F419656

General Info

Members Datasets Scaffolds Average Seq Length
354 196 708 302

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100055574|Ga0070713_1000555741
Length 327
Sequence MRPEGSGLGPADGLAAGGRRRRMRIGILAAEPGGTQALGKLADQLSRAADDGFASFWLPNIFGLDALTSLAVAGSQVPGIELGTAVVPSYPRHPAVLAQQALTAALAIGPGRLTLGIGLSHKIVIEDMYGYTFDRPARHMREYLSVLLPLLDGTAVSVDGSTLSAHIGLSVPRAGRVPVLLAALAPRMLALAGEQTDGTVLWMTGPATVRDYVVPAISAAASAAGRPSPRIVCSLPVCVTGDPAAARASADKELAIYGQLPSYRAMLDREGAAGPGDVAIVGDEDAVAAQIAELADAGVTDFTAAEFAHGPDRERTRSLLKTVIAAS

Samples

Sample ID Description Type Environment
1 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
6 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
26 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
27 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
28 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
45 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
51 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
52 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
80 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
81 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
82 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
83 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
84 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
85 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
86 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
87 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
88 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
89 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
90 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
91 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
92 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
93 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
94 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
95 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
96 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
97 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
98 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
99 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
100 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
101 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
102 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
103 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
104 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
105 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
106 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
107 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
108 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
109 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
110 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
111 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
112 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
113 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
114 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
115 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
116 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
117 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
118 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
119 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
120 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
121 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
122 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
123 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
124 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
125 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
126 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
127 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
128 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
129 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
130 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
131 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
132 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
133 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
134 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
135 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
136 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
