F419600

General Info

Members Datasets Scaffolds Average Seq Length
354 230 354 525

Family's Representative Sequence

Representative Sequence 3300001991|JGI24743J22301_10003927|JGI24743J22301_100039272
Length 557
Sequence MLRRDDPSPLPEQPLHGGLHTRPSLPEAVRAQEEALRMLSDGELARLLDGAARMPVERARQVFVNRNLRLGNVEMVGFDMDYTLAIYHLRRIEQLSFDLTLSRLVAEFGYPSEVGLIQYDHEFVMRGLVVDKAQGNLIKMDRFGSVGRAYHGLAPLPPEVCHRQYRNERIRLTTERYAWIDTLFSLPEAWLYAAIIDLLERQGRKVEYARLYDDVREAIDAVHRDDSLKREVRKDIGRYIFRDPELGPALHKLRSGGKKLFLLTNSLWDYTDVVMSFLLDGVVSEYPSWRNYFDVVVTGAMKPAFFTEGRPFLEIDSTNRENRVIGEAKALERWKVYQGGNLPALERMTGIGGEKVLYVGDHIYGDILRSRKASLWRTCMVVQELEDEIRYTEGRAEEITRLGEVELLLARLDDELNVRKGQLNALDRRLDRNGGAEXERALLEEDRRRAKTDLERLRRALRSSVEIADVLERDVELGFNPFWGLLFKEGNENSRFGSQVEQYACLYTSRVSNFLYLSPMQYLRAQRDRMPHEMAGAPTGRMAPVGSEGPSKGARRG

Samples

Sample ID Description Type Environment
1 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
160 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
161 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
162 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
163 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
164 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
165 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
166 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
167 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
168 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
169 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
170 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
171 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
172 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
173 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
174 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
175 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
176 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
177 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
178 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
179 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
180 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
181 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
182 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
183 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
184 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
185 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
186 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
187 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
188 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
189 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
190 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
191 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
192 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
193 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
194 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
195 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
196 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
197 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
198 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
199 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
200 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
201 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
208 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
209 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
210 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
211 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
212 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
213 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
214 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
215 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
