501784 3300013296 Bacteria 1218
117 Ga0157374_12286043 3300013296 Bacteria 568
118 Ga0157378_10026321 3300013297 Bacteria 5128
119 Ga0157378_10441003 3300013297 Bacteria 1291
120 Ga0157378_11320867 3300013297 Bacteria 763
121 Ga0163162_12677149 3300013306 Bacteria 574
122 Ga0157375_10753096 3300013308 Bacteria 1125
123 Ga0157375_12813351 3300013308 Bacteria 582
124 Ga0157380_12121089 3300014326 Bacteria 625
125 Ga0182008_10449276 3300014497 Bacteria 700
126 Ga0157376_11146075 3300014969 Bacteria 804
127 Ga0207427_102200 3300025231 Bacteria 5523
128 Ga0209233_1000911 3300025261 Bacteria 12899
129 Ga0207697_10084493 3300025315 Bacteria 1340
130 Ga0207656_10171811 3300025321 Bacteria 1036
131 Ga0207688_10062508 3300025901 Bacteria 2099
132 Ga0207688_10278243 3300025901 Bacteria 1019
133 Ga0207680_10285108 3300025903 Bacteria 1148
134 Ga0207647_10307553 3300025904 Bacteria 902
135 Ga0207645_10512221 3300025907 Bacteria 813
136 Ga0207645_10698804 3300025907 Bacteria 689
137 Ga0207643_10348448 3300025908 Bacteria 929
138 Ga0207705_10002855 3300025909 Bacteria 13220
139 Ga0207705_10031214 3300025909 Bacteria 3801
140 Ga0207705_10042342 3300025909 Bacteria 3269
141 Ga0207705_11290678 3300025909 Bacteria 558
142 Ga0207654_10115453 3300025911 Bacteria 1677
143 Ga0207654_10476278 3300025911 Bacteria 879
144 Ga0207671_10001115 3300025914 Bacteria 32386
145 Ga0207671_11413135 3300025914 Bacteria 539
146 Ga0207657_10007473 3300025919 Bacteria 11196
147 Ga0207657_10014832 3300025919 Bacteria 7586
148 Ga0207657_10045799 3300025919 Bacteria 3835
149 Ga0207657_10110415 3300025919 Bacteria 2271
150 Ga0207657_11013170 3300025919 Bacteria 637
151 Ga0207649_10072073 3300025920 Bacteria 2209
152 Ga0207649_10165654 3300025920 Bacteria 1535
153 Ga0207649_10348931 3300025920 Bacteria 1095
154 Ga0207652_11482671 3300025921 Bacteria 582
155 Ga0207681_10274313 3300025923 Bacteria 1325
156 Ga0207694_10859845 3300025924 Bacteria 766
157 Ga0207694_11847302 3300025924 Bacteria 507
158 Ga0207650_11390496 3300025925 Bacteria 597
159 Ga0207659_10030537 3300025926 Bacteria 3683
160 Ga0207687_11325352 3300025927 Bacteria 619
161 Ga0207687_11369424 3300025927 Bacteria 608
162 Ga0207690_10896465 3300025932 Bacteria 735
163 Ga0207706_10086499 3300025933 Bacteria 2755
164 Ga0207706_10374546 3300025933 Bacteria 1236
165 Ga0207669_10009149 3300025937 Bacteria 4701
166 Ga0207704_10129137 3300025938 Bacteria 1746
167 Ga0207704_10158019 3300025938 Bacteria 1609
168 Ga0207704_11694618 3300025938 Bacteria 543
169 Ga0207661_10289958 3300025944 Bacteria 1465
170 Ga0207679_10224956 3300025945 Bacteria 1580
171 Ga0207667_10020598 3300025949 Bacteria 7328
172 Ga0207667_10562774 3300025949 Bacteria 1152
173 Ga0207667_11627840 3300025949 Bacteria 614
174 Ga0207668_10099979 3300025972 Bacteria 2153
175 Ga0207640_10298039 3300025981 Bacteria 1274
176 Ga0207640_10425066 3300025981 Bacteria 1088
177 Ga0207640_10763350 3300025981 Bacteria 835
178 Ga0207640_10984652 3300025981 Bacteria 741
179 Ga0207677_10208764 3300026023 Bacteria 1558
180 Ga0207677_12030757 3300026023 Bacteria 534
181 Ga0207639_10004936 3300026041 Bacteria 8985
182 Ga0207639_10127374 3300026041 Bacteria 2102
183 Ga0207639_10381707 3300026041 Bacteria 1265
184 Ga0207678_10076095 3300026067 Bacteria 2875
185 Ga0207678_10876453 3300026067 Bacteria 793
186 Ga0207678_11291713 3300026067 Bacteria 646
187 Ga0207702_10364230 3300026078 Bacteria 1386
188 Ga0207702_10802098 3300026078 Bacteria 931
189 Ga0207702_11489390 3300026078 Bacteria 670
190 Ga0207641_10954138 3300026088 Bacteria 853
191 Ga0207648_10044276 3300026089 Bacteria 3905
192 Ga0207648_10120563 3300026089 Bacteria 2306
193 Ga0207648_10802234 3300026089 Bacteria 876
194 Ga0207648_11610262 3300026089 Bacteria 610
195 Ga0207648_11843315 3300026089 Bacteria 566
196 Ga0207674_10004228 3300026116 Bacteria 17321
197 Ga0207675_100648768 3300026118 Bacteria 1062
198 Ga0207683_10085153 3300026121 Bacteria 2810
199 Ga0207683_10356853 3300026121 Bacteria 1342
200 Ga0207698_10060516 3300026142 Bacteria 2945
201 Ga0207698_11248881 3300026142 Bacteria 757
202 Ga0209983_1016448 3300027665 Bacteria 1528
203 Ga0207428_10089429 3300027907 Bacteria 2393
204 Ga0268266_10000974 3300028379 Bacteria 36355
205 Ga0268266_10107512 3300028379 Bacteria 2467