137 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
138 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
139 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
140 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
141 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
142 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
143 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
144 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
145 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
146 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
147 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
148 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
149 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
150 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
151 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
152 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
153 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
154 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
155 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
156 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
157 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
158 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
159 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
160 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
161 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
162 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
163 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
164 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
165 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
166 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
167 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
168 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
169 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
175 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
176 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
177 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
178 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
179 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
180 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
181 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
182 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
183 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
184 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
185 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
186 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
187 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
188 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
189 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
190 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
191 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
192 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
193 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
194 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
195 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
196 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.89
Metatranscriptomes 1.69
Isolates 1.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.24
Rhizosphere 89.27
Stem 0
Stem Tuber 0
Unclassified 3.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070713_100055574 3300005436 Bacteria 3290
2 Ga0070658_10001070 3300005327 Bacteria 23389
3 Ga0070658_10012296 3300005327 Bacteria 6872
4 Ga0070683_100460658 3300005329 Bacteria 1213
5 Ga0070680_100002830 3300005336 Bacteria 12899
6 Ga0070680_100124005 3300005336 Bacteria 2158
7 Ga0070669_100123555 3300005353 Bacteria 1978
8 Ga0070703_10057735 3300005406 Bacteria 1261
9 Ga0070709_10002939 3300005434 Bacteria 9175
10 Ga0070709_10035743 3300005434 Bacteria 3021
11 Ga0070714_100003355 3300005435 Bacteria 11930
12 Ga0070714_100047820 3300005435 Bacteria 3636
13 Ga0070714_100078846 3300005435 Bacteria 2863
14 Ga0070714_100159207 3300005435 Bacteria 2041
15 Ga0070713_100041643 3300005436 Bacteria 3743
16 Ga0070710_10067023 3300005437 Bacteria 2059
17 Ga0070710_10089237 3300005437 Bacteria 1815
18 Ga0070710_10118084 3300005437 Bacteria 1602
19 Ga0070710_10280156 3300005437 Bacteria 1081
