F419659

General Info

Members Datasets Scaffolds Average Seq Length
354 219 708 136

Family's Representative Sequence

Representative Sequence 3300005441|Ga0070700_101822218|Ga0070700_1018222181
Length 141
Sequence LSASQIYHEAIKALATAATGEGTLAAPDGHALIDNPLCGDRVDMEVRIADGRIAEVAHQVRGCLLCRAAAAIIGRRAVGEAPADIERVSAGVSAMLEKQAPPPEEWKELDAFVPVHGHRSRYRCVQLPFEALLAALRAAGC

Samples

Sample ID Description Type Environment
1 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
5 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
50 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
51 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
77 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
78 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
81 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
83 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
126 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
127 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
128 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
129 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
130 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
131 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
132 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
135 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
136 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
137 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
138 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
139 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
140 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
141 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
144 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
145 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
146 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
147 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
148 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
149 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
150 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
151 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
152 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
153 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
154 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
155 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
156 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
157 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
158 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
159 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
160 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
161 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
171 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
172 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
173 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
174 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
175 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
176 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
177 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
178 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
179 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
180 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
182 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
183 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
184 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
185 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
186 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
187 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
188 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
189 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
190 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
191 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
192 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
193 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
194 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
195 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
196 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
197 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
198 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
199 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
200 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
201 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
202 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
203 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
204 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
205 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
206 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
207 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
208 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
209 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
210 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
211 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
212 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
213 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
214 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
215 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
216 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
217 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
218 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
219 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.01
Nodule 0
Rhizoplane 0.28
Rhizosphere 72.88
Stem 0
Stem Tuber 0
Unclassified 7.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070700_101822218 3300005441 Bacteria 524
2 JGI25153J46596_10000156 3300003215 Bacteria 68489
3 rootH1_10350236 3300003323 Bacteria 1212
4 Ga0055529_1024766 3300003763 Unclassified 742
5 Ga0055531_10006645 3300003794 Bacteria 6497
6 Ga0070658_10023964 3300005327 Bacteria 4896
7 Ga0070658_11570926 3300005327 Unclassified 570
8 Ga0070683_100107438 3300005329 Bacteria 2631
9 Ga0070680_100009271 3300005336 Bacteria 7552
10 Ga0070660_100381969 3300005339 Bacteria 1163
11 Ga0070661_100624059 3300005344 Bacteria 873
12 Ga0070669_101085984 3300005353 Unclassified 689
13 Ga0070675_100020500 3300005354 Bacteria 5274
14 Ga0070675_101028818 3300005354 Bacteria 757
15 Ga0070674_100771801 3300005356 Bacteria 828
16 Ga0070673_100400066 3300005364 Bacteria 1228
17 Ga0070659_100402493 3300005366 Bacteria 1156
18 Ga0070709_10054679 3300005434 Bacteria 2518
19 Ga0070713_100076190 3300005436 Bacteria 2848
20 Ga0070710_10233691 3300005437 Bacteria 1175
21 Ga0070700_100985363 3300005441 Bacteria 692
22 Ga0070700_101043175 3300005441 Unclassified 674
23 Ga0070708_100089487 3300005445 Bacteria 2801
24 Ga0070708_100199737 3300005445 Bacteria 1872
25 Ga0070678_100016034 3300005456 Bacteria 4779
26 Ga0070662_101044531 3300005457 Bacteria 700
27 Ga0070681_10019388 3300005458 Bacteria 6806
28 Ga0070706_100119564 3300005467 Bacteria 2455
29 Ga0070706_100325741 3300005467 Bacteria 1433
30 Ga0070698_100001083 3300005471 Bacteria 29936
31 Ga0070699_101824215 3300005518 Bacteria 557
32 Ga0070679_100024489 3300005530 Bacteria 5914
33 Ga0070679_100201528 3300005530 Bacteria 1956
34 Ga0070684_100110165 3300005535 Bacteria 2468
35 Ga0070697_100094123 3300005536 Bacteria 2482
36 Ga0070672_100588731 3300005543 Bacteria 968
37 Ga0070693_100176325 3300005547 Bacteria 1373
38 Ga0070665_100018431 3300005548 Bacteria 6997
39 Ga0070665_100019281 3300005548 Bacteria 6843
40 Ga0070665_100156746 3300005548 Bacteria 2279
41 Ga0070665_100586379 3300005548 Bacteria 1128
42 Ga0068855_100042688 3300005563 Bacteria 5373
43 Ga0068855_100047755 3300005563 Bacteria 5056
44 Ga0068855_100324182 3300005563 Bacteria 1702
45 Ga0068855_100376429 3300005563 Bacteria 1560
46 Ga0070664_100078337 3300005564 Bacteria 2843
47 Ga0068857_100032853 3300005577 Bacteria 4587
48 Ga0068856_100497661 3300005614 Bacteria 1240
49 Ga0068856_101013572 3300005614 Bacteria 848
50 Ga0068856_101771652 3300005614 Bacteria 629
51 Ga0068859_100131720 3300005617 Bacteria 2572
52 Ga0068864_100747889 3300005618 Bacteria 958