206 Ga0268266_10214036 3300028379 Bacteria 1768
207 Ga0268266_10214340 3300028379 Bacteria 1767
208 Ga0268266_11714025 3300028379 Bacteria 603
209 Ga0268265_10031217 3300028380 Bacteria 3845
210 Ga0268264_12261988 3300028381 Bacteria 551
211 Ga0265318_10007936 3300028577 Bacteria 4760
212 Ga0265320_10060412 3300031240 Bacteria 1810
213 Ga0265331_10538923 3300031250 Bacteria 526
214 Ga0265327_10011138 3300031251 Bacteria 6238
215 Ga0265316_10446515 3300031344 Bacteria 928
216 Ga0307408_102010465 3300031548 Bacteria 556
217 Ga0265314_10306937 3300031711 Bacteria 888
218 Ga0307405_10573619 3300031731 Unclassified 917
219 Ga0307405_11912197 3300031731 Bacteria 529
220 Ga0307413_10063709 3300031824 Bacteria 2287
221 Ga0307407_10327741 3300031903 Bacteria 1077
222 Ga0307407_11595562 3300031903 Unclassified 518
223 Ga0307412_11971218 3300031911 Bacteria 540
224 Ga0307409_100614751 3300031995 Bacteria 1076
225 Ga0307409_100623686 3300031995 Bacteria 1069
226 Ga0307409_101834295 3300031995 Bacteria 636
227 Ga0307409_101961092 3300031995 Bacteria 615
228 Ga0307416_101633080 3300032002 Bacteria 750
229 Ga0307414_10078972 3300032004 Bacteria 2400
230 Ga0307414_10079623 3300032004 Bacteria 2392
231 Ga0307414_10348115 3300032004 Bacteria 1271
232 Ga0307411_11145282 3300032005 Bacteria 703
233 Ga0307415_101408528 3300032126 Bacteria 664
234 Ga0373950_0036963 3300034818 Unclassified 923
235 Ga0373949_0154347 3300035090 Unclassified 666
236 Ga0373939_0270181 3300035114 Bacteria 668
237 Ga0373941_0485359 3300035115 Bacteria 523
238 Ga0373942_0316150 3300035207 Bacteria 545
239 Ga0373931_0024848 3300035691 Bacteria 3040
240 Ga0373925_0172944 3300037068 Bacteria 1706
241 Ga0395899_0006011 3300037312 Bacteria 9422
242 Ga0395899_0234525 3300037312 Bacteria 1265
243 Ga0395899_0697349 3300037312 Bacteria 637
244 Ga0395900_0123599 3300037418 Bacteria 2654
245 Ga0395900_0168700 3300037418 Bacteria 2229
246 Ga0395900_0186014 3300037418 Bacteria 2108
247 Ga0395900_0668829 3300037418 Bacteria 974
248 Ga0395900_1116675 3300037418 Bacteria 705
249 Ga0395900_1926419 3300037418 Unclassified 501
250 Ga0395898_0001251 3300037466 Bacteria 37818
251 Ga0395898_0077433 3300037466 Bacteria 3210
252 Ga0395898_0222902 3300037466 Bacteria 1798
253 Ga0395898_0746577 3300037466 Bacteria 920
254 Ga0395898_0928724 3300037466 Bacteria 808
255 Ga0395905_1556725 3300037471 Bacteria 566
256 Ga0395901_0050692 3300038443 Bacteria 4311
257 Ga0395901_0096554 3300038443 Bacteria 3097
258 Ga0395901_0261621 3300038443 Unclassified 1801
259 Ga0395901_0384220 3300038443 Unclassified 1445
260 Ga0395901_0385646 3300038443 Bacteria 1441
261 Ga0395901_1597772 3300038443 Bacteria 605
262 Ga0395901_1630195 3300038443 Bacteria 598
263 Ga0439436_0102068 3300041404 Bacteria 800
264 Ga0439439_0275432 3300041406 Unclassified 503
265 Ga0439461_0154847 3300041410 Bacteria 594
266 Ga0439465_0060371 3300041413 Bacteria 1256
267 Ga0451791_0602820 3300041451 Bacteria 538
268 Ga0451797_0979737 3300041453 Unclassified 602
269 Ga0451802_0576375 3300041460 Bacteria 611
270 Ga0439441_124756 3300042001 Bacteria 593
271 Ga0466965_0060835 3300044683 Bacteria 1887
272 Ga0495599_0784314 3300046678 Unclassified 545
273 Ga0495686_0233079 3300047472 Bacteria 1041
274 Ga0496106_1391631 3300048909 Bacteria 542
275 Ga0496108_1354933 3300048911 Unclassified 597
276 Ga0496111_0074712 3300048914 Bacteria 2469
277 Ga0496118_0236401 3300048921 Bacteria 1050
278 Ga0496118_0461480 3300048921 Bacteria 642
279 Ga0496119_0035737 3300048922 Bacteria 3251
280 Ga0496121_0201371 3300048924 Bacteria 1419
281 Ga0496121_0346954 3300048924 Unclassified 990
282 Ga0496123_0082334 3300048926 Bacteria 1952
283 Ga0496124_0378833 3300048927 Bacteria 990
284 Ga0496125_0000430 3300048928 Bacteria 77339
285 Ga0496126_0230258 3300048929 Bacteria 1553
286 Ga0501031_0039402 3300049568 Bacteria 3083
287 Ga0501031_0042253 3300049568 Bacteria 2976
288 Ga0501031_0922931 3300049568 Bacteria 559
289 Ga0501032_0063983 3300049569 Bacteria 2462
290 Ga0501033_0055391 3300049570 Bacteria 2932
291 Ga0501033_0063313 3300049570 Bacteria 2722
292 Ga0501034_0014348 3300049571 Bacteria 8163
293 Ga0501034_0029990 3300049571 Bacteria 5528
294 Ga0501034_0056171 3300049571 Bacteria 3962