20 Ga0070711_100021415 3300005439 Bacteria 4180
21 Ga0070711_100133903 3300005439 Bacteria 1849
22 Ga0070711_100224928 3300005439 Bacteria 1460
23 Ga0070711_100376099 3300005439 Bacteria 1147
24 Ga0070705_100067856 3300005440 Bacteria 2144
25 Ga0070708_100068586 3300005445 Bacteria 3188
26 Ga0070708_100312585 3300005445 Bacteria 1480
27 Ga0070708_100507692 3300005445 Bacteria 1137
28 Ga0070681_10003041 3300005458 Bacteria 15550
29 Ga0070681_10269813 3300005458 Bacteria 1613
30 Ga0070706_100011428 3300005467 Bacteria 8251
31 Ga0070706_100039419 3300005467 Bacteria 4362
32 Ga0070706_100081546 3300005467 Bacteria 2995
33 Ga0070706_100350786 3300005467 Unclassified 1375
34 Ga0070706_100651454 3300005467 Bacteria 978
35 Ga0070707_100026682 3300005468 Bacteria 5487
36 Ga0070707_100030777 3300005468 Bacteria 5112
37 Ga0070707_100161705 3300005468 Bacteria 2182
38 Ga0070707_100264076 3300005468 Bacteria 1674
39 Ga0070698_100009729 3300005471 Bacteria 10276
40 Ga0070698_100021807 3300005471 Bacteria 6708
41 Ga0070698_100039476 3300005471 Bacteria 4858
42 Ga0070698_100087879 3300005471 Bacteria 3094
43 Ga0070698_100116789 3300005471 Bacteria 2631
44 Ga0070699_100056377 3300005518 Bacteria 3402
45 Ga0070679_100000749 3300005530 Bacteria 28066
46 Ga0070679_100284877 3300005530 Bacteria 1604
47 Ga0070664_100454587 3300005564 Bacteria 1176
48 Ga0068856_100029906 3300005614 Bacteria 5323
49 Ga0068859_100046158 3300005617 Bacteria 4376
50 Ga0068864_100030069 3300005618 Bacteria 4604
51 Ga0068863_100009874 3300005841 Bacteria 9296
52 Ga0070717_10017633 3300006028 Bacteria 5559
53 Ga0070715_10026217 3300006163 Bacteria 2316
54 Ga0070716_100013188 3300006173 Bacteria 4209
55 Ga0070716_100030368 3300006173 Bacteria 2930
56 Ga0070712_100013506 3300006175 Bacteria 5221
57 Ga0070712_100040754 3300006175 Bacteria 3185
58 Ga0068871_100231283 3300006358 Bacteria 1604
59 Ga0068871_100260464 3300006358 Bacteria 1513
60 Ga0075428_100112183 3300006844 Bacteria 2970
61 Ga0075428_100357593 3300006844 Unclassified 1567
62 Ga0075431_100119205 3300006847 Bacteria 2723
63 Ga0075436_100032855 3300006914 Bacteria 3575
64 Ga0097620_100046158 3300006931 Bacteria 4376
65 Ga0075435_100103893 3300007076 Bacteria 2357
66 Ga0111539_10198545 3300009094 Bacteria 2340
67 Ga0114129_10433303 3300009147 Bacteria 1727
68 Ga0114129_10539083 3300009147 Bacteria 1519
69 Ga0105248_10139361 3300009177 Bacteria 2736
70 Ga0105237_10085383 3300009545 Bacteria 3146
71 Ga0105249_10123689 3300009553 Bacteria 2461
72 Ga0105239_10246051 3300010375 Bacteria 2008
73 Ga0105239_10525991 3300010375 Bacteria 1346
74 Ga0157369_10001522 3300013105 Bacteria 28415
75 Ga0157369_10139308 3300013105 Bacteria 2568
76 Ga0157374_10104610 3300013296 Bacteria 2718
77 Ga0157375_10061736 3300013308 Bacteria 3722
78 Ga0163163_10022175 3300014325 Bacteria 6007
79 Ga0157380_10389308 3300014326 Bacteria 1318
80 Ga0197907_11307954 3300020069 Bacteria 6095
81 Ga0206349_1123043 3300020075 Bacteria 2329
82 Ga0206352_10419987 3300020078 Bacteria 1030
83 Ga0206354_11415256 3300020081 Bacteria 2466
84 Ga0206353_10295195 3300020082 Bacteria 2073
85 Ga0206353_10693210 3300020082 Bacteria 21014
86 Ga0213876_10001905 3300021384 Bacteria 12550
87 Ga0213876_10050835 3300021384 Unclassified 2190
88 Ga0213876_10092178 3300021384 Bacteria 1605
89 Ga0213875_10015683 3300021388 Bacteria 3686
90 Ga0213875_10029763 3300021388 Bacteria 2589
91 Ga0213875_10121560 3300021388 Bacteria 1220
92 Ga0207692_10015574 3300025898 Bacteria 3348
93 Ga0207692_10082243 3300025898 Bacteria 1725
94 Ga0207685_10004945 3300025905 Bacteria 3458
95 Ga0207699_10002017 3300025906 Bacteria 9590
96 Ga0207699_10038681 3300025906 Bacteria 2736
97 Ga0207699_10090991 3300025906 Bacteria 1915
98 Ga0207699_10110691 3300025906 Bacteria 1759
99 Ga0207705_10004845 3300025909 Bacteria 10111
100 Ga0207705_10029930 3300025909 Bacteria 3883
101 Ga0207684_10006725 3300025910 Bacteria 10443
102 Ga0207684_10059864 3300025910 Bacteria 3234
103 Ga0207684_10242432 3300025910 Unclassified 1555
104 Ga0207707_10010136 3300025912 Bacteria 8177
105 Ga0207707_10227421 3300025912 Bacteria 1623
106 Ga0207693_10005745 3300025915 Bacteria 10296
107 Ga0207693_10032974 3300025915 Bacteria 4087
108 Ga0207663_10011536 3300025916 Bacteria 4748