216 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
217 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
218 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
220 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
221 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
222 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
223 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
224 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
225 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
226 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
227 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
228 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
229 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
230 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.41
Nodule 0
Rhizoplane 3.95
Rhizosphere 92.09
Stem 0
Stem Tuber 0
Unclassified 2.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10003927 3300001991 Bacteria 2383
2 rootH1_10053408 3300003323 Bacteria 6682
3 Ga0070658_10000789 3300005327 Bacteria 27151
4 Ga0070676_10000457 3300005328 Bacteria 19507
5 Ga0070683_100004701 3300005329 Bacteria 11287
6 Ga0070683_100044004 3300005329 Bacteria 4116
7 Ga0070690_100001609 3300005330 Bacteria 11855
8 Ga0070670_100004825 3300005331 Bacteria 11330
9 Ga0070670_100053593 3300005331 Bacteria 3464
10 Ga0070677_10000257 3300005333 Bacteria 18315
11 Ga0068869_100000821 3300005334 Bacteria 17718
12 Ga0070666_10006821 3300005335 Bacteria 7037
13 Ga0070680_100165127 3300005336 Bacteria 1861
14 Ga0070682_100019838 3300005337 Bacteria 3948
15 Ga0070682_100065516 3300005337 Bacteria 2309
16 Ga0068868_100000319 3300005338 Bacteria 32296
17 Ga0070660_100000968 3300005339 Bacteria 19214
18 Ga0070689_100000023 3300005340 Bacteria 116923
19 Ga0070689_100003822 3300005340 Bacteria 10085
20 Ga0070687_100000001 3300005343 Bacteria 110332
21 Ga0070661_100000972 3300005344 Bacteria 20404
22 Ga0070692_10001883 3300005345 Bacteria 7906
23 Ga0070668_100000728 3300005347 Bacteria 22563
24 Ga0070668_100041684 3300005347 Bacteria 3517
25 Ga0070669_100002062 3300005353 Bacteria 14540
26 Ga0070675_100034674 3300005354 Bacteria 4097
27 Ga0070671_100002728 3300005355 Bacteria 13709
28 Ga0070671_100061643 3300005355 Bacteria 3124
29 Ga0070674_100000935 3300005356 Bacteria 15229
30 Ga0070673_100002021 3300005364 Bacteria 12232
31 Ga0070673_100003824 3300005364 Bacteria 9443
32 Ga0070688_100000541 3300005365 Bacteria 19067
33 Ga0070688_100026275 3300005365 Bacteria 3458
34 Ga0070659_100005646 3300005366 Bacteria 8994
35 Ga0070667_100006323 3300005367 Bacteria 9844
36 Ga0070701_10018144 3300005438 Bacteria 3303
37 Ga0070705_100012854 3300005440 Bacteria 4269
38 Ga0070705_100045787 3300005440 Bacteria 2519
39 Ga0070700_100006737 3300005441 Bacteria 6155
40 Ga0070700_100051573 3300005441 Bacteria 2561
41 Ga0070694_100050426 3300005444 Bacteria 2806
42 Ga0070708_100038583 3300005445 Bacteria 4174
43 Ga0070663_100015351 3300005455 Bacteria 4941
44 Ga0070678_100000476 3300005456 Bacteria 19206
45 Ga0070662_100002372 3300005457 Bacteria 11576
46 Ga0070681_10026159 3300005458 Bacteria 5868
47 Ga0070681_10048978 3300005458 Bacteria 4220
48 Ga0068867_100008832 3300005459 Bacteria 7112
49 Ga0070685_10014429 3300005466 Bacteria 4184
50 Ga0070706_100000505 3300005467 Bacteria 45815
51 Ga0070699_100043305 3300005518 Bacteria 3897
52 Ga0070697_100006669 3300005536 Bacteria 8956
53 Ga0068853_100000581 3300005539 Bacteria 24980
54 Ga0068853_100002218 3300005539 Bacteria 14522
55 Ga0070672_100008137 3300005543 Bacteria 7168
56 Ga0070686_100002121 3300005544 Bacteria 10935
57 Ga0070686_100009653 3300005544 Bacteria 5424
58 Ga0070686_100102507 3300005544 Bacteria 1936
59 Ga0070695_100015099 3300005545 Bacteria 4661