295 Ga0501034_0061630 3300049571 Bacteria 3766
296 Ga0501034_0135182 3300049571 Bacteria 2446
297 Ga0501034_0173704 3300049571 Bacteria 2121
298 Ga0501034_0179731 3300049571 Bacteria 2081
299 Ga0501034_0302707 3300049571 Bacteria 1535
300 Ga0501034_0359873 3300049571 Bacteria 1382
301 Ga0501034_0476843 3300049571 Bacteria 1163
302 Ga0501034_0531017 3300049571 Bacteria 1087
303 Ga0501034_1317004 3300049571 Bacteria 599
304 Ga0501034_1338969 3300049571 Bacteria 592
305 Ga0501036_0086335 3300049572 Bacteria 2652
306 Ga0501037_0010816 3300049573 Bacteria 6704
307 Ga0501037_0065234 3300049573 Bacteria 2653
308 Ga0501037_0168887 3300049573 Bacteria 1556
309 Ga0501038_0017457 3300049574 Bacteria 6487
310 Ga0501038_0368454 3300049574 Bacteria 1116
311 Ga0501038_0557580 3300049574 Bacteria 871
312 Ga0501039_0106522 3300049575 Bacteria 2189
313 Ga0501039_1379601 3300049575 Bacteria 543
314 Ga0501043_0016762 3300049579 Bacteria 5742
315 Ga0501043_0129180 3300049579 Bacteria 1980
316 Ga0501043_0340657 3300049579 Bacteria 1141
317 Ga0501043_1018414 3300049579 Bacteria 589
318 Ga0501046_0167877 3300049580 Bacteria 1648
319 Ga0501047_0021068 3300049581 Bacteria 6259
320 Ga0501047_0111572 3300049581 Bacteria 2617
321 Ga0501047_0410435 3300049581 Bacteria 1187
322 Ga0501047_1257439 3300049581 Bacteria 554
323 Ga0501048_0506453 3300049582 Bacteria 866
324 Ga0501069_0326330 3300049585 Bacteria 902
325 Ga0501070_0061428 3300049586 Bacteria 3113
326 Ga0501070_0187797 3300049586 Bacteria 1699
327 Ga0501070_0222523 3300049586 Bacteria 1547
328 Ga0501073_0357456 3300049589 Bacteria 1009
329 Ga0501073_0890456 3300049589 Bacteria 613
330 Ga0501073_1130890 3300049589 Unclassified 538
331 Ga0501079_1039258 3300049741 Bacteria 645
332 Ga0501080_1098451 3300049742 Bacteria 687
333 Ga0501080_1435517 3300049742 Bacteria 588
334 Ga0501083_0790638 3300049744 Bacteria 617
335 Ga0501035_0035268 3300049822 Bacteria 4540
336 Ga0501035_0409875 3300049822 Bacteria 1126
337 Ga0501035_0844098 3300049822 Bacteria 729
338 Ga0501044_0151683 3300049823 Bacteria 2299
339 Ga0501044_0264626 3300049823 Bacteria 1657
340 Ga0501044_0395341 3300049823 Bacteria 1295
341 Ga0501044_0573969 3300049823 Bacteria 1023
342 Ga0501044_0840423 3300049823 Bacteria 795
343 Ga0501045_1060733 3300049824 Bacteria 593
344 nmdc:mga03683_31323_c1 3300050489 Bacteria 2133
345 nmdc:mga03n38_83189_c1 3300050490 Bacteria 1508
346 nmdc:mga06z11_155866_c1 3300050494 Bacteria 1302
347 nmdc:mga07m45_920309_c1 3300050496 Bacteria 500
348 nmdc:mga08y16_226818_c1 3300050511 Bacteria 1933
349 Ga0500650_0386014 3300053098 Unclassified 608
350 Ga0500593_280001 3300053117 Bacteria 546
351 Ga0500604_0000722 3300053151 Bacteria 9019
352 Ga0500616_0015607 3300053153 Bacteria 4339
353 Ga0500620_218964 3300053155 Bacteria 643
354 Ga0501082_0690146 3300060353 Bacteria 894

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003911 JGI25405J52794_10164680 JGI25405J52794_101646802 83
2 3300005327 Ga0070658_10009004 Ga0070658_100090041 83
3 3300005327 Ga0070658_10200296 Ga0070658_102002962 83
4 3300005327 Ga0070658_10340578 Ga0070658_103405782 83
5 3300005327 Ga0070658_11035023 Ga0070658_110350232 83
6 3300005327 Ga0070658_11121662 Ga0070658_111216621 83
7 3300005328 Ga0070676_10365148 Ga0070676_103651482 83
8 3300005328 Ga0070676_10459473 Ga0070676_104594732 83
9 3300005331 Ga0070670_101751404 Ga0070670_1017514042 83
10 3300005335 Ga0070666_10864004 Ga0070666_108640041 83
11 3300005336 Ga0070680_100707020 Ga0070680_1007070202 83
12 3300005338 Ga0068868_100339660 Ga0068868_1003396601 83
13 3300005339 Ga0070660_100013616 Ga0070660_1000136162 83
14 3300005339 Ga0070660_100023063 Ga0070660_1000230634 83
15 3300005339 Ga0070660_100205191 Ga0070660_1002051913 83
16 3300005339 Ga0070660_100232958 Ga0070660_1002329582 83
17 3300005339 Ga0070660_100972485 Ga0070660_1009724851 83
18 3300005341 Ga0070691_10650356 Ga0070691_106503562 83
19 3300005344 Ga0070661_100043785 Ga0070661_1000437853 83
20 3300005344 Ga0070661_100056721 Ga0070661_1000567213 83
21 3300005344 Ga0070661_100120178 Ga0070661_1001201783 83
22 3300005347 Ga0070668_100079275 Ga0070668_1000792754 83
23 3300005347 Ga0070668_100152277 Ga0070668_1001522774 83
24 3300005353 Ga0070669_101263993 Ga0070669_1012639932 83