109 Ga0207663_10017506 3300025916 Bacteria 3994
110 Ga0207663_10047972 3300025916 Bacteria 2640
111 Ga0207663_10134384 3300025916 Bacteria 1714
112 Ga0207660_10203198 3300025917 Bacteria 1548
113 Ga0207652_10027012 3300025921 Bacteria 4783
114 Ga0207652_10030202 3300025921 Bacteria 4536
115 Ga0207646_10105638 3300025922 Bacteria 2525
116 Ga0207646_10317689 3300025922 Bacteria 1407
117 Ga0207700_10003121 3300025928 Bacteria 9566
118 Ga0207700_10018222 3300025928 Bacteria 4712
119 Ga0207700_10033593 3300025928 Bacteria 3672
120 Ga0207700_10042635 3300025928 Bacteria 3328
121 Ga0207700_10051645 3300025928 Bacteria 3069
122 Ga0207664_10011241 3300025929 Bacteria 6350
123 Ga0207664_10020243 3300025929 Bacteria 4928
124 Ga0207664_10044854 3300025929 Bacteria 3464
125 Ga0207664_10069587 3300025929 Bacteria 2830
126 Ga0207664_10199663 3300025929 Bacteria 1726
127 Ga0207664_10239823 3300025929 Bacteria 1579
128 Ga0207644_10244413 3300025931 Bacteria 1430
129 Ga0207686_10406870 3300025934 Bacteria 1038
130 Ga0207670_10300476 3300025936 Bacteria 1257
131 Ga0207665_10006650 3300025939 Bacteria 7670
132 Ga0207665_10008709 3300025939 Bacteria 6675
133 Ga0207711_10157337 3300025941 Bacteria 2054
134 Ga0207661_10297313 3300025944 Bacteria 1447
135 Ga0207661_10302539 3300025944 Bacteria 1434
136 Ga0207667_10160583 3300025949 Bacteria 2312
137 Ga0207712_10130860 3300025961 Unclassified 1912
138 Ga0207677_10227650 3300026023 Bacteria 1500
139 Ga0207702_10113459 3300026078 Bacteria 2413
140 Ga0207641_10142609 3300026088 Bacteria 2163
141 Ga0207648_10301490 3300026089 Bacteria 1437
142 Ga0207683_10218138 3300026121 Bacteria 1738
143 Ga0268265_10126730 3300028380 Unclassified 2114
144 Ga0268265_10375713 3300028380 Bacteria 1306
145 Ga0265337_1000562 3300028556 Bacteria 19510
146 Ga0265326_10008472 3300028558 Bacteria 3101
147 Ga0265319_1003722 3300028563 Bacteria 7836
148 Ga0265334_10001506 3300028573 Bacteria 11252
149 Ga0265336_10013001 3300028666 Bacteria 2785
150 Ga0265338_10007855 3300028800 Bacteria 13100
151 Ga0265338_10136300 3300028800 Bacteria 1929
152 Ga0265332_10001378 3300031238 Bacteria 13733
153 Ga0265325_10018028 3300031241 Bacteria 3917
154 Ga0265327_10002425 3300031251 Bacteria 19691
155 Ga0265316_10004139 3300031344 Bacteria 14517
156 Ga0265314_10046456 3300031711 Bacteria 3063
157 Ga0265342_10004014 3300031712 Bacteria 11763
158 Ga0307407_10056369 3300031903 Bacteria 2275
159 Ga0307409_100111778 3300031995 Bacteria 2292
160 Ga0307414_10067196 3300032004 Bacteria 2567
161 Ga0307411_10104310 3300032005 Bacteria 2013
162 Ga0373930_0002252 3300034816 Bacteria 2973
163 Ga0373926_0004078 3300035083 Bacteria 4771
164 Ga0373926_0040207 3300035083 Bacteria 1668
165 Ga0373934_0002574 3300035086 Bacteria 6679
166 Ga0373934_0062234 3300035086 Bacteria 1487
167 Ga0373952_0027774 3300035092 Bacteria 1237
168 Ga0373923_0134133 3300035111 Bacteria 1115
169 Ga0373936_0001480 3300035113 Bacteria 8529
170 Ga0373936_0005798 3300035113 Bacteria 4651
171 Ga0373945_0000923 3300035116 Bacteria 8725
172 Ga0373953_0106309 3300035117 Bacteria 1184
173 Ga0373954_0063871 3300035118 Bacteria 1740
174 Ga0373954_0071345 3300035118 Bacteria 1651
175 Ga0373956_0084523 3300035119 Bacteria 1459
176 Ga0373957_0051366 3300035120 Bacteria 1577
177 Ga0373943_0000270 3300035170 Bacteria 21406
178 Ga0373943_0030056 3300035170 Bacteria 2570
179 Ga0373943_0072069 3300035170 Bacteria 1751
180 Ga0373946_0000423 3300035171 Bacteria 13798
181 Ga0373946_0055927 3300035171 Bacteria 1665
182 Ga0373946_0110122 3300035171 Bacteria 1245
183 Ga0373955_0072243 3300035172 Bacteria 1932
184 Ga0373955_0074087 3300035172 Bacteria 1910
185 Ga0373955_0095736 3300035172 Bacteria 1698
186 Ga0373955_0237820 3300035172 Bacteria 1090
187 Ga0373924_0057495 3300035410 Bacteria 1622
188 Ga0373927_0004315 3300035695 Bacteria 9977
189 Ga0373927_0162503 3300035695 Bacteria 1463
190 Ga0373927_0241733 3300035695 Bacteria 1186
191 Ga0373947_0216200 3300035725 Bacteria 1259
192 Ga0373947_0270045 3300035725 Bacteria 1129
193 Ga0373937_0007180 3300036401 Bacteria 9635
194 Ga0373937_0080559 3300036401 Bacteria 3011
195 Ga0373937_0170633 3300036401 Bacteria 2041
196 Ga0373937_0303005 3300036401 Bacteria 1510
197 Ga0373925_0049717 3300037068 Bacteria 3125
198 Ga0373925_0050556 3300037068 Bacteria 3100