60 Ga0070696_100033501 3300005546 Bacteria 3530
61 Ga0070665_100130580 3300005548 Bacteria 2514
62 Ga0070704_100009468 3300005549 Bacteria 5887
63 Ga0068855_100002860 3300005563 Bacteria 21211
64 Ga0068855_100073554 3300005563 Bacteria 3970
65 Ga0070664_100001665 3300005564 Bacteria 17783
66 Ga0070664_100005483 3300005564 Bacteria 10188
67 Ga0068857_100003118 3300005577 Bacteria 13716
68 Ga0068857_100007586 3300005577 Bacteria 9340
69 Ga0068854_100002187 3300005578 Bacteria 12024
70 Ga0068856_100000478 3300005614 Bacteria 44261
71 Ga0070702_100016658 3300005615 Bacteria 3775
72 Ga0068852_100002165 3300005616 Bacteria 13490
73 Ga0068859_100007398 3300005617 Bacteria 11144
74 Ga0068864_100001550 3300005618 Bacteria 18961
75 Ga0068866_10001770 3300005718 Bacteria 9091
76 Ga0068861_100001466 3300005719 Bacteria 14945
77 Ga0068851_10000290 3300005834 Bacteria 23010
78 Ga0068870_10000085 3300005840 Bacteria 30429
79 Ga0068863_100002421 3300005841 Bacteria 18520
80 Ga0068858_100044865 3300005842 Bacteria 4097
81 Ga0068862_100007583 3300005844 Bacteria 8995
82 Ga0081540_1000162 3300005983 Bacteria 68999
83 Ga0081540_1003667 3300005983 Bacteria 12045
84 Ga0070717_10006725 3300006028 Bacteria 8482
85 Ga0070717_10008724 3300006028 Bacteria 7584
86 Ga0097621_100003694 3300006237 Bacteria 10587
87 Ga0068871_100009826 3300006358 Bacteria 6944
88 Ga0075431_100111647 3300006847 Bacteria 2821
89 Ga0075433_10109808 3300006852 Bacteria 2447
90 Ga0075434_100197573 3300006871 Bacteria 2031
91 Ga0075429_100010125 3300006880 Bacteria 8169
92 Ga0068865_100001485 3300006881 Bacteria 13656
93 Ga0097620_100007398 3300006931 Bacteria 11144
94 Ga0099794_10003772 3300007265 Bacteria 5844
95 Ga0099794_10025638 3300007265 Bacteria 2718
96 Ga0105240_10007962 3300009093 Bacteria 15283
97 Ga0105240_10021881 3300009093 Bacteria 8495
98 Ga0105245_10000703 3300009098 Bacteria 30139
99 Ga0105247_10000492 3300009101 Bacteria 32764
100 Ga0114129_10005395 3300009147 Bacteria 18049
101 Ga0105243_10044290 3300009148 Bacteria 3491
102 Ga0105241_10002408 3300009174 Bacteria 14053
103 Ga0105248_10005923 3300009177 Bacteria 13438
104 Ga0105237_10000276 3300009545 Bacteria 71919
105 Ga0105237_10004995 3300009545 Bacteria 15109
106 Ga0105237_10104430 3300009545 Bacteria 2825
107 Ga0105238_10000744 3300009551 Bacteria 34002
108 Ga0105238_10022262 3300009551 Bacteria 6461
109 Ga0105238_10072872 3300009551 Bacteria 3429
110 Ga0105249_10001984 3300009553 Bacteria 17764
111 Ga0105239_10000686 3300010375 Bacteria 48254
112 Ga0105246_10000797 3300011119 Bacteria 17893
113 Ga0157373_10007018 3300013100 Bacteria 8392
114 Ga0157371_10000234 3300013102 Bacteria 79682
115 Ga0157369_10006018 3300013105 Bacteria 14092
116 Ga0157374_10001417 3300013296 Bacteria 20318
117 Ga0157374_10056262 3300013296 Bacteria 3672
118 Ga0157378_10000488 3300013297 Bacteria 37515
119 Ga0163162_10010695 3300013306 Bacteria 8926
120 Ga0157372_10003128 3300013307 Bacteria 17837
121 Ga0157372_10132659 3300013307 Bacteria 2867
122 Ga0157375_10004505 3300013308 Bacteria 12113
123 Ga0163163_10004857 3300014325 Bacteria 11552
124 Ga0182008_10054381 3300014497 Bacteria 1981
125 Ga0157379_10000471 3300014968 Bacteria 32717
126 Ga0157376_10003479 3300014969 Bacteria 10854
127 Ga0207697_10000389 3300025315 Bacteria 24664
128 Ga0207656_10000890 3300025321 Bacteria 9753
129 Ga0207642_10000989 3300025899 Bacteria 8880
130 Ga0207710_10006664 3300025900 Bacteria 4922
131 Ga0207688_10000003 3300025901 Bacteria 78666
132 Ga0207680_10001715 3300025903 Bacteria 10337
133 Ga0207647_10005253 3300025904 Bacteria 9531
134 Ga0207645_10001425 3300025907 Bacteria 19566
135 Ga0207645_10001790 3300025907 Bacteria 17351
136 Ga0207643_10000011 3300025908 Bacteria 150819
137 Ga0207705_10001396 3300025909 Bacteria 19248
138 Ga0207705_10010632 3300025909 Bacteria 6686