53 Ga0068870_10218958 3300005840 Bacteria 1164
54 Ga0068858_100339540 3300005842 Bacteria 1437
55 Ga0068858_101268784 3300005842 Bacteria 725
56 Ga0068860_100662704 3300005843 Bacteria 1052
57 Ga0068862_100139760 3300005844 Bacteria 2149
58 Ga0068862_100827141 3300005844 Bacteria 906
59 Ga0068862_100948948 3300005844 Bacteria 848
60 Ga0081455_10004909 3300005937 Bacteria 14819
61 Ga0081455_10010925 3300005937 Bacteria 9158
62 Ga0081455_10218696 3300005937 Bacteria 1413
63 Ga0081455_10377350 3300005937 Bacteria 992
64 Ga0081539_10025536 3300005985 Bacteria 3802
65 Ga0081539_10038198 3300005985 Bacteria 2848
66 Ga0075365_10014864 3300006038 Bacteria 4692
67 Ga0075365_10020651 3300006038 Bacteria 4088
68 Ga0075365_10053358 3300006038 Bacteria 2677
69 Ga0075365_10123927 3300006038 Bacteria 1784
70 Ga0075368_10287995 3300006042 Unclassified 707
71 Ga0070712_101820707 3300006175 Bacteria 533
72 Ga0075362_10002925 3300006177 Bacteria 5857
73 Ga0075362_10031143 3300006177 Bacteria 2308
74 Ga0075362_10168892 3300006177 Bacteria 1056
75 Ga0075362_10218381 3300006177 Bacteria 931
76 Ga0075367_10086579 3300006178 Bacteria 1902
77 Ga0075367_10191084 3300006178 Bacteria 1278
78 Ga0075367_10340084 3300006178 Bacteria 947
79 Ga0075369_10000059 3300006186 Bacteria 28189
80 Ga0075369_10003333 3300006186 Bacteria 5833
81 Ga0075366_10174961 3300006195 Bacteria 1303
82 Ga0075366_10227416 3300006195 Bacteria 1136
83 Ga0075370_10188277 3300006353 Bacteria 1215
84 Ga0075370_10792627 3300006353 Bacteria 577
85 Ga0068871_100930548 3300006358 Bacteria 807
86 Ga0075428_100020592 3300006844 Bacteria 7304
87 Ga0075430_100068517 3300006846 Bacteria 2976
88 Ga0075429_100013864 3300006880 Bacteria 6991
89 Ga0075436_101312913 3300006914 Unclassified 547
90 Ga0097620_100131722 3300006931 Bacteria 2572
91 Ga0097620_100825461 3300006931 Bacteria 1014
92 Ga0075435_100604336 3300007076 Bacteria 951
93 Ga0099794_10079876 3300007265 Bacteria 1612
94 Ga0099794_10574808 3300007265 Bacteria 596
95 Ga0105240_10093761 3300009093 Bacteria 3664
96 Ga0105240_10147172 3300009093 Bacteria 2810
97 Ga0105240_10213088 3300009093 Bacteria 2256
98 Ga0105240_10510627 3300009093 Bacteria 1335
99 Ga0111539_10002464 3300009094 Bacteria 24584
100 Ga0105242_11258863 3300009176 Unclassified 762
101 Ga0105248_10919086 3300009177 Bacteria 988
102 Ga0105237_10065673 3300009545 Bacteria 3624
103 Ga0105237_12501137 3300009545 Unclassified 527
104 Ga0105238_10030134 3300009551 Bacteria 5521
105 Ga0105239_10151086 3300010375 Bacteria 2592
106 Ga0157369_10028905 3300013105 Bacteria 6132
107 Ga0157369_11037144 3300013105 Bacteria 839
108 Ga0157374_10243298 3300013296 Bacteria 1769
109 Ga0163162_11234744 3300013306 Bacteria 848
110 Ga0157372_10388479 3300013307 Bacteria 1626
111 Ga0157372_10393568 3300013307 Bacteria 1615
112 Ga0157375_12087416 3300013308 Bacteria 674
113 Ga0157375_12324212 3300013308 Bacteria 639
114 Ga0182008_10129455 3300014497 Bacteria 1258
115 Ga0157379_10981371 3300014968 Bacteria 805
116 Ga0157379_11722803 3300014968 Bacteria 614
117 Ga0182007_10284088 3300015262 Bacteria 603
118 Ga0163161_11550501 3300017792 Bacteria 583
119 Ga0213872_10120928 3300021361 Bacteria 1158
120 Ga0213871_10000584 3300021441 Bacteria 5146
121 Ga0209148_1000485 3300025254 Bacteria 41112
122 Ga0209455_1027783 3300025272 Unclassified 997
123 Ga0209758_1000119 3300025297 Bacteria 195545
124 Ga0209050_1008208 3300025298 Bacteria 5638
125 Ga0207426_1108591 3300025302 Bacteria 703
126 Ga0209051_1053857 3300025303 Bacteria 1318
127 Ga0209257_1000301 3300025304 Bacteria 108454
128 Ga0209257_1105322 3300025304 Bacteria 681
129 Ga0209257_1122964 3300025304 Unclassified 604
130 Ga0207688_10302299 3300025901 Bacteria 978
131 Ga0207680_11299888 3300025903 Bacteria 517
132 Ga0207699_10049666 3300025906 Bacteria 2470
133 Ga0207645_10337871 3300025907 Bacteria 1006
134 Ga0207643_10499784 3300025908 Bacteria 777
135 Ga0207705_10204813 3300025909 Bacteria 1495
136 Ga0207684_10072564 3300025910 Bacteria 2924
137 Ga0207684_10254300 3300025910 Bacteria 1516
138 Ga0207707_10025433 3300025912 Bacteria 5179