199 Ga0373925_0341633 3300037068 Bacteria 1214
200 Ga0436364_0349394 3300037853 Bacteria 10019
201 Ga0436364_0450547 3300037853 Bacteria 1116
202 Ga0436364_0505720 3300037853 Bacteria 3025
203 Ga0436364_0658113 3300037853 Bacteria 3103
204 Ga0436364_0982739 3300037853 Bacteria 6035
205 Ga0436364_1374474 3300037853 Bacteria 5315
206 Ga0436365_0784799 3300039437 Bacteria 1438
207 Ga0436365_0787718 3300039437 Bacteria 2492
208 Ga0436365_1107086 3300039437 Unclassified 3101
209 Ga0436365_1336426 3300039437 Bacteria 3292
210 Ga0436365_1400340 3300039437 Bacteria 18923
211 Ga0436363_0517065 3300039450 Unclassified 1950
212 Ga0436363_1431989 3300039450 Bacteria 1681
213 Ga0436362_0273079 3300039453 Bacteria 1428
214 Ga0466961_0040429 3300044693 Bacteria 2990
215 Ga0466963_0115578 3300044694 Bacteria 1844
216 Ga0466967_0001671 3300045976 Bacteria 13148
217 Ga0495592_0043123 3300046454 Bacteria 3376
218 Ga0495629_0050167 3300046459 Bacteria 2923
219 Ga0495641_0022400 3300046461 Bacteria 3161
220 Ga0495641_0046347 3300046461 Bacteria 1999
221 Ga0495651_0009545 3300046462 Bacteria 7455
222 Ga0495651_0195550 3300046462 Bacteria 1419
223 Ga0495653_0016530 3300046463 Bacteria 6004
224 Ga0495653_0018783 3300046463 Bacteria 5609
225 Ga0495653_0096314 3300046463 Bacteria 2152
226 Ga0495653_0186399 3300046463 Bacteria 1419
227 Ga0495582_0025491 3300046473 Bacteria 3239
228 Ga0495639_0007756 3300046475 Bacteria 4616
229 Ga0495639_0037048 3300046475 Bacteria 2186
230 Ga0495662_0031582 3300046476 Bacteria 2558
231 Ga0495664_0000669 3300046477 Bacteria 17420
232 Ga0495664_0019290 3300046477 Bacteria 3919
233 Ga0495664_0063229 3300046477 Bacteria 2205
234 Ga0495664_0166940 3300046477 Bacteria 1335
235 Ga0495608_0014035 3300046511 Bacteria 5559
236 Ga0495608_0155742 3300046511 Bacteria 1454
237 Ga0495618_0005179 3300046514 Bacteria 7969
238 Ga0495618_0104270 3300046514 Bacteria 1815
239 Ga0495618_0257767 3300046514 Bacteria 1092
240 Ga0495628_0010095 3300046516 Bacteria 8032
241 Ga0495666_0047421 3300046526 Bacteria 2069
242 Ga0495652_0014450 3300046529 Bacteria 7086
243 Ga0495652_0033366 3300046529 Bacteria 4493
244 Ga0495652_0185836 3300046529 Bacteria 1590
245 Ga0495640_0024128 3300046533 Bacteria 4424
246 Ga0495640_0048877 3300046533 Bacteria 2919
247 Ga0495640_0105596 3300046533 Bacteria 1845
248 Ga0495586_0038826 3300046535 Bacteria 2559
249 Ga0495587_0027553 3300046536 Bacteria 3459
250 Ga0495587_0096566 3300046536 Bacteria 1704
251 Ga0495645_0196190 3300046543 Bacteria 1372
252 Ga0495667_0002600 3300046559 Bacteria 12045
253 Ga0495667_0004641 3300046559 Bacteria 9290
254 Ga0495667_0030588 3300046559 Bacteria 3617
255 Ga0495667_0210214 3300046559 Bacteria 1243
256 Ga0495634_0006131 3300046642 Bacteria 9152
257 Ga0495634_0038739 3300046642 Bacteria 3248
258 Ga0495635_0010717 3300046663 Bacteria 6419
259 Ga0495635_0019187 3300046663 Bacteria 4770
260 Ga0495635_0025509 3300046663 Bacteria 4118
261 Ga0495635_0101194 3300046663 Bacteria 1969
262 Ga0495657_0043876 3300046675 Bacteria 3045
263 Ga0495657_0058116 3300046675 Bacteria 2569
264 Ga0495657_0142627 3300046675 Bacteria 1492
265 Ga0495599_0080831 3300046678 Bacteria 2029
266 Ga0495599_0096417 3300046678 Bacteria 1844
267 Ga0495623_0069179 3300046679 Bacteria 2200
268 Ga0495646_0013231 3300046680 Bacteria 5243
269 Ga0495646_0022205 3300046680 Bacteria 4003
270 Ga0495646_0044883 3300046680 Bacteria 2701
271 Ga0495646_0073176 3300046680 Bacteria 2014
272 Ga0495647_0025595 3300046681 Bacteria 2157
273 Ga0495613_0105269 3300046689 Bacteria 2036
274 Ga0495624_0004109 3300046690 Bacteria 10709
275 Ga0495624_0032608 3300046690 Bacteria 3377
276 Ga0495624_0036942 3300046690 Bacteria 3145
277 Ga0495624_0079861 3300046690 Bacteria 2028
278 Ga0495624_0108753 3300046690 Bacteria 1705
279 Ga0495600_0008620 3300046809 Bacteria 6271
280 Ga0495600_0132648 3300046809 Bacteria 1619
281 Ga0495604_0020353 3300047317 Bacteria 5301
282 Ga0495604_0067332 3300047317 Bacteria 2721
283 Ga0495604_0072280 3300047317 Bacteria 2607
284 Ga0495604_0119092 3300047317 Bacteria 1913
285 Ga0495604_0169238 3300047317 Bacteria 1538
286 Ga0495674_0011674 3300047319 Bacteria 8285
287 Ga0495674_0109534 3300047319 Bacteria 2342
288 Ga0495674_0226130 3300047319 Bacteria 1545
289 Ga0495674_0439429 3300047319 Bacteria 1049