139 Ga0207705_10053363 3300025909 Bacteria 2912
140 Ga0207684_10000062 3300025910 Bacteria 202863
141 Ga0207654_10012350 3300025911 Bacteria 4377
142 Ga0207707_10074282 3300025912 Bacteria 2965
143 Ga0207695_10001125 3300025913 Bacteria 46438
144 Ga0207695_10022092 3300025913 Bacteria 7237
145 Ga0207671_10000434 3300025914 Bacteria 57541
146 Ga0207671_10001549 3300025914 Bacteria 26297
147 Ga0207662_10000004 3300025918 Bacteria 128333
148 Ga0207662_10058927 3300025918 Bacteria 2300
149 Ga0207657_10005694 3300025919 Bacteria 13000
150 Ga0207649_10002850 3300025920 Bacteria 9543
151 Ga0207649_10008357 3300025920 Bacteria 5641
152 Ga0207652_10012603 3300025921 Bacteria 6834
153 Ga0207652_10025322 3300025921 Bacteria 4932
154 Ga0207652_10029084 3300025921 Bacteria 4616
155 Ga0207646_10029447 3300025922 Bacteria 4990
156 Ga0207681_10000598 3300025923 Bacteria 24547
157 Ga0207681_10002551 3300025923 Bacteria 11562
158 Ga0207694_10003200 3300025924 Bacteria 13063
159 Ga0207650_10000993 3300025925 Bacteria 21350
160 Ga0207659_10002952 3300025926 Bacteria 10129
161 Ga0207659_10103376 3300025926 Bacteria 2153
162 Ga0207687_10005000 3300025927 Bacteria 8780
163 Ga0207644_10007124 3300025931 Bacteria 7288
164 Ga0207690_10003999 3300025932 Bacteria 8706
165 Ga0207706_10000152 3300025933 Bacteria 76168
166 Ga0207670_10000029 3300025936 Bacteria 116950
167 Ga0207670_10000208 3300025936 Bacteria 38511
168 Ga0207670_10102515 3300025936 Bacteria 2046
169 Ga0207669_10000558 3300025937 Bacteria 16280
170 Ga0207704_10000423 3300025938 Bacteria 18964
171 Ga0207691_10000457 3300025940 Bacteria 40411
172 Ga0207711_10001955 3300025941 Bacteria 18716
173 Ga0207689_10000245 3300025942 Bacteria 48509
174 Ga0207689_10061667 3300025942 Bacteria 3084
175 Ga0207661_10003972 3300025944 Bacteria 10332
176 Ga0207661_10006089 3300025944 Bacteria 8520
177 Ga0207661_10035071 3300025944 Bacteria 3907
178 Ga0207679_10000447 3300025945 Bacteria 29118
179 Ga0207679_10001548 3300025945 Bacteria 14378
180 Ga0207667_10003606 3300025949 Bacteria 19102
181 Ga0207667_10035672 3300025949 Bacteria 5335
182 Ga0207651_10000491 3300025960 Bacteria 16601
183 Ga0207651_10006716 3300025960 Bacteria 6061
184 Ga0207712_10000573 3300025961 Bacteria 29698
185 Ga0207668_10002430 3300025972 Bacteria 10879
186 Ga0207640_10000709 3300025981 Bacteria 19311
187 Ga0207658_10001389 3300025986 Bacteria 18870
188 Ga0207677_10000407 3300026023 Bacteria 29633
189 Ga0207677_10069937 3300026023 Bacteria 2471
190 Ga0207703_10001839 3300026035 Bacteria 18903
191 Ga0207639_10001153 3300026041 Bacteria 17949
192 Ga0207639_10014203 3300026041 Bacteria 5592
193 Ga0207639_10043072 3300026041 Bacteria 3386
194 Ga0207678_10006655 3300026067 Bacteria 10244
195 Ga0207708_10000638 3300026075 Bacteria 26946
196 Ga0207702_10004732 3300026078 Bacteria 12025
197 Ga0207702_10125637 3300026078 Bacteria 2302
198 Ga0207641_10007392 3300026088 Bacteria 9139
199 Ga0207648_10000094 3300026089 Bacteria 84345
200 Ga0207648_10012237 3300026089 Bacteria 8035
201 Ga0207676_10021116 3300026095 Bacteria 4774
202 Ga0207674_10000255 3300026116 Bacteria 66477
203 Ga0207674_10012517 3300026116 Bacteria 9478
204 Ga0207674_10070068 3300026116 Bacteria 3525
205 Ga0207675_100000004 3300026118 Bacteria 210328
206 Ga0207683_10000007 3300026121 Bacteria 175543
207 Ga0207698_10001286 3300026142 Bacteria 14631
208 Ga0207428_10029847 3300027907 Bacteria 4512
209 Ga0268266_10004317 3300028379 Bacteria 13672
210 Ga0268265_10000375 3300028380 Bacteria 48217
211 Ga0268264_10000729 3300028381 Bacteria 37671
212 Ga0268264_10063030 3300028381 Bacteria 3115
213 Ga0265318_10000027 3300028577 Bacteria 153682
214 Ga0265318_10000591 3300028577 Bacteria 25424
215 Ga0265318_10021241 3300028577 Bacteria 2609