139 Ga0207695_10047371 3300025913 Bacteria 4551
140 Ga0207695_10344254 3300025913 Bacteria 1378
141 Ga0207695_11314876 3300025913 Bacteria 603
142 Ga0207695_11588335 3300025913 Unclassified 535
143 Ga0207671_10595744 3300025914 Bacteria 881
144 Ga0207671_11137602 3300025914 Unclassified 612
145 Ga0207660_10028668 3300025917 Bacteria 3809
146 Ga0207662_10162329 3300025918 Bacteria 1428
147 Ga0207649_10044145 3300025920 Bacteria 2728
148 Ga0207652_10012233 3300025921 Bacteria 6934
149 Ga0207681_10595303 3300025923 Bacteria 913
150 Ga0207650_11314603 3300025925 Bacteria 615
151 Ga0207659_10027199 3300025926 Bacteria 3869
152 Ga0207659_11475986 3300025926 Unclassified 582
153 Ga0207690_10243393 3300025932 Bacteria 1386
154 Ga0207686_10789261 3300025934 Unclassified 760
155 Ga0207670_10975850 3300025936 Bacteria 712
156 Ga0207669_11846203 3300025937 Unclassified 516
157 Ga0207704_10581710 3300025938 Bacteria 914
158 Ga0207691_10179214 3300025940 Bacteria 1852
159 Ga0207689_10576809 3300025942 Bacteria 946
160 Ga0207661_10152168 3300025944 Bacteria 2000
161 Ga0207679_10341550 3300025945 Bacteria 1302
162 Ga0207667_10008008 3300025949 Bacteria 12605
163 Ga0207667_10036412 3300025949 Bacteria 5274
164 Ga0207667_10086212 3300025949 Bacteria 3250
165 Ga0207668_11332189 3300025972 Bacteria 647
166 Ga0207677_10124015 3300026023 Bacteria 1949
167 Ga0207639_11097634 3300026041 Bacteria 746
168 Ga0207708_10456110 3300026075 Bacteria 1065
169 Ga0207702_10114937 3300026078 Bacteria 2399
170 Ga0207648_10251030 3300026089 Bacteria 1577
171 Ga0207676_10706553 3300026095 Bacteria 977
172 Ga0207674_10017026 3300026116 Bacteria 7936
173 Ga0207674_11377115 3300026116 Bacteria 675
174 Ga0207675_100935650 3300026118 Bacteria 884
175 Ga0207683_10056404 3300026121 Bacteria 3446
176 Ga0268266_10008153 3300028379 Bacteria 9352
177 Ga0268266_10051918 3300028379 Bacteria 3520
178 Ga0268266_10206503 3300028379 Bacteria 1800
179 Ga0268266_10710219 3300028379 Bacteria 969
180 Ga0268265_10007387 3300028380 Bacteria 7420
181 Ga0268265_10604309 3300028380 Bacteria 1049
182 Ga0268264_11969840 3300028381 Unclassified 593
183 Ga0265334_10023244 3300028573 Bacteria 2522
184 Ga0307517_10143127 3300028786 Bacteria 1670
185 Ga0265340_10026760 3300031247 Bacteria 2913
186 Ga0265327_10097892 3300031251 Unclassified 1420
187 Ga0265316_11168878 3300031344 Bacteria 533
188 Ga0307513_10023152 3300031456 Bacteria 7267
189 Ga0307513_10203355 3300031456 Bacteria 1819
190 Ga0307513_10526426 3300031456 Bacteria 897
191 Ga0307513_10529421 3300031456 Bacteria 893
192 Ga0307508_10687002 3300031616 Bacteria 632
193 Ga0307516_10206697 3300031730 Bacteria 1680
194 Ga0307416_101246920 3300032002 Bacteria 849
195 Ga0307416_102110638 3300032002 Bacteria 665
196 Ga0373923_0217600 3300035111 Bacteria 887
197 Ga0373939_0072982 3300035114 Bacteria 1122
198 Ga0373943_0362717 3300035170 Bacteria 832
199 Ga0373931_0017496 3300035691 Bacteria 3548
200 Ga0373931_0409347 3300035691 Bacteria 860
201 Ga0373927_0129194 3300035695 Bacteria 1650
202 Ga0373933_0158844 3300035724 Bacteria 1435
203 Ga0373947_0697170 3300035725 Bacteria 693
204 Ga0373937_0266336 3300036401 Bacteria 1617
205 Ga0373925_0130534 3300037068 Bacteria 1959
206 Ga0373925_0147626 3300037068 Bacteria 1844
207 Ga0395899_0007174 3300037312 Bacteria 8628
208 Ga0395899_0019645 3300037312 Bacteria 5129
209 Ga0395899_0283464 3300037312 Bacteria 1126
210 Ga0395899_0383951 3300037312 Bacteria 933
211 Ga0395900_0009875 3300037418 Bacteria 9775
212 Ga0395900_0012101 3300037418 Bacteria 8816
213 Ga0395900_0046919 3300037418 Bacteria 4448
214 Ga0395898_0013417 3300037466 Bacteria 8439
215 Ga0395898_0027205 3300037466 Bacteria 5744
216 Ga0395898_0325109 3300037466 Bacteria 1467
217 Ga0395898_0959901 3300037466 Bacteria 792
218 Ga0395901_0001490 3300038443 Bacteria 24357
219 Ga0395901_0003196 3300038443 Bacteria 16485
220 Ga0395901_0005144 3300038443 Bacteria 13205
221 Ga0395901_0116210 3300038443 Bacteria 2810
222 Ga0395901_0151514 3300038443 Bacteria 2436
223 Ga0436365_0186769 3300039437 Bacteria 1127