290 Ga0495676_0012933 3300047321 Bacteria 7508
291 Ga0495676_0047692 3300047321 Bacteria 3460
292 Ga0495676_0087376 3300047321 Bacteria 2343
293 Ga0495680_0006995 3300047322 Bacteria 10404
294 Ga0495680_0009742 3300047322 Bacteria 8620
295 Ga0495680_0016358 3300047322 Bacteria 6376
296 Ga0495680_0022847 3300047322 Bacteria 5207
297 Ga0495680_0045042 3300047322 Bacteria 3485
298 Ga0495680_0137407 3300047322 Bacteria 1791
299 Ga0495675_0020838 3300047444 Bacteria 4172
300 Ga0495684_0014461 3300047471 Bacteria 6072
301 Ga0495684_0364020 3300047471 Bacteria 1023
302 Ga0495593_0165028 3300047673 Bacteria 1117
303 Ga0495602_0061088 3300048088 Bacteria 3279
304 Ga0495602_0130620 3300048088 Bacteria 2004
305 Ga0495602_0253370 3300048088 Bacteria 1310
306 Ga0496100_0036118 3300048903 Bacteria 3114
307 Ga0496104_0003691 3300048907 Bacteria 13211
308 Ga0496105_0010262 3300048908 Bacteria 7363
309 Ga0496106_0432894 3300048909 Bacteria 1057
310 Ga0496107_0034133 3300048910 Bacteria 3642
311 Ga0496108_0025252 3300048911 Bacteria 4896
312 Ga0496108_0033270 3300048911 Bacteria 4283
313 Ga0496110_0205737 3300048913 Bacteria 1789
314 Ga0496110_0289470 3300048913 Bacteria 1492
315 Ga0496110_0600321 3300048913 Bacteria 999
316 Ga0496111_0052755 3300048914 Bacteria 2937
317 Ga0496112_0085496 3300048915 Bacteria 3120
318 Ga0496114_0032070 3300048917 Bacteria 4322
319 Ga0496115_0007670 3300048918 Bacteria 7951
320 Ga0496115_0242470 3300048918 Bacteria 1485
321 Ga0501031_0153704 3300049568 Bacteria 1504
322 Ga0501036_0034320 3300049572 Bacteria 4292
323 Ga0501038_0424892 3300049574 Unclassified 1025
324 Ga0501039_0241428 3300049575 Bacteria 1420
325 Ga0501041_0122534 3300049577 Bacteria 1617
326 Ga0501068_0261976 3300049584 Bacteria 1103
327 Ga0501069_0000013 3300049585 Bacteria 147915
328 Ga0501069_0080616 3300049585 Bacteria 1833
329 Ga0501070_0000012 3300049586 Bacteria 188541
330 Ga0501070_0189496 3300049586 Bacteria 1691
331 Ga0501074_0228861 3300049590 Bacteria 1323
332 Ga0501075_0221493 3300049591 Bacteria 1443
333 Ga0501076_0173658 3300049592 Bacteria 1757
334 Ga0501080_0510885 3300049742 Bacteria 1073
335 nmdc:mga05p37_345071_c1 3300050507 Unclassified 1754
336 nmdc:mga09592_79453_c1 3300050508 Unclassified 2792
337 nmdc:mga06r32_163286_c1 3300050510 Bacteria 2210
338 nmdc:mga06r32_58164_c1 3300050510 Unclassified 3715
339 nmdc:mga08y16_220049_c1 3300050511 Bacteria 1966
340 nmdc:mga08y16_77016_c1 3300050511 Bacteria 3476
341 nmdc:mga0n895_192102_c1 3300050512 Bacteria 2073
342 Ga0495601_0042230 3300053077 Bacteria 2860
343 Ga0495601_0071692 3300053077 Bacteria 2212
344 Ga0495595_0007688 3300053084 Bacteria 4417
345 Ga0495619_0043022 3300053085 Bacteria 2960
346 Ga0495619_0098645 3300053085 Bacteria 1986
347 Ga0501084_0050342 3300054114 Bacteria 3487
348 Ga0501082_0089285 3300060353 Bacteria 2661
349 Ga0530510_0169047 3300061734 Bacteria 1619
350 2515852224 2515154155 Bacteria 7985436
351 2816504036 2816332139 Bacteria 9138787
352 2915772872 2915768154 Bacteria 8424322
353 8055070611 8055066027 Bacteria 9479577
354 8055173731 8055172936 Bacteria 9305943
355 Ga0070713_100055574
356 Ga0070658_10001070
357 Ga0070658_10012296
358 Ga0070683_100460658
359 Ga0070680_100002830
360 Ga0070680_100124005
361 Ga0070669_100123555
362 Ga0070703_10057735
363 Ga0070709_10002939
364 Ga0070709_10035743
365 Ga0070714_100003355
366 Ga0070714_100047820
367 Ga0070714_100078846
368 Ga0070714_100159207
369 Ga0070713_100041643
370 Ga0070710_10067023
371 Ga0070710_10089237
372 Ga0070710_10118084
373 Ga0070710_10280156
374 Ga0070711_100021415
375 Ga0070711_100133903
376 Ga0070711_100224928
377 Ga0070711_100376099
378 Ga0070705_100067856
379 Ga0070708_100068586
380 Ga0070708_100312585
381 Ga0070708_100507692
382 Ga0070681_10003041
383 Ga0070681_10269813
384 Ga0070706_100011428
385 Ga0070706_100039419
386 Ga0070706_100081546
387 Ga0070706_100350786
388 Ga0070706_100651454
389 Ga0070707_100026682
390 Ga0070707_100030777
391 Ga0070707_100161705
392 Ga0070707_100264076
393 Ga0070698_100009729
394 Ga0070698_100021807
395 Ga0070698_100039476
396 Ga0070698_100087879
397 Ga0070698_100116789
398 Ga0070699_100056377
399 Ga0070679_100000749
400 Ga0070679_100284877
401 Ga0070664_100454587
402 Ga0068856_100029906
403 Ga0068859_100046158
404 Ga0068864_100030069