216 Ga0307515_10010206 3300028794 Bacteria 18037
217 Ga0265338_10029999 3300028800 Bacteria 5375
218 Ga0265338_10037556 3300028800 Bacteria 4607
219 Ga0265338_10039730 3300028800 Bacteria 4433
220 Ga0265338_10086166 3300028800 Bacteria 2615
221 Ga0265330_10000126 3300031235 Bacteria 62021
222 Ga0265330_10007561 3300031235 Bacteria 5285
223 Ga0265332_10000649 3300031238 Bacteria 22574
224 Ga0265332_10001740 3300031238 Bacteria 11831
225 Ga0265332_10022259 3300031238 Bacteria 2797
226 Ga0265328_10004087 3300031239 Bacteria 6378
227 Ga0265328_10005349 3300031239 Bacteria 5503
228 Ga0265320_10000018 3300031240 Bacteria 183411
229 Ga0265320_10004977 3300031240 Bacteria 8615
230 Ga0265320_10007432 3300031240 Bacteria 6798
231 Ga0265325_10057630 3300031241 Bacteria 1981
232 Ga0265329_10001562 3300031242 Bacteria 10959
233 Ga0265329_10002760 3300031242 Bacteria 7859
234 Ga0265339_10002232 3300031249 Bacteria 14034
235 Ga0265331_10000046 3300031250 Bacteria 183360
236 Ga0265331_10001033 3300031250 Bacteria 21699
237 Ga0265316_10002028 3300031344 Bacteria 21327
238 Ga0265316_10016236 3300031344 Bacteria 6464
239 Ga0265316_10085043 3300031344 Bacteria 2421
240 Ga0307513_10004573 3300031456 Bacteria 18438
241 Ga0307509_10000069 3300031507 Bacteria 141246
242 Ga0307509_10002164 3300031507 Bacteria 32269
243 Ga0307509_10062458 3300031507 Bacteria 3928
244 Ga0307509_10070519 3300031507 Bacteria 3649
245 Ga0265313_10000489 3300031595 Bacteria 41771
246 Ga0265313_10018533 3300031595 Bacteria 3904
247 Ga0265314_10000283 3300031711 Bacteria 73858
248 Ga0265314_10003757 3300031711 Bacteria 14527
249 Ga0265314_10039352 3300031711 Bacteria 3406
250 Ga0265314_10094690 3300031711 Bacteria 1935
251 Ga0265342_10000064 3300031712 Bacteria 113079
252 Ga0265342_10001601 3300031712 Bacteria 20888
253 Ga0265342_10003468 3300031712 Bacteria 12916
254 Ga0265342_10003911 3300031712 Bacteria 11966
255 Ga0373950_0000001 3300034818 Bacteria 1001987
256 Ga0373950_0000038 3300034818 Bacteria 117886
257 Ga0373934_0026639 3300035086 Bacteria 2243
258 Ga0373949_0002092 3300035090 Bacteria 5260
259 Ga0373936_0000012 3300035113 Bacteria 228915
260 Ga0373954_0045275 3300035118 Bacteria 2055
261 Ga0373956_0004762 3300035119 Bacteria 5430
262 Ga0373955_0012718 3300035172 Bacteria 4053
263 Ga0373955_0045894 3300035172 Bacteria 2360
264 Ga0373933_0000365 3300035724 Bacteria 28941
265 Ga0373933_0048417 3300035724 Bacteria 2531
266 Ga0373937_0001210 3300036401 Bacteria 21731
267 Ga0373937_0013602 3300036401 Bacteria 7170
268 Ga0373937_0031062 3300036401 Bacteria 4837
269 Ga0373937_0086521 3300036401 Bacteria 2900
270 Ga0436365_0226075 3300039437 Bacteria 1966
271 Ga0436363_1485290 3300039450 Bacteria 1755
272 Ga0451577_0000119 3300042876 Bacteria 172779
273 Ga0451577_0040064 3300042876 Bacteria 4207
274 Ga0451577_0102809 3300042876 Bacteria 2553
275 Ga0451577_0181901 3300042876 Bacteria 1895
276 Ga0451577_0199012 3300042876 Bacteria 1808
277 Ga0451577_0221701 3300042876 Bacteria 1709
278 Ga0453683_0000715 3300044673 Bacteria 34227
279 Ga0453683_0002564 3300044673 Bacteria 14006
280 Ga0453683_0003728 3300044673 Bacteria 11120
281 Ga0453683_0012833 3300044673 Bacteria 5482
282 Ga0453683_0076662 3300044673 Bacteria 2093
283 Ga0453683_0098742 3300044673 Bacteria 1833
284 Ga0453684_0000258 3300044712 Bacteria 228312
285 Ga0453684_0001130 3300044712 Bacteria 83545
286 Ga0453684_0002024 3300044712 Bacteria 51806
287 Ga0453684_0004266 3300044712 Bacteria 30523
288 Ga0453684_0005592 3300044712 Bacteria 24763
289 Ga0453684_0011247 3300044712 Bacteria 15063
290 Ga0453684_0063450 3300044712 Bacteria 4725
291 Ga0453684_0071030 3300044712 Bacteria 4404
292 Ga0453684_0100280 3300044712 Bacteria 3544
293 Ga0453684_0103186 3300044712 Bacteria 3485
294 Ga0451576_0000966 3300045051 Bacteria 53767