25 3300005354 Ga0070675_100468171 Ga0070675_1004681712 83
26 3300005356 Ga0070674_100006232 Ga0070674_1000062325 83
27 3300005364 Ga0070673_101227869 Ga0070673_1012278692 83
28 3300005366 Ga0070659_100078196 Ga0070659_1000781963 83
29 3300005366 Ga0070659_100140552 Ga0070659_1001405522 83
30 3300005455 Ga0070663_100198929 Ga0070663_1001989292 83
31 3300005456 Ga0070678_100063442 Ga0070678_1000634423 83
32 3300005456 Ga0070678_100254962 Ga0070678_1002549622 83
33 3300005457 Ga0070662_100439812 Ga0070662_1004398122 83
34 3300005458 Ga0070681_10402686 Ga0070681_104026863 83
35 3300005459 Ga0068867_100088670 Ga0068867_1000886703 83
36 3300005530 Ga0070679_100310059 Ga0070679_1003100592 83
37 3300005539 Ga0068853_100000881 Ga0068853_1000008818 83
38 3300005548 Ga0070665_100050501 Ga0070665_1000505013 83
39 3300005548 Ga0070665_100069291 Ga0070665_1000692914 83
40 3300005548 Ga0070665_100156228 Ga0070665_1001562283 83
41 3300005548 Ga0070665_100276432 Ga0070665_1002764322 83
42 3300005548 Ga0070665_101516993 Ga0070665_1015169932 83
43 3300005563 Ga0068855_100315691 Ga0068855_1003156913 83
44 3300005563 Ga0068855_100675121 Ga0068855_1006751213 83
45 3300005563 Ga0068855_100861262 Ga0068855_1008612622 83
46 3300005563 Ga0068855_101656283 Ga0068855_1016562832 83
47 3300005564 Ga0070664_100140272 Ga0070664_1001402723 83
48 3300005577 Ga0068857_100074112 Ga0068857_1000741123 83
49 3300005578 Ga0068854_100113296 Ga0068854_1001132963 83
50 3300005578 Ga0068854_101068934 Ga0068854_1010689342 83
51 3300005614 Ga0068856_100021310 Ga0068856_1000213108 83
52 3300005614 Ga0068856_100154142 Ga0068856_1001541424 83
53 3300005614 Ga0068856_101061754 Ga0068856_1010617542 83
54 3300005614 Ga0068856_101165864 Ga0068856_1011658641 83
55 3300005616 Ga0068852_100003738 Ga0068852_1000037388 83
56 3300005616 Ga0068852_100029913 Ga0068852_1000299135 83
57 3300005616 Ga0068852_100542699 Ga0068852_1005426993 83
58 3300005616 Ga0068852_101098435 Ga0068852_1010984352 83
59 3300005617 Ga0068859_101010164 Ga0068859_1010101642 83
60 3300005719 Ga0068861_100050234 Ga0068861_1000502343 83
61 3300005834 Ga0068851_10388246 Ga0068851_103882462 83
62 3300005840 Ga0068870_10515190 Ga0068870_105151902 83
63 3300006177 Ga0075362_10031010 Ga0075362_100310102 83
64 3300006178 Ga0075367_10134145 Ga0075367_101341452 83
65 3300006178 Ga0075367_10752358 Ga0075367_107523582 83
66 3300006186 Ga0075369_10416478 Ga0075369_104164782 83
67 3300006195 Ga0075366_10022514 Ga0075366_100225143 83
68 3300006237 Ga0097621_100734696 Ga0097621_1007346962 83
69 3300006353 Ga0075370_10368568 Ga0075370_103685682 83
70 3300006358 Ga0068871_100291604 Ga0068871_1002916042 83
71 3300006844 Ga0075428_102345203 Ga0075428_1023452032 83
72 3300006881 Ga0068865_100148452 Ga0068865_1001484522 83
73 3300006881 Ga0068865_100335288 Ga0068865_1003352882 83
74 3300006931 Ga0097620_101010189 Ga0097620_1010101892 83
75 3300009093 Ga0105240_10099279 Ga0105240_100992794 83
76 3300009093 Ga0105240_12352727 Ga0105240_123527272 83
77 3300009094 Ga0111539_10897952 Ga0111539_108979522 83
78 3300009098 Ga0105245_10414503 Ga0105245_104145032 83
79 3300009098 Ga0105245_10738275 Ga0105245_107382752 83
80 3300009098 Ga0105245_12191654 Ga0105245_121916541 83
81 3300009174 Ga0105241_10262634 Ga0105241_102626343 83
82 3300009174 Ga0105241_10283394 Ga0105241_102833942 83
83 3300009174 Ga0105241_10551005 Ga0105241_105510052 83
84 3300009174 Ga0105241_11560495 Ga0105241_115604951 83
85 3300009174 Ga0105241_11641714 Ga0105241_116417141 83
86 3300009176 Ga0105242_11444995 Ga0105242_114449952 83
87 3300009545 Ga0105237_10001389 Ga0105237_1000138941 83
88 3300009545 Ga0105237_10516114 Ga0105237_105161142 83
89 3300009545 Ga0105237_10758802 Ga0105237_107588022 83
90 3300009545 Ga0105237_11449702 Ga0105237_114497022 83
91 3300009551 Ga0105238_10125572 Ga0105238_101255723 83
92 3300009551 Ga0105238_10314176 Ga0105238_103141761 83
93 3300009551 Ga0105238_10690903 Ga0105238_106909033 83
94 3300009551 Ga0105238_10729504 Ga0105238_107295042 83
95 3300009551 Ga0105238_12048375 Ga0105238_120483752 83
96 3300009551 Ga0105238_12493194 Ga0105238_124931942 83
97 3300010375 Ga0105239_10001103 Ga0105239_1000110347 83
98 3300010375 Ga0105239_10358999 Ga0105239_103589993 83