224 Ga0436360_0118090 3300039438 Bacteria 17627
225 Ga0436361_0437337 3300039447 Bacteria 2836
226 Ga0451843_1388041 3300041509 Bacteria 555
227 Ga0439437_031766 3300042000 Unclassified 666
228 Ga0439458_0066812 3300042157 Unclassified 904
229 Ga0451576_0385376 3300045051 Bacteria 1469
230 Ga0466967_0138939 3300045976 Bacteria 2261
231 Ga0495638_0119206 3300046460 Bacteria 1561
232 Ga0495610_0230779 3300046512 Bacteria 743
233 Ga0495625_0168203 3300046660 Bacteria 1465
234 Ga0495636_0155751 3300047318 Bacteria 1027
235 Ga0495686_0087913 3300047472 Bacteria 1890
236 Ga0495686_0100419 3300047472 Bacteria 1746
237 Ga0496113_0400434 3300048916 Bacteria 1102
238 Ga0501033_0076907 3300049570 Bacteria 2450
239 Ga0501033_0130253 3300049570 Bacteria 1823
240 Ga0501033_0185964 3300049570 Bacteria 1488
241 Ga0501033_0604703 3300049570 Bacteria 752
242 Ga0501034_0014898 3300049571 Bacteria 7995
243 Ga0501034_0081700 3300049571 Bacteria 3234
244 Ga0501034_0215648 3300049571 Bacteria 1873
245 Ga0501034_0288333 3300049571 Bacteria 1580
246 Ga0501034_0359578 3300049571 Bacteria 1383
247 Ga0501034_0386773 3300049571 Bacteria 1323
248 Ga0501034_0573256 3300049571 Bacteria 1036
249 Ga0501036_0992182 3300049572 Unclassified 688
250 Ga0501037_0112030 3300049573 Bacteria 1965
251 Ga0501037_0421082 3300049573 Bacteria 914
252 Ga0501037_0666714 3300049573 Unclassified 694
253 Ga0501038_0109503 3300049574 Bacteria 2289
254 Ga0501038_0153475 3300049574 Bacteria 1876
255 Ga0501038_0171983 3300049574 Bacteria 1753
256 Ga0501039_0704809 3300049575 Bacteria 789
257 Ga0501039_1497618 3300049575 Unclassified 519
258 Ga0501043_0010963 3300049579 Bacteria 7103
259 Ga0501043_0105023 3300049579 Bacteria 2220
260 Ga0501043_0481728 3300049579 Bacteria 929
261 Ga0501043_0638702 3300049579 Unclassified 783
262 Ga0501046_0031525 3300049580 Bacteria 4296
263 Ga0501047_0040754 3300049581 Bacteria 4490
264 Ga0501047_0146405 3300049581 Bacteria 2239
265 Ga0501068_0038753 3300049584 Bacteria 2855
266 Ga0501068_0064717 3300049584 Bacteria 2225
267 Ga0501069_0141152 3300049585 Bacteria 1382
268 Ga0501070_0048826 3300049586 Bacteria 3515
269 Ga0501070_0224433 3300049586 Bacteria 1540
270 Ga0501071_0597270 3300049587 Bacteria 848
271 Ga0501072_0556922 3300049588 Bacteria 905
272 Ga0501073_0030629 3300049589 Bacteria 3840
273 Ga0501073_0117988 3300049589 Bacteria 1839
274 Ga0501073_0384721 3300049589 Bacteria 969
275 Ga0501076_0282006 3300049592 Bacteria 1361
276 Ga0501079_0282237 3300049741 Bacteria 1299
277 Ga0501080_0141951 3300049742 Bacteria 2220
278 Ga0501080_0196124 3300049742 Bacteria 1854
279 Ga0501080_1811911 3300049742 Bacteria 513
280 Ga0501083_0035589 3300049744 Bacteria 3400
281 Ga0501083_0102123 3300049744 Bacteria 1890
282 Ga0501035_0075840 3300049822 Bacteria 2974
283 Ga0501035_0302354 3300049822 Bacteria 1348
284 Ga0501035_0428079 3300049822 Bacteria 1098
285 Ga0501044_0033862 3300049823 Bacteria 5364
286 Ga0501044_0045174 3300049823 Bacteria 4566
287 Ga0501044_0079193 3300049823 Bacteria 3330
288 Ga0501044_0083185 3300049823 Bacteria 3237
289 Ga0501044_0105474 3300049823 Bacteria 2831
290 nmdc:mga03683_12402_c1 3300050489 Bacteria 3112
291 nmdc:mga03683_381076_c1 3300050489 Bacteria 671
292 nmdc:mga03683_6862_c1 3300050489 Bacteria 3922
293 nmdc:mga03683_87251_c1 3300050489 Bacteria 1356
294 nmdc:mga03n38_583274_c1 3300050490 Bacteria 635
295 nmdc:mga0yw44_119069_c1 3300050492 Bacteria 1699
296 nmdc:mga0yw44_12932_c1 3300050492 Bacteria 4372
297 nmdc:mga0yw44_23955_c1 3300050492 Bacteria 3446
298 nmdc:mga0yw44_29829_c1 3300050492 Bacteria 3153
299 nmdc:mga0yw44_395589_c1 3300050492 Bacteria 934
300 nmdc:mga0yw44_92707_c1 3300050492 Bacteria 1912
301 nmdc:mga0k408_165879_c1 3300050493 Bacteria 1316
302 nmdc:mga0k408_273719_c1 3300050493 Bacteria 1008
303 nmdc:mga06z11_30999_c1 3300050494 Bacteria 2593
304 nmdc:mga06z11_373673_c1 3300050494 Bacteria 856
305 nmdc:mga06z11_488086_c1 3300050494 Bacteria 746
306 nmdc:mga06z11_9670_c1 3300050494 Bacteria 4072
307 nmdc:mga04h51_236535_c1 3300050495 Bacteria 728