295 Ga0451576_0006566 3300045051 Bacteria 14234
296 Ga0451576_0031232 3300045051 Bacteria 5681
297 Ga0451576_0178723 3300045051 Bacteria 2216
298 Ga0451576_0315725 3300045051 Bacteria 1635
299 Ga0495658_0012288 3300046683 Bacteria 4332
300 Ga0496101_0021099 3300048904 Bacteria 4471
301 Ga0496102_0026492 3300048905 Bacteria 5172
302 Ga0496103_0123684 3300048906 Bacteria 1649
303 Ga0496105_0118908 3300048908 Bacteria 2180
304 Ga0496106_0004085 3300048909 Bacteria 10889
305 Ga0496106_0084248 3300048909 Bacteria 2446
306 Ga0496108_0032582 3300048911 Bacteria 4329
307 Ga0496108_0052951 3300048911 Bacteria 3402
308 Ga0496109_0003227 3300048912 Bacteria 13578
309 Ga0496109_0030485 3300048912 Bacteria 4834
310 Ga0496112_0000583 3300048915 Bacteria 25057
311 Ga0496114_0001486 3300048917 Bacteria 17798
312 Ga0496114_0008181 3300048917 Bacteria 8291
313 Ga0496114_0009521 3300048917 Bacteria 7707
314 Ga0501034_0001788 3300049571 Bacteria 27444
315 Ga0501036_0030534 3300049572 Bacteria 4551
316 Ga0501043_0010349 3300049579 Bacteria 7311
317 Ga0501046_0000885 3300049580 Bacteria 29144
318 Ga0501047_0000078 3300049581 Bacteria 123338
319 Ga0501048_0002434 3300049582 Bacteria 14206
320 Ga0501067_0000011 3300049583 Bacteria 115694
321 Ga0501067_0007119 3300049583 Bacteria 6211
322 Ga0501067_0091707 3300049583 Bacteria 1686
323 Ga0501068_0020400 3300049584 Bacteria 3860
324 Ga0501069_0013897 3300049585 Bacteria 4298
325 Ga0501070_0000021 3300049586 Bacteria 168438
326 Ga0501070_0005279 3300049586 Bacteria 11020
327 Ga0501072_0000111 3300049588 Bacteria 59988
328 Ga0501073_0000153 3300049589 Bacteria 45756
329 Ga0501073_0010740 3300049589 Bacteria 6706
330 Ga0501073_0015760 3300049589 Bacteria 5478
331 Ga0501073_0022605 3300049589 Bacteria 4525
332 Ga0501074_0007135 3300049590 Bacteria 8074
333 Ga0501074_0094995 3300049590 Bacteria 2135
334 Ga0501079_0004458 3300049741 Bacteria 10379
335 Ga0501080_0001290 3300049742 Bacteria 20839
336 Ga0501080_0085591 3300049742 Bacteria 2929
337 Ga0501081_0078291 3300049743 Bacteria 2311
338 Ga0501083_0000377 3300049744 Bacteria 28170
339 Ga0501083_0006052 3300049744 Bacteria 8571
340 Ga0501035_0001110 3300049822 Bacteria 28205
341 Ga0501044_0158504 3300049823 Bacteria 2242
342 nmdc:mga09592_15719_c1 3300050508 Bacteria 6184
343 nmdc:mga0n895_103530_c1 3300050512 Bacteria 2858
344 nmdc:mga0a205_111647_c1 3300050515 Bacteria 2633
345 Ga0500640_000111 3300053095 Bacteria 14911
346 Ga0500572_007939 3300053111 Bacteria 2468
347 Ga0500595_000342 3300053119 Bacteria 30337
348 Ga0500608_069252 3300053122 Bacteria 1679
349 Ga0500614_001785 3300053123 Bacteria 4990
350 Ga0501084_0000015 3300054114 Bacteria 159007
351 Ga0501084_0194772 3300054114 Bacteria 1710
352 Ga0501082_0000686 3300060353 Bacteria 29836
353 Ga0501082_0036010 3300060353 Bacteria 4264
354 Ga0530510_0017130 3300061734 Bacteria 5132

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049583 Ga0501067_0091707 Ga0501067_0091707_10_1380 428
2 3300048911 Ga0496108_0032582 Ga0496108_0032582_840_2339 443
3 3300048912 Ga0496109_0030485 Ga0496109_0030485_211_1710 443
4 3300049742 Ga0501080_0085591 Ga0501080_0085591_1357_2793 449
5 3300054114 Ga0501084_0194772 Ga0501084_0194772_115_1629 452
6 3300005347 Ga0070668_100041684 Ga0070668_1000416842 454
7 3300005441 Ga0070700_100051573 Ga0070700_1000515732 454
8 3300025907 Ga0207645_10001425 Ga0207645_100014253 454
9 3300025923 Ga0207681_10002551 Ga0207681_100025513 454
10 3300026075 Ga0207708_10000638 Ga0207708_1000063820 454
11 3300026089 Ga0207648_10012237 Ga0207648_100122375 454
12 3300028381 Ga0268264_10063030 Ga0268264_100630302 454
13 3300042876 Ga0451577_0221701 Ga0451577_0221701_163_1677 454
14 3300049585 Ga0501069_0013897 Ga0501069_0013897_2730_4217 457
15 3300035086 Ga0373934_0026639 Ga0373934_0026639_640_2175 459