99 3300010375 Ga0105239_11414855 Ga0105239_114148552 83
100 3300010375 Ga0105239_13395157 Ga0105239_133951571 83
101 3300011119 Ga0105246_10319550 Ga0105246_103195502 83
102 3300011119 Ga0105246_10359105 Ga0105246_103591052 83
103 3300011119 Ga0105246_11284519 Ga0105246_112845192 83
104 3300013100 Ga0157373_10712576 Ga0157373_107125762 83
105 3300013102 Ga0157371_10080515 Ga0157371_100805153 83
106 3300013104 Ga0157370_10178362 Ga0157370_101783624 83
107 3300013104 Ga0157370_10237603 Ga0157370_102376034 83
108 3300013104 Ga0157370_10468534 Ga0157370_104685342 83
109 3300013104 Ga0157370_10949627 Ga0157370_109496272 83
110 3300013104 Ga0157370_11096577 Ga0157370_110965772 83
111 3300013104 Ga0157370_11187993 Ga0157370_111879932 83
112 3300013105 Ga0157369_10137109 Ga0157369_101371094 83
113 3300013105 Ga0157369_10184181 Ga0157369_101841814 83
114 3300013105 Ga0157369_10722534 Ga0157369_107225342 83
115 3300013296 Ga0157374_10425171 Ga0157374_104251712 83
116 3300013296 Ga0157374_10501784 Ga0157374_105017842 83
117 3300013296 Ga0157374_12286043 Ga0157374_122860432 83
118 3300013297 Ga0157378_10026321 Ga0157378_100263215 83
119 3300013297 Ga0157378_10441003 Ga0157378_104410031 83
120 3300013297 Ga0157378_11320867 Ga0157378_113208672 83
121 3300013306 Ga0163162_12677149 Ga0163162_126771492 83
122 3300013308 Ga0157375_10753096 Ga0157375_107530962 83
123 3300013308 Ga0157375_12813351 Ga0157375_128133512 83
124 3300014326 Ga0157380_12121089 Ga0157380_121210892 83
125 3300014497 Ga0182008_10449276 Ga0182008_104492762 83
126 3300014969 Ga0157376_11146075 Ga0157376_111460752 83
127 3300025231 Ga0207427_102200 Ga0207427_1022007 83
128 3300025261 Ga0209233_1000911 Ga0209233_10009114 83
129 3300025315 Ga0207697_10084493 Ga0207697_100844931 83
130 3300025321 Ga0207656_10171811 Ga0207656_101718112 83
131 3300025901 Ga0207688_10062508 Ga0207688_100625084 83
132 3300025901 Ga0207688_10278243 Ga0207688_102782432 83
133 3300025903 Ga0207680_10285108 Ga0207680_102851082 83
134 3300025904 Ga0207647_10307553 Ga0207647_103075532 83
135 3300025907 Ga0207645_10512221 Ga0207645_105122212 83
136 3300025907 Ga0207645_10698804 Ga0207645_106988042 83
137 3300025908 Ga0207643_10348448 Ga0207643_103484482 83
138 3300025909 Ga0207705_10002855 Ga0207705_100028556 83
139 3300025909 Ga0207705_10031214 Ga0207705_100312145 83
140 3300025909 Ga0207705_10042342 Ga0207705_100423425 83
141 3300025909 Ga0207705_11290678 Ga0207705_112906782 83
142 3300025911 Ga0207654_10115453 Ga0207654_101154533 83
143 3300025911 Ga0207654_10476278 Ga0207654_104762782 83
144 3300025914 Ga0207671_10001115 Ga0207671_1000111528 83
145 3300025914 Ga0207671_11413135 Ga0207671_114131352 83
146 3300025919 Ga0207657_10007473 Ga0207657_100074732 83
147 3300025919 Ga0207657_10014832 Ga0207657_100148323 83
148 3300025919 Ga0207657_10045799 Ga0207657_100457992 83
149 3300025919 Ga0207657_10110415 Ga0207657_101104154 83
150 3300025919 Ga0207657_11013170 Ga0207657_110131702 83
151 3300025920 Ga0207649_10072073 Ga0207649_100720733 83
152 3300025920 Ga0207649_10165654 Ga0207649_101656543 83
153 3300025920 Ga0207649_10348931 Ga0207649_103489312 83
154 3300025921 Ga0207652_11482671 Ga0207652_114826712 83
155 3300025923 Ga0207681_10274313 Ga0207681_102743132 83
156 3300025924 Ga0207694_10859845 Ga0207694_108598452 83
157 3300025924 Ga0207694_11847302 Ga0207694_118473022 83
158 3300025925 Ga0207650_11390496 Ga0207650_113904962 83
159 3300025926 Ga0207659_10030537 Ga0207659_100305375 83
160 3300025927 Ga0207687_11325352 Ga0207687_113253522 83
161 3300025927 Ga0207687_11369424 Ga0207687_113694242 83
162 3300025932 Ga0207690_10896465 Ga0207690_108964652 83
163 3300025933 Ga0207706_10086499 Ga0207706_100864993 83
164 3300025933 Ga0207706_10374546 Ga0207706_103745462 83
165 3300025937 Ga0207669_10009149 Ga0207669_100091492 83
166 3300025938 Ga0207704_10129137 Ga0207704_101291372 83
167 3300025938 Ga0207704_10158019 Ga0207704_101580192 83
168 3300025938 Ga0207704_11694618 Ga0207704_116946182 83
169 3300025944 Ga0207661_10289958 Ga0207661_102899584 83
170 3300025945 Ga0207679_10224956 Ga0207679_102249562 83
171 3300025949 Ga0207667_10020598 Ga0207667_100205983 83
172 3300025949 Ga0207667_10562774 Ga0207667_105627742 83
173 3300025949 Ga0207667_11627840 Ga0207667_116278402 83