308 nmdc:mga07m45_437155_c1 3300050496 Unclassified 759
309 nmdc:mga05p37_255464_c1 3300050507 Bacteria 2100
310 nmdc:mga0qj67_46505_c1 3300050509 Bacteria 3426
311 nmdc:mga08y16_3844_c1 3300050511 Bacteria 15627
312 nmdc:mga0rr50_636677_c1 3300050513 Bacteria 910
313 nmdc:mga08x19_1145768_c1 3300050514 Unclassified 552
314 nmdc:mga0sz30_142512_c1 3300050516 Bacteria 1058
315 nmdc:mga0sz30_195760_c1 3300050516 Bacteria 897
316 nmdc:mga0sz30_266_c1 3300050516 Bacteria 20024
317 nmdc:mga0sz30_5590_c1 3300050516 Bacteria 4618
318 Ga0500578_0094488 3300053086 Bacteria 1897
319 Ga0500643_044718 3300053087 Bacteria 1286
320 Ga0500644_0191537 3300053088 Bacteria 842
321 Ga0500651_0005136 3300053093 Bacteria 7448
322 Ga0500651_0569412 3300053093 Bacteria 618
323 Ga0500566_0007676 3300053094 Bacteria 6397
324 Ga0500566_0314930 3300053094 Bacteria 731
325 Ga0500641_0016227 3300053096 Bacteria 2771
326 Ga0500641_0168066 3300053096 Bacteria 944
327 Ga0500650_0241164 3300053098 Bacteria 813
328 Ga0500555_014545 3300053103 Bacteria 2269
329 Ga0500562_060209 3300053108 Bacteria 1020
330 Ga0500595_000354 3300053119 Bacteria 29968
331 Ga0500595_101106 3300053119 Bacteria 826
332 Ga0500642_0005345 3300053130 Bacteria 4137
333 Ga0500655_038464 3300053133 Bacteria 935
334 Ga0500658_0093139 3300053134 Bacteria 1306
335 Ga0500658_0154653 3300053134 Bacteria 1035
336 Ga0500658_0169644 3300053134 Bacteria 990
337 Ga0500658_0304736 3300053134 Bacteria 732
338 Ga0500568_0003685 3300053139 Bacteria 8420
339 Ga0500577_0243085 3300053142 Bacteria 781
340 Ga0500588_0063413 3300053146 Bacteria 1191
341 Ga0500604_0001425 3300053151 Bacteria 6675
342 Ga0500604_0055042 3300053151 Bacteria 1236
343 Ga0500616_0000846 3300053153 Bacteria 34311
344 Ga0500616_0002333 3300053153 Bacteria 15998
345 Ga0500611_004604 3300053727 Bacteria 1873
346 Ga0500645_184254 3300053730 Unclassified 567
347 Ga0500656_009669 3300053732 Bacteria 1042
348 Ga0500552_000972 3300053733 Bacteria 2704
349 Ga0500599_002151 3300053736 Bacteria 2343
350 Ga0501084_0067755 3300054114 Bacteria 2988
351 Ga0501084_0501511 3300054114 Bacteria 1026
352 Ga0501084_1164400 3300054114 Bacteria 647
353 Ga0501082_0001872 3300060353 Bacteria 18517
354 Ga0501082_0417435 3300060353 Bacteria 1172
355 Ga0070700_101822218
356 JGI25153J46596_10000156
357 rootH1_10350236
358 Ga0055529_1024766
359 Ga0055531_10006645
360 Ga0070658_10023964
361 Ga0070658_11570926
362 Ga0070683_100107438
363 Ga0070680_100009271
364 Ga0070660_100381969
365 Ga0070661_100624059
366 Ga0070669_101085984
367 Ga0070675_100020500
368 Ga0070675_101028818
369 Ga0070674_100771801
370 Ga0070673_100400066
371 Ga0070659_100402493
372 Ga0070709_10054679
373 Ga0070713_100076190
374 Ga0070710_10233691
375 Ga0070700_100985363
376 Ga0070700_101043175
377 Ga0070708_100089487
378 Ga0070708_100199737
379 Ga0070678_100016034
380 Ga0070662_101044531
381 Ga0070681_10019388
382 Ga0070706_100119564
383 Ga0070706_100325741
384 Ga0070698_100001083
385 Ga0070699_101824215
386 Ga0070679_100024489
387 Ga0070679_100201528
388 Ga0070684_100110165
389 Ga0070697_100094123
390 Ga0070672_100588731
391 Ga0070693_100176325
392 Ga0070665_100018431
393 Ga0070665_100019281
394 Ga0070665_100156746
395 Ga0070665_100586379
396 Ga0068855_100042688
397 Ga0068855_100047755
398 Ga0068855_100324182
399 Ga0068855_100376429
400 Ga0070664_100078337
401 Ga0068857_100032853
402 Ga0068856_100497661
403 Ga0068856_101013572
404 Ga0068856_101771652
405 Ga0068859_100131720
406 Ga0068864_100747889
407 Ga0068870_10218958
408 Ga0068858_100339540
409 Ga0068858_101268784
410 Ga0068860_100662704
411 Ga0068862_100139760
412 Ga0068862_100827141
413 Ga0068862_100948948
414 Ga0081455_10004909
415 Ga0081455_10010925
416 Ga0081455_10218696
417 Ga0081455_10377350
418 Ga0081539_10025536
419 Ga0081539_10038198
420 Ga0075365_10014864
421 Ga0075365_10020651
422 Ga0075365_10053358
423 Ga0075365_10123927
424 Ga0075368_10287995
425 Ga0070712_101820707
426 Ga0075362_10002925
427 Ga0075362_10031143
428 Ga0075362_10168892
429 Ga0075362_10218381
430 Ga0075367_10086579
431 Ga0075367_10191084