16 3300035724 Ga0373933_0000365 Ga0373933_0000365_9229_10764 459
17 3300005329 Ga0070683_100004701 Ga0070683_1000047013 460
18 3300005563 Ga0068855_100073554 Ga0068855_1000735542 460
19 3300049586 Ga0501070_0000021 Ga0501070_0000021_46007_47497 462
20 3300049743 Ga0501081_0078291 Ga0501081_0078291_778_2268 462
21 3300034818 Ga0373950_0000038 Ga0373950_0000038_31529_33010 463
22 3300049589 Ga0501073_0022605 Ga0501073_0022605_806_2305 463
23 3300049744 Ga0501083_0006052 Ga0501083_0006052_5607_7106 463
24 3300060353 Ga0501082_0036010 Ga0501082_0036010_897_2396 463
25 3300005331 Ga0070670_100053593 Ga0070670_1000535932 464
26 3300006847 Ga0075431_100111647 Ga0075431_1001116471 464
27 3300006880 Ga0075429_100010125 Ga0075429_1000101259 464
28 3300050508 nmdc:mga09592_15719_c1 nmdc:mga09592_15719_c1_3179_4696 464
29 3300049571 Ga0501034_0001788 Ga0501034_0001788_21737_23215 465
30 3300049572 Ga0501036_0030534 Ga0501036_0030534_30_1508 465
31 3300049579 Ga0501043_0010349 Ga0501043_0010349_1602_3080 465
32 3300049580 Ga0501046_0000885 Ga0501046_0000885_21406_22884 465
33 3300049581 Ga0501047_0000078 Ga0501047_0000078_51698_53176 465
34 3300049582 Ga0501048_0002434 Ga0501048_0002434_7789_9267 465
35 3300049584 Ga0501068_0020400 Ga0501068_0020400_1650_3128 465
36 3300049586 Ga0501070_0005279 Ga0501070_0005279_6461_7939 465
37 3300049588 Ga0501072_0000111 Ga0501072_0000111_9884_11362 465
38 3300049590 Ga0501074_0007135 Ga0501074_0007135_6094_7572 465
39 3300049741 Ga0501079_0004458 Ga0501079_0004458_6426_7904 465
40 3300049742 Ga0501080_0001290 Ga0501080_0001290_16198_17676 465
41 3300049744 Ga0501083_0000377 Ga0501083_0000377_21702_23180 465
42 3300049823 Ga0501044_0158504 Ga0501044_0158504_697_2175 465
43 3300054114 Ga0501084_0000015 Ga0501084_0000015_105836_107314 465
44 3300060353 Ga0501082_0000686 Ga0501082_0000686_6942_8420 465
45 3300025942 Ga0207689_10061667 Ga0207689_100616672 467
46 3300039437 Ga0436365_0226075 Ga0436365_0226075_356_1870 467
47 3300005544 Ga0070686_100009653 Ga0070686_1000096532 468
48 3300007265 Ga0099794_10025638 Ga0099794_100256381 468
49 3300025936 Ga0207670_10102515 Ga0207670_101025151 468
50 3300027907 Ga0207428_10029847 Ga0207428_100298472 468
51 3300031241 Ga0265325_10057630 Ga0265325_100576302 468
52 3300044673 Ga0453683_0098742 Ga0453683_0098742_116_1669 468
53 3300005329 Ga0070683_100044004 Ga0070683_1000440042 469
54 3300005364 Ga0070673_100003824 Ga0070673_1000038247 469
55 3300025944 Ga0207661_10035071 Ga0207661_100350712 469
56 3300025960 Ga0207651_10006716 Ga0207651_100067162 469
57 3300048904 Ga0496101_0021099 Ga0496101_0021099_2720_4234 469
58 3300048917 Ga0496114_0008181 Ga0496114_0008181_826_2340 469
59 3300049589 Ga0501073_0015760 Ga0501073_0015760_3606_5237 469
60 3300005617 Ga0068859_100007398 Ga0068859_1000073982 470
61 3300006931 Ga0097620_100007398 Ga0097620_1000073982 470
62 3300025921 Ga0207652_10029084 Ga0207652_100290843 470
63 3300025944 Ga0207661_10003972 Ga0207661_100039723 470
64 3300025949 Ga0207667_10035672 Ga0207667_100356723 470
65 3300034818 Ga0373950_0000001 Ga0373950_0000001_131533_133017 470
66 3300042876 Ga0451577_0199012 Ga0451577_0199012_13_1449 470
67 3300048908 Ga0496105_0118908 Ga0496105_0118908_118_1632 470
68 3300048917 Ga0496114_0009521 Ga0496114_0009521_1537_3051 470
69 3300049583 Ga0501067_0000011 Ga0501067_0000011_19705_21189 470
70 3300049589 Ga0501073_0000153 Ga0501073_0000153_32348_33832 470
71 3300048909 Ga0496106_0084248 Ga0496106_0084248_245_1783 475
72 3300005544 Ga0070686_100102507 Ga0070686_1001025072 477
73 3300031456 Ga0307513_10004573 Ga0307513_100045734 477
74 3300005539 Ga0068853_100002218 Ga0068853_1000022188 478
75 3300026041 Ga0207639_10014203 Ga0207639_100142033 478
76 3300031238 Ga0265332_10022259 Ga0265332_100222592 478