174 3300025972 Ga0207668_10099979 Ga0207668_100999794 83
175 3300025981 Ga0207640_10298039 Ga0207640_102980392 83
176 3300025981 Ga0207640_10425066 Ga0207640_104250662 83
177 3300025981 Ga0207640_10763350 Ga0207640_107633502 83
178 3300025981 Ga0207640_10984652 Ga0207640_109846522 83
179 3300026023 Ga0207677_10208764 Ga0207677_102087642 83
180 3300026023 Ga0207677_12030757 Ga0207677_120307572 83
181 3300026041 Ga0207639_10004936 Ga0207639_100049368 83
182 3300026041 Ga0207639_10127374 Ga0207639_101273742 83
183 3300026041 Ga0207639_10381707 Ga0207639_103817072 83
184 3300026067 Ga0207678_10076095 Ga0207678_100760954 83
185 3300026067 Ga0207678_10876453 Ga0207678_108764532 83
186 3300026067 Ga0207678_11291713 Ga0207678_112917132 83
187 3300026078 Ga0207702_10364230 Ga0207702_103642303 83
188 3300026078 Ga0207702_10802098 Ga0207702_108020982 83
189 3300026078 Ga0207702_11489390 Ga0207702_114893902 83
190 3300026088 Ga0207641_10954138 Ga0207641_109541382 83
191 3300026089 Ga0207648_10044276 Ga0207648_100442763 83
192 3300026089 Ga0207648_10120563 Ga0207648_101205634 83
193 3300026089 Ga0207648_10802234 Ga0207648_108022342 83
194 3300026089 Ga0207648_11610262 Ga0207648_116102621 83
195 3300026089 Ga0207648_11843315 Ga0207648_118433152 83
196 3300026116 Ga0207674_10004228 Ga0207674_1000422821 83
197 3300026118 Ga0207675_100648768 Ga0207675_1006487682 83
198 3300026121 Ga0207683_10085153 Ga0207683_100851533 83
199 3300026121 Ga0207683_10356853 Ga0207683_103568533 83
200 3300026142 Ga0207698_10060516 Ga0207698_100605163 83
201 3300026142 Ga0207698_11248881 Ga0207698_112488812 83
202 3300027665 Ga0209983_1016448 Ga0209983_10164483 83
203 3300027907 Ga0207428_10089429 Ga0207428_100894293 83
204 3300028379 Ga0268266_10000974 Ga0268266_100009742 83
205 3300028379 Ga0268266_10107512 Ga0268266_101075123 83
206 3300028379 Ga0268266_10214036 Ga0268266_102140362 83
207 3300028379 Ga0268266_10214340 Ga0268266_102143402 83
208 3300028379 Ga0268266_11714025 Ga0268266_117140252 83
209 3300028380 Ga0268265_10031217 Ga0268265_100312174 83
210 3300028381 Ga0268264_12261988 Ga0268264_122619881 83
211 3300028577 Ga0265318_10007936 Ga0265318_100079361 83
212 3300031240 Ga0265320_10060412 Ga0265320_100604122 83
213 3300031250 Ga0265331_10538923 Ga0265331_105389232 83
214 3300031251 Ga0265327_10011138 Ga0265327_100111384 83
215 3300031344 Ga0265316_10446515 Ga0265316_104465152 83
216 3300031548 Ga0307408_102010465 Ga0307408_1020104652 83
217 3300031711 Ga0265314_10306937 Ga0265314_103069371 83
218 3300031731 Ga0307405_10573619 Ga0307405_105736192 83
219 3300031731 Ga0307405_11912197 Ga0307405_119121972 83
220 3300031824 Ga0307413_10063709 Ga0307413_100637093 83
221 3300031903 Ga0307407_10327741 Ga0307407_103277412 83
222 3300031903 Ga0307407_11595562 Ga0307407_115955622 83
223 3300031911 Ga0307412_11971218 Ga0307412_119712182 83
224 3300031995 Ga0307409_100614751 Ga0307409_1006147512 83
225 3300031995 Ga0307409_100623686 Ga0307409_1006236862 83
226 3300031995 Ga0307409_101834295 Ga0307409_1018342951 83
227 3300031995 Ga0307409_101961092 Ga0307409_1019610922 83
228 3300032002 Ga0307416_101633080 Ga0307416_1016330802 83
229 3300032004 Ga0307414_10078972 Ga0307414_100789724 83
230 3300032004 Ga0307414_10079623 Ga0307414_100796232 83
231 3300032004 Ga0307414_10348115 Ga0307414_103481152 83
232 3300032005 Ga0307411_11145282 Ga0307411_111452822 83
233 3300032126 Ga0307415_101408528 Ga0307415_1014085282 83
234 3300034818 Ga0373950_0036963 Ga0373950_0036963_302_553 83
235 3300035090 Ga0373949_0154347 Ga0373949_0154347_354_605 83
236 3300035114 Ga0373939_0270181 Ga0373939_0270181_277_528 83
237 3300035115 Ga0373941_0485359 Ga0373941_0485359_144_395 83
238 3300035207 Ga0373942_0316150 Ga0373942_0316150_150_401 83
239 3300035691 Ga0373931_0024848 Ga0373931_0024848_2750_3001 83
240 3300037068 Ga0373925_0172944 Ga0373925_0172944_1349_1600 83
241 3300037312 Ga0395899_0006011 Ga0395899_0006011_6325_6576 83
242 3300037312 Ga0395899_0234525 Ga0395899_0234525_34_342 83
243 3300037312 Ga0395899_0697349 Ga0395899_0697349_318_569 83
244 3300037418 Ga0395900_0123599 Ga0395900_0123599_224_475 83
245 3300037418 Ga0395900_0168700 Ga0395900_0168700_1615_1866 83
246 3300037418 Ga0395900_0186014 Ga0395900_0186014_707_1015 83