432 Ga0075367_10340084
433 Ga0075369_10000059
434 Ga0075369_10003333
435 Ga0075366_10174961
436 Ga0075366_10227416
437 Ga0075370_10188277
438 Ga0075370_10792627
439 Ga0068871_100930548
440 Ga0075428_100020592
441 Ga0075430_100068517
442 Ga0075429_100013864
443 Ga0075436_101312913
444 Ga0097620_100131722
445 Ga0097620_100825461
446 Ga0075435_100604336
447 Ga0099794_10079876
448 Ga0099794_10574808
449 Ga0105240_10093761
450 Ga0105240_10147172
451 Ga0105240_10213088
452 Ga0105240_10510627
453 Ga0111539_10002464
454 Ga0105242_11258863
455 Ga0105248_10919086
456 Ga0105237_10065673
457 Ga0105237_12501137
458 Ga0105238_10030134
459 Ga0105239_10151086
460 Ga0157369_10028905
461 Ga0157369_11037144
462 Ga0157374_10243298
463 Ga0163162_11234744
464 Ga0157372_10388479
465 Ga0157372_10393568
466 Ga0157375_12087416
467 Ga0157375_12324212
468 Ga0182008_10129455
469 Ga0157379_10981371
470 Ga0157379_11722803
471 Ga0182007_10284088
472 Ga0163161_11550501
473 Ga0213872_10120928
474 Ga0213871_10000584
475 Ga0209148_1000485
476 Ga0209455_1027783
477 Ga0209758_1000119
478 Ga0209050_1008208
479 Ga0207426_1108591
480 Ga0209051_1053857
481 Ga0209257_1000301
482 Ga0209257_1105322
483 Ga0209257_1122964
484 Ga0207688_10302299
485 Ga0207680_11299888
486 Ga0207699_10049666
487 Ga0207645_10337871
488 Ga0207643_10499784
489 Ga0207705_10204813
490 Ga0207684_10072564
491 Ga0207684_10254300
492 Ga0207707_10025433
493 Ga0207695_10047371
494 Ga0207695_10344254
495 Ga0207695_11314876
496 Ga0207695_11588335
497 Ga0207671_10595744
498 Ga0207671_11137602
499 Ga0207660_10028668
500 Ga0207662_10162329
501 Ga0207649_10044145
502 Ga0207652_10012233
503 Ga0207681_10595303
504 Ga0207650_11314603
505 Ga0207659_10027199
506 Ga0207659_11475986
507 Ga0207690_10243393
508 Ga0207686_10789261
509 Ga0207670_10975850
510 Ga0207669_11846203
511 Ga0207704_10581710
512 Ga0207691_10179214
513 Ga0207689_10576809
514 Ga0207661_10152168
515 Ga0207679_10341550
516 Ga0207667_10008008
517 Ga0207667_10036412
518 Ga0207667_10086212
519 Ga0207668_11332189
520 Ga0207677_10124015
521 Ga0207639_11097634
522 Ga0207708_10456110
523 Ga0207702_10114937
524 Ga0207648_10251030
525 Ga0207676_10706553
526 Ga0207674_10017026
527 Ga0207674_11377115
528 Ga0207675_100935650
529 Ga0207683_10056404
530 Ga0268266_10008153
531 Ga0268266_10051918
532 Ga0268266_10206503
533 Ga0268266_10710219
534 Ga0268265_10007387
535 Ga0268265_10604309
536 Ga0268264_11969840
537 Ga0265334_10023244
538 Ga0307517_10143127
539 Ga0265340_10026760
540 Ga0265327_10097892
541 Ga0265316_11168878
542 Ga0307513_10023152
543 Ga0307513_10203355
544 Ga0307513_10526426
545 Ga0307513_10529421
546 Ga0307508_10687002
547 Ga0307516_10206697
548 Ga0307416_101246920
549 Ga0307416_102110638
550 Ga0373923_0217600
551 Ga0373939_0072982
552 Ga0373943_0362717
553 Ga0373931_0017496
554 Ga0373931_0409347
555 Ga0373927_0129194
556 Ga0373933_0158844
557 Ga0373947_0697170
558 Ga0373937_0266336
559 Ga0373925_0130534
560 Ga0373925_0147626
561 Ga0395899_0007174
562 Ga0395899_0019645
563 Ga0395899_0283464
564 Ga0395899_0383951
565 Ga0395900_0009875
566 Ga0395900_0012101
567 Ga0395900_0046919
568 Ga0395898_0013417
569 Ga0395898_0027205
570 Ga0395898_0325109
571 Ga0395898_0959901
572 Ga0395901_0001490
573 Ga0395901_0003196
574 Ga0395901_0005144
575 Ga0395901_0116210
576 Ga0395901_0151514
577 Ga0436365_0186769
578 Ga0436360_0118090
579 Ga0436361_0437337
580 Ga0451843_1388041
581 Ga0439437_031766
582 Ga0439458_0066812
583 Ga0451576_0385376
584 Ga0466967_0138939
585 Ga0495638_0119206
586 Ga0495610_0230779
587 Ga0495625_0168203
588 Ga0495636_0155751
589 Ga0495686_0087913
590 Ga0495686_0100419
591 Ga0496113_0400434
592 Ga0501033_0076907
593 Ga0501033_0130253
594 Ga0501033_0185964
595 Ga0501033_0604703
596 Ga0501034_0014898
597 Ga0501034_0081700
598 Ga0501034_0215648
599 Ga0501034_0288333
600 Ga0501034_0359578
601 Ga0501034_0386773
602 Ga0501034_0573256
603 Ga0501036_0992182
604 Ga0501037_0112030
605 Ga0501037_0421082
606 Ga0501037_0666714
607 Ga0501038_0109503
608 Ga0501038_0153475
609 Ga0501038_0171983
610 Ga0501039_0704809