405 Ga0068863_100009874
406 Ga0070717_10017633
407 Ga0070715_10026217
408 Ga0070716_100013188
409 Ga0070716_100030368
410 Ga0070712_100013506
411 Ga0070712_100040754
412 Ga0068871_100231283
413 Ga0068871_100260464
414 Ga0075428_100112183
415 Ga0075428_100357593
416 Ga0075431_100119205
417 Ga0075436_100032855
418 Ga0097620_100046158
419 Ga0075435_100103893
420 Ga0111539_10198545
421 Ga0114129_10433303
422 Ga0114129_10539083
423 Ga0105248_10139361
424 Ga0105237_10085383
425 Ga0105249_10123689
426 Ga0105239_10246051
427 Ga0105239_10525991
428 Ga0157369_10001522
429 Ga0157369_10139308
430 Ga0157374_10104610
431 Ga0157375_10061736
432 Ga0163163_10022175
433 Ga0157380_10389308
434 Ga0197907_11307954
435 Ga0206349_1123043
436 Ga0206352_10419987
437 Ga0206354_11415256
438 Ga0206353_10295195
439 Ga0206353_10693210
440 Ga0213876_10001905
441 Ga0213876_10050835
442 Ga0213876_10092178
443 Ga0213875_10015683
444 Ga0213875_10029763
445 Ga0213875_10121560
446 Ga0207692_10015574
447 Ga0207692_10082243
448 Ga0207685_10004945
449 Ga0207699_10002017
450 Ga0207699_10038681
451 Ga0207699_10090991
452 Ga0207699_10110691
453 Ga0207705_10004845
454 Ga0207705_10029930
455 Ga0207684_10006725
456 Ga0207684_10059864
457 Ga0207684_10242432
458 Ga0207707_10010136
459 Ga0207707_10227421
460 Ga0207693_10005745
461 Ga0207693_10032974
462 Ga0207663_10011536
463 Ga0207663_10017506
464 Ga0207663_10047972
465 Ga0207663_10134384
466 Ga0207660_10203198
467 Ga0207652_10027012
468 Ga0207652_10030202
469 Ga0207646_10105638
470 Ga0207646_10317689
471 Ga0207700_10003121
472 Ga0207700_10018222
473 Ga0207700_10033593
474 Ga0207700_10042635
475 Ga0207700_10051645
476 Ga0207664_10011241
477 Ga0207664_10020243
478 Ga0207664_10044854
479 Ga0207664_10069587
480 Ga0207664_10199663
481 Ga0207664_10239823
482 Ga0207644_10244413
483 Ga0207686_10406870
484 Ga0207670_10300476
485 Ga0207665_10006650
486 Ga0207665_10008709
487 Ga0207711_10157337
488 Ga0207661_10297313
489 Ga0207661_10302539
490 Ga0207667_10160583
491 Ga0207712_10130860
492 Ga0207677_10227650
493 Ga0207702_10113459
494 Ga0207641_10142609
495 Ga0207648_10301490
496 Ga0207683_10218138
497 Ga0268265_10126730
498 Ga0268265_10375713
499 Ga0265337_1000562
500 Ga0265326_10008472
501 Ga0265319_1003722
502 Ga0265334_10001506
503 Ga0265336_10013001
504 Ga0265338_10007855
505 Ga0265338_10136300
506 Ga0265332_10001378
507 Ga0265325_10018028
508 Ga0265327_10002425
509 Ga0265316_10004139
510 Ga0265314_10046456
511 Ga0265342_10004014
512 Ga0307407_10056369
513 Ga0307409_100111778
514 Ga0307414_10067196
515 Ga0307411_10104310
516 Ga0373930_0002252
517 Ga0373926_0004078
518 Ga0373926_0040207
519 Ga0373934_0002574
520 Ga0373934_0062234
521 Ga0373952_0027774
522 Ga0373923_0134133
523 Ga0373936_0001480
524 Ga0373936_0005798
525 Ga0373945_0000923
526 Ga0373953_0106309
527 Ga0373954_0063871
528 Ga0373954_0071345
529 Ga0373956_0084523
530 Ga0373957_0051366
531 Ga0373943_0000270
532 Ga0373943_0030056
533 Ga0373943_0072069
534 Ga0373946_0000423
535 Ga0373946_0055927
536 Ga0373946_0110122
537 Ga0373955_0072243
538 Ga0373955_0074087
539 Ga0373955_0095736
540 Ga0373955_0237820
541 Ga0373924_0057495
542 Ga0373927_0004315
543 Ga0373927_0162503
544 Ga0373927_0241733
545 Ga0373947_0216200
546 Ga0373947_0270045
547 Ga0373937_0007180
548 Ga0373937_0080559
549 Ga0373937_0170633
550 Ga0373937_0303005
551 Ga0373925_0049717
552 Ga0373925_0050556
553 Ga0373925_0341633
554 Ga0436364_0349394
555 Ga0436364_0450547
556 Ga0436364_0505720
557 Ga0436364_0658113
558 Ga0436364_0982739
559 Ga0436364_1374474
560 Ga0436365_0784799
561 Ga0436365_0787718
562 Ga0436365_1107086
563 Ga0436365_1336426
564 Ga0436365_1400340
565 Ga0436363_0517065
566 Ga0436363_1431989
567 Ga0436362_0273079
568 Ga0466961_0040429
569 Ga0466963_0115578
570 Ga0466967_0001671
571 Ga0495592_0043123
572 Ga0495629_0050167
573 Ga0495641_0022400
574 Ga0495641_0046347
575 Ga0495651_0009545
576 Ga0495651_0195550
577 Ga0495653_0016530
578 Ga0495653_0018783
579 Ga0495653_0096314
580 Ga0495653_0186399
581 Ga0495582_0025491
582 Ga0495639_0007756
583 Ga0495639_0037048
584 Ga0495662_0031582
585 Ga0495664_0000669
586 Ga0495664_0019290
587 Ga0495664_0063229
588 Ga0495664_0166940
589 Ga0495608_0014035
590 Ga0495608_0155742
591 Ga0495618_0005179
592 Ga0495618_0104270
593 Ga0495618_0257767
594 Ga0495628_0010095