247 3300037418 Ga0395900_0668829 Ga0395900_0668829_199_450 83
248 3300037418 Ga0395900_1116675 Ga0395900_1116675_400_651 83
249 3300037418 Ga0395900_1926419 Ga0395900_1926419_93_344 83
250 3300037466 Ga0395898_0001251 Ga0395898_0001251_24384_24635 83
251 3300037466 Ga0395898_0077433 Ga0395898_0077433_1100_1351 83
252 3300037466 Ga0395898_0222902 Ga0395898_0222902_1151_1402 83
253 3300037466 Ga0395898_0746577 Ga0395898_0746577_203_454 83
254 3300037466 Ga0395898_0928724 Ga0395898_0928724_198_449 83
255 3300037471 Ga0395905_1556725 Ga0395905_1556725_282_533 83
256 3300038443 Ga0395901_0050692 Ga0395901_0050692_1447_1698 83
257 3300038443 Ga0395901_0096554 Ga0395901_0096554_1005_1256 83
258 3300038443 Ga0395901_0261621 Ga0395901_0261621_167_418 83
259 3300038443 Ga0395901_0384220 Ga0395901_0384220_923_1174 83
260 3300038443 Ga0395901_0385646 Ga0395901_0385646_31_282 83
261 3300038443 Ga0395901_1597772 Ga0395901_1597772_91_342 83
262 3300038443 Ga0395901_1630195 Ga0395901_1630195_159_410 83
263 3300041404 Ga0439436_0102068 Ga0439436_0102068_290_541 83
264 3300041406 Ga0439439_0275432 Ga0439439_0275432_103_354 83
265 3300041410 Ga0439461_0154847 Ga0439461_0154847_209_460 83
266 3300041413 Ga0439465_0060371 Ga0439465_0060371_253_504 83
267 3300041451 Ga0451791_0602820 Ga0451791_0602820_176_427 83
268 3300041453 Ga0451797_0979737 Ga0451797_0979737_141_392 83
269 3300041460 Ga0451802_0576375 Ga0451802_0576375_11_262 83
270 3300042001 Ga0439441_124756 Ga0439441_124756_177_428 83
271 3300044683 Ga0466965_0060835 Ga0466965_0060835_788_1039 83
272 3300046678 Ga0495599_0784314 Ga0495599_0784314_186_437 83
273 3300047472 Ga0495686_0233079 Ga0495686_0233079_651_902 83
274 3300048909 Ga0496106_1391631 Ga0496106_1391631_22_273 83
275 3300048911 Ga0496108_1354933 Ga0496108_1354933_93_344 83
276 3300048914 Ga0496111_0074712 Ga0496111_0074712_417_668 83
277 3300048921 Ga0496118_0236401 Ga0496118_0236401_257_508 83
278 3300048921 Ga0496118_0461480 Ga0496118_0461480_263_514 83
279 3300048922 Ga0496119_0035737 Ga0496119_0035737_485_736 83
280 3300048924 Ga0496121_0201371 Ga0496121_0201371_408_659 83
281 3300048924 Ga0496121_0346954 Ga0496121_0346954_273_524 83
282 3300048926 Ga0496123_0082334 Ga0496123_0082334_1611_1862 83
283 3300048927 Ga0496124_0378833 Ga0496124_0378833_586_837 83
284 3300048928 Ga0496125_0000430 Ga0496125_0000430_44674_44925 83
285 3300048929 Ga0496126_0230258 Ga0496126_0230258_955_1206 83
286 3300049568 Ga0501031_0039402 Ga0501031_0039402_1860_2111 83
287 3300049568 Ga0501031_0042253 Ga0501031_0042253_1831_2082 83
288 3300049568 Ga0501031_0922931 Ga0501031_0922931_71_322 83
289 3300049569 Ga0501032_0063983 Ga0501032_0063983_246_497 83
290 3300049570 Ga0501033_0055391 Ga0501033_0055391_219_470 83
291 3300049570 Ga0501033_0063313 Ga0501033_0063313_1556_1807 83
292 3300049571 Ga0501034_0014348 Ga0501034_0014348_4933_5184 83
293 3300049571 Ga0501034_0029990 Ga0501034_0029990_4845_5096 83
294 3300049571 Ga0501034_0056171 Ga0501034_0056171_117_368 83
295 3300049571 Ga0501034_0061630 Ga0501034_0061630_676_927 83
296 3300049571 Ga0501034_0135182 Ga0501034_0135182_871_1122 83
297 3300049571 Ga0501034_0173704 Ga0501034_0173704_1349_1600 83
298 3300049571 Ga0501034_0179731 Ga0501034_0179731_830_1081 83
299 3300049571 Ga0501034_0302707 Ga0501034_0302707_1099_1350 83
300 3300049571 Ga0501034_0359873 Ga0501034_0359873_616_867 83
301 3300049571 Ga0501034_0476843 Ga0501034_0476843_867_1118 83
302 3300049571 Ga0501034_0531017 Ga0501034_0531017_673_924 83
303 3300049571 Ga0501034_1317004 Ga0501034_1317004_90_341 83
304 3300049571 Ga0501034_1338969 Ga0501034_1338969_36_287 83
305 3300049572 Ga0501036_0086335 Ga0501036_0086335_1064_1315 83
306 3300049573 Ga0501037_0010816 Ga0501037_0010816_4385_4636 83
307 3300049573 Ga0501037_0065234 Ga0501037_0065234_1511_1762 83
308 3300049573 Ga0501037_0168887 Ga0501037_0168887_238_489 83
309 3300049574 Ga0501038_0017457 Ga0501038_0017457_3353_3604 83
310 3300049574 Ga0501038_0368454 Ga0501038_0368454_644_895 83
311 3300049574 Ga0501038_0557580 Ga0501038_0557580_547_798 83
312 3300049575 Ga0501039_0106522 Ga0501039_0106522_1452_1703 83
313 3300049575 Ga0501039_1379601 Ga0501039_1379601_99_350 83
314 3300049579 Ga0501043_0016762 Ga0501043_0016762_1315_1566 83