611 Ga0501039_1497618
612 Ga0501043_0010963
613 Ga0501043_0105023
614 Ga0501043_0481728
615 Ga0501043_0638702
616 Ga0501046_0031525
617 Ga0501047_0040754
618 Ga0501047_0146405
619 Ga0501068_0038753
620 Ga0501068_0064717
621 Ga0501069_0141152
622 Ga0501070_0048826
623 Ga0501070_0224433
624 Ga0501071_0597270
625 Ga0501072_0556922
626 Ga0501073_0030629
627 Ga0501073_0117988
628 Ga0501073_0384721
629 Ga0501076_0282006
630 Ga0501079_0282237
631 Ga0501080_0141951
632 Ga0501080_0196124
633 Ga0501080_1811911
634 Ga0501083_0035589
635 Ga0501083_0102123
636 Ga0501035_0075840
637 Ga0501035_0302354
638 Ga0501035_0428079
639 Ga0501044_0033862
640 Ga0501044_0045174
641 Ga0501044_0079193
642 Ga0501044_0083185
643 Ga0501044_0105474
644 nmdc:mga03683_12402_c1
645 nmdc:mga03683_381076_c1
646 nmdc:mga03683_6862_c1
647 nmdc:mga03683_87251_c1
648 nmdc:mga03n38_583274_c1
649 nmdc:mga0yw44_119069_c1
650 nmdc:mga0yw44_12932_c1
651 nmdc:mga0yw44_23955_c1
652 nmdc:mga0yw44_29829_c1
653 nmdc:mga0yw44_395589_c1
654 nmdc:mga0yw44_92707_c1
655 nmdc:mga0k408_165879_c1
656 nmdc:mga0k408_273719_c1
657 nmdc:mga06z11_30999_c1
658 nmdc:mga06z11_373673_c1
659 nmdc:mga06z11_488086_c1
660 nmdc:mga06z11_9670_c1
661 nmdc:mga04h51_236535_c1
662 nmdc:mga07m45_437155_c1
663 nmdc:mga05p37_255464_c1
664 nmdc:mga0qj67_46505_c1
665 nmdc:mga08y16_3844_c1
666 nmdc:mga0rr50_636677_c1
667 nmdc:mga08x19_1145768_c1
668 nmdc:mga0sz30_142512_c1
669 nmdc:mga0sz30_195760_c1
670 nmdc:mga0sz30_266_c1
671 nmdc:mga0sz30_5590_c1
672 Ga0500578_0094488
673 Ga0500643_044718
674 Ga0500644_0191537
675 Ga0500651_0005136
676 Ga0500651_0569412
677 Ga0500566_0007676
678 Ga0500566_0314930
679 Ga0500641_0016227
680 Ga0500641_0168066
681 Ga0500650_0241164
682 Ga0500555_014545
683 Ga0500562_060209
684 Ga0500595_000354
685 Ga0500595_101106
686 Ga0500642_0005345
687 Ga0500655_038464
688 Ga0500658_0093139
689 Ga0500658_0154653
690 Ga0500658_0169644
691 Ga0500658_0304736
692 Ga0500568_0003685
693 Ga0500577_0243085
694 Ga0500588_0063413
695 Ga0500604_0001425
696 Ga0500604_0055042
697 Ga0500616_0000846
698 Ga0500616_0002333
699 Ga0500611_004604
700 Ga0500645_184254
701 Ga0500656_009669
702 Ga0500552_000972
703 Ga0500599_002151
704 Ga0501084_0067755
705 Ga0501084_0501511
706 Ga0501084_1164400
707 Ga0501082_0001872
708 Ga0501082_0417435

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01592

NifU_N

NifU-like N terminal domain

6

105

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
6jzv-assembly4.cif.gz_D crystal structure of sufu from bacillus subtilis 0.9329 4 136
2qq4-assembly2.cif.gz_D crystal structure of iron-sulfur cluster biosynthesis protein iscu (ttha1736) from thermus thermophilus hb8 0.9306 4 135
6jzw-assembly3.cif.gz_C crystal structure of sufu from bacillus subtilis with cys persulfurated 0.9253 4 136
5uft-assembly1.cif.gz_A crystal structure of a nitrogen-fixing nifu-like protein (n-terminal) from brucella abortus 0.9251 4 138
6jzw-assembly4.cif.gz_D crystal structure of sufu from bacillus subtilis with cys persulfurated 0.9225 4 134
ID Description Score Start End Superfamily
2qq4B00 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.9328 4 135 3.90.1010.10
5xt5C00 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.9121 10 134 3.90.1010.10
2qq4B00 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.8941 4 135 3.90.1010.10
af_O53156_2_157_3.90.1010.10 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.8731 4 138 3.90.1010.10
af_Q54KY1_301_369_3.30.390.50 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;CO dehydrogenase flavoprotein, C-terminal domain 0.8512 25 61 3.30.390.50
ID Description Score Start End GO Terms
AF-A0A5C7NVQ2-F1-model_v4 deleted 0.9716 1 139
AF-A0A2D8YT46-F1-model_v4 Iron-sulfur cluster assembly scaffold protein 0.9705 39 136
AF-W4TL23-F1-model_v4 deleted 0.9572 30 135
AF-A0A1H7I1R5-F1-model_v4 NifU homolog involved in Fe-S cluster formation 0.9562 4 138 GO:0005506
GO:0016226
GO:0051536
AF-A0A7X2KF43-F1-model_v4 Iron-sulfur cluster assembly scaffold protein 0.9553 1 136 GO:0005506
GO:0016226
GO:0051536

Map