595 Ga0495666_0047421
596 Ga0495652_0014450
597 Ga0495652_0033366
598 Ga0495652_0185836
599 Ga0495640_0024128
600 Ga0495640_0048877
601 Ga0495640_0105596
602 Ga0495586_0038826
603 Ga0495587_0027553
604 Ga0495587_0096566
605 Ga0495645_0196190
606 Ga0495667_0002600
607 Ga0495667_0004641
608 Ga0495667_0030588
609 Ga0495667_0210214
610 Ga0495634_0006131
611 Ga0495634_0038739
612 Ga0495635_0010717
613 Ga0495635_0019187
614 Ga0495635_0025509
615 Ga0495635_0101194
616 Ga0495657_0043876
617 Ga0495657_0058116
618 Ga0495657_0142627
619 Ga0495599_0080831
620 Ga0495599_0096417
621 Ga0495623_0069179
622 Ga0495646_0013231
623 Ga0495646_0022205
624 Ga0495646_0044883
625 Ga0495646_0073176
626 Ga0495647_0025595
627 Ga0495613_0105269
628 Ga0495624_0004109
629 Ga0495624_0032608
630 Ga0495624_0036942
631 Ga0495624_0079861
632 Ga0495624_0108753
633 Ga0495600_0008620
634 Ga0495600_0132648
635 Ga0495604_0020353
636 Ga0495604_0067332
637 Ga0495604_0072280
638 Ga0495604_0119092
639 Ga0495604_0169238
640 Ga0495674_0011674
641 Ga0495674_0109534
642 Ga0495674_0226130
643 Ga0495674_0439429
644 Ga0495676_0012933
645 Ga0495676_0047692
646 Ga0495676_0087376
647 Ga0495680_0006995
648 Ga0495680_0009742
649 Ga0495680_0016358
650 Ga0495680_0022847
651 Ga0495680_0045042
652 Ga0495680_0137407
653 Ga0495675_0020838
654 Ga0495684_0014461
655 Ga0495684_0364020
656 Ga0495593_0165028
657 Ga0495602_0061088
658 Ga0495602_0130620
659 Ga0495602_0253370
660 Ga0496100_0036118
661 Ga0496104_0003691
662 Ga0496105_0010262
663 Ga0496106_0432894
664 Ga0496107_0034133
665 Ga0496108_0025252
666 Ga0496108_0033270
667 Ga0496110_0205737
668 Ga0496110_0289470
669 Ga0496110_0600321
670 Ga0496111_0052755
671 Ga0496112_0085496
672 Ga0496114_0032070
673 Ga0496115_0007670
674 Ga0496115_0242470
675 Ga0501031_0153704
676 Ga0501036_0034320
677 Ga0501038_0424892
678 Ga0501039_0241428
679 Ga0501041_0122534
680 Ga0501068_0261976
681 Ga0501069_0000013
682 Ga0501069_0080616
683 Ga0501070_0000012
684 Ga0501070_0189496
685 Ga0501074_0228861
686 Ga0501075_0221493
687 Ga0501076_0173658
688 Ga0501080_0510885
689 nmdc:mga05p37_345071_c1
690 nmdc:mga09592_79453_c1
691 nmdc:mga06r32_163286_c1
692 nmdc:mga06r32_58164_c1
693 nmdc:mga08y16_220049_c1
694 nmdc:mga08y16_77016_c1
695 nmdc:mga0n895_192102_c1
696 Ga0495601_0042230
697 Ga0495601_0071692
698 Ga0495595_0007688
699 Ga0495619_0043022
700 Ga0495619_0098645
701 Ga0501084_0050342
702 Ga0501082_0089285
703 Ga0530510_0169047
704 2515852224
705 2816504036
706 2915772872
707 8055070611
708 8055173731

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00296

Bac_luciferase

Luciferase-like monooxygenase

23

301

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1z69-assembly1.cif.gz_B crystal structure of methylenetetrahydromethanopterin reductase (mer) in complex with coenzyme f420 0.8507 1 295
1z69-assembly1.cif.gz_B crystal structure of methylenetetrahydromethanopterin reductase (mer) in complex with coenzyme f420 0.8428 1 295
1ezw-assembly1.cif.gz_A structure of coenzyme f420 dependent tetrahydromethanopterin reductase from methanopyrus kandleri 0.8352 1 293
3c8n-assembly1.cif.gz_B crystal structure of apo-fgd1 from mycobacterium tuberculosis 0.8243 1 297
3c8n-assembly2.cif.gz_C crystal structure of apo-fgd1 from mycobacterium tuberculosis 0.824 1 297
ID Description Score Start End Superfamily
af_P9WM03_11_339_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8734 4 289 3.20.20.30
af_P9WM03_11_339_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8403 4 289 3.20.20.30
1ezwA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8351 1 293 3.20.20.30
af_O05772_7_317_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8299 15 297 3.20.20.30
1ezwA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8228 1 293 3.20.20.30
ID Description Score Start End GO Terms
AF-A0A3L7X1E1-F1-model_v4 TIGR03564 family F420-dependent LLM class oxidoreductase (EC 1.-.-.-) 0.983 1 295 GO:0016705
AF-A0A2E6E543-F1-model_v4 LLM class F420-dependent oxidoreductase 0.9815 1 295 GO:0016705
AF-A0A1S1RRK4-F1-model_v4 deleted 0.98 1 295
AF-A0A7C4TGW9-F1-model_v4 TIGR03564 family F420-dependent LLM class oxidoreductase (EC 1.-.-.-) 0.9793 60 295 GO:0016705
AF-A0A1Z9ASS0-F1-model_v4 Luciferase-like domain-containing protein 0.9774 1 294 GO:0016705

Map