315 3300049579 Ga0501043_0129180 Ga0501043_0129180_1334_1585 83
316 3300049579 Ga0501043_0340657 Ga0501043_0340657_229_480 83
317 3300049579 Ga0501043_1018414 Ga0501043_1018414_192_443 83
318 3300049580 Ga0501046_0167877 Ga0501046_0167877_863_1114 83
319 3300049581 Ga0501047_0021068 Ga0501047_0021068_1589_1840 83
320 3300049581 Ga0501047_0111572 Ga0501047_0111572_637_888 83
321 3300049581 Ga0501047_0410435 Ga0501047_0410435_456_707 83
322 3300049581 Ga0501047_1257439 Ga0501047_1257439_251_502 83
323 3300049582 Ga0501048_0506453 Ga0501048_0506453_543_794 83
324 3300049585 Ga0501069_0326330 Ga0501069_0326330_328_579 83
325 3300049586 Ga0501070_0061428 Ga0501070_0061428_1097_1348 83
326 3300049586 Ga0501070_0187797 Ga0501070_0187797_333_584 83
327 3300049586 Ga0501070_0222523 Ga0501070_0222523_841_1092 83
328 3300049589 Ga0501073_0357456 Ga0501073_0357456_458_709 83
329 3300049589 Ga0501073_0890456 Ga0501073_0890456_130_381 83
330 3300049589 Ga0501073_1130890 Ga0501073_1130890_150_401 83
331 3300049741 Ga0501079_1039258 Ga0501079_1039258_347_598 83
332 3300049742 Ga0501080_1098451 Ga0501080_1098451_31_282 83
333 3300049742 Ga0501080_1435517 Ga0501080_1435517_278_529 83
334 3300049744 Ga0501083_0790638 Ga0501083_0790638_33_284 83
335 3300049822 Ga0501035_0035268 Ga0501035_0035268_1339_1590 83
336 3300049822 Ga0501035_0409875 Ga0501035_0409875_624_875 83
337 3300049822 Ga0501035_0844098 Ga0501035_0844098_67_318 83
338 3300049823 Ga0501044_0151683 Ga0501044_0151683_1768_2019 83
339 3300049823 Ga0501044_0264626 Ga0501044_0264626_42_296 83
340 3300049823 Ga0501044_0395341 Ga0501044_0395341_230_481 83
341 3300049823 Ga0501044_0573969 Ga0501044_0573969_352_603 83
342 3300049823 Ga0501044_0840423 Ga0501044_0840423_408_659 83
343 3300049824 Ga0501045_1060733 Ga0501045_1060733_240_491 83
344 3300050489 nmdc:mga03683_31323_c1 nmdc:mga03683_31323_c1_879_1130 83
345 3300050490 nmdc:mga03n38_83189_c1 nmdc:mga03n38_83189_c1_104_355 83
346 3300050494 nmdc:mga06z11_155866_c1 nmdc:mga06z11_155866_c1_35_286 83
347 3300050496 nmdc:mga07m45_920309_c1 nmdc:mga07m45_920309_c1_103_354 83
348 3300050511 nmdc:mga08y16_226818_c1 nmdc:mga08y16_226818_c1_306_557 83
349 3300053098 Ga0500650_0386014 Ga0500650_0386014_336_587 83
350 3300053117 Ga0500593_280001 Ga0500593_280001_74_325 83
351 3300053151 Ga0500604_0000722 Ga0500604_0000722_1821_2072 83
352 3300053153 Ga0500616_0015607 Ga0500616_0015607_1430_1681 83
353 3300053155 Ga0500620_218964 Ga0500620_218964_297_548 83
354 3300060353 Ga0501082_0690146 Ga0501082_0690146_489_740 83

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02597

ThiS

ThiS family

3

83

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1jwb-assembly1.cif.gz_D-2 structure of the covalent acyl-adenylate form of the moeb-moad protein complex 0.8498 1 83
1jwb-assembly1.cif.gz_D-2 structure of the covalent acyl-adenylate form of the moeb-moad protein complex 0.8402 1 83
6jc0-assembly1.cif.gz_A structural analysis of molybdopterin synthases from two mycobacteria pathogens 0.8038 2 83
6jbz-assembly1.cif.gz_D structural analysis of molybdopterin synthases from two mycobacteria pathogens 0.8016 2 83
2qie-assembly1.cif.gz_D staphylococcus aureus molybdopterin synthase in complex with precursor z 0.801 1 83
ID Description Score Start End Superfamily
af_P30748_1_81_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.884 2 83 3.10.20.30
af_Q6MWY3_4_79_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8539 1 79 3.10.20.30
af_P30748_1_81_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8539 2 83 3.10.20.30
af_Q6MWY3_4_79_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8335 1 79 3.10.20.30
af_A0A0B4J391_26_106_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8198 2 83 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A258K8M6-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.982 1 43
AF-A0A212QXW6-F1-model_v4 Molybdopterin synthase subunit MoaD 0.9656 1 83
AF-A0A259DF16-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.9636 2 76
AF-A0A0Q6BUZ6-F1-model_v4 deleted 0.9631 1 83
AF-A0A849EGV1-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.9622 1 81 GO:0006777
GO:1990133

Feature Viewer

pLDDT pTM Quality
94.88 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map