77 3300031344 Ga0265316_10085043 Ga0265316_100850432 478
78 3300031711 Ga0265314_10094690 Ga0265314_100946902 478
79 3300035090 Ga0373949_0002092 Ga0373949_0002092_1719_3239 478
80 3300035118 Ga0373954_0045275 Ga0373954_0045275_178_1749 478
81 3300036401 Ga0373937_0031062 Ga0373937_0031062_2355_3926 478
82 3300045051 Ga0451576_0315725 Ga0451576_0315725_156_1592 478
83 3300009545 Ga0105237_10104430 Ga0105237_101044302 479
84 3300025918 Ga0207662_10058927 Ga0207662_100589272 479
85 3300026041 Ga0207639_10043072 Ga0207639_100430723 480
86 3300031507 Ga0307509_10002164 Ga0307509_1000216410 480
87 3300035172 Ga0373955_0045894 Ga0373955_0045894_529_2061 481
88 3300036401 Ga0373937_0086521 Ga0373937_0086521_1217_2749 481
89 3300048917 Ga0496114_0001486 Ga0496114_0001486_16003_17553 481
90 3300048906 Ga0496103_0123684 Ga0496103_0123684_31_1482 483
91 3300009551 Ga0105238_10072872 Ga0105238_100728722 484
92 3300028800 Ga0265338_10037556 Ga0265338_100375562 484
93 3300042876 Ga0451577_0102809 Ga0451577_0102809_64_1680 484
94 3300049589 Ga0501073_0010740 Ga0501073_0010740_3927_5447 485
95 3300049590 Ga0501074_0094995 Ga0501074_0094995_437_1957 485
96 3300005327 Ga0070658_10000789 Ga0070658_100007899 487
97 3300005337 Ga0070682_100019838 Ga0070682_1000198383 487
98 3300005340 Ga0070689_100000023 Ga0070689_10000002382 487
99 3300005365 Ga0070688_100026275 Ga0070688_1000262751 487
100 3300009093 Ga0105240_10007962 Ga0105240_100079624 487
101 3300009545 Ga0105237_10004995 Ga0105237_100049959 487
102 3300009551 Ga0105238_10022262 Ga0105238_100222624 487
103 3300025909 Ga0207705_10010632 Ga0207705_100106322 487
104 3300025913 Ga0207695_10001125 Ga0207695_1000112510 487
105 3300025914 Ga0207671_10000434 Ga0207671_100004344 487
106 3300025921 Ga0207652_10012603 Ga0207652_100126032 487
107 3300025926 Ga0207659_10103376 Ga0207659_101033762 487
108 3300025936 Ga0207670_10000029 Ga0207670_1000002913 487
109 3300026078 Ga0207702_10125637 Ga0207702_101256372 487
110 3300026116 Ga0207674_10070068 Ga0207674_100700682 487
111 3300028577 Ga0265318_10000027 Ga0265318_10000027121 487
112 3300031235 Ga0265330_10000126 Ga0265330_1000012641 487
113 3300031238 Ga0265332_10000649 Ga0265332_100006497 487
114 3300031239 Ga0265328_10005349 Ga0265328_100053494 487
115 3300031240 Ga0265320_10000018 Ga0265320_1000001842 487
116 3300031242 Ga0265329_10002760 Ga0265329_100027604 487
117 3300031250 Ga0265331_10000046 Ga0265331_1000004641 487
118 3300031344 Ga0265316_10002028 Ga0265316_1000202817 487
119 3300031595 Ga0265313_10000489 Ga0265313_1000048914 487
120 3300031595 Ga0265313_10018533 Ga0265313_100185332 487
121 3300031711 Ga0265314_10000283 Ga0265314_1000028341 487
122 3300031712 Ga0265342_10001601 Ga0265342_1000160110 487
123 3300005518 Ga0070699_100043305 Ga0070699_1000433053 489
124 3300053095 Ga0500640_000111 Ga0500640_000111_8618_10129 489
125 3300053111 Ga0500572_007939 Ga0500572_007939_505_2016 489
126 3300053119 Ga0500595_000342 Ga0500595_000342_20376_21887 489
127 3300053122 Ga0500608_069252 Ga0500608_069252_101_1612 489
128 3300003323 rootH1_10053408 rootH1_100534085 490
129 3300049583 Ga0501067_0007119 Ga0501067_0007119_407_1930 490
130 3300013296 Ga0157374_10056262 Ga0157374_100562622 493
131 3300028800 Ga0265338_10086166 Ga0265338_100861661 493
132 3300031240 Ga0265320_10007432 Ga0265320_100074322 493
133 3300031711 Ga0265314_10039352 Ga0265314_100393522 493
134 3300031712 Ga0265342_10000064 Ga0265342_1000006452 493
135 3300031712 Ga0265342_10003468 Ga0265342_100034685 493
136 3300036401 Ga0373937_0013602 Ga0373937_0013602_2334_3860 493
137 3300028577 Ga0265318_10021241 Ga0265318_100212412 494
138 3300028800 Ga0265338_10039730 Ga0265338_100397304 494
139 3300031249 Ga0265339_10002232 Ga0265339_100022326 494
140 3300028794 Ga0307515_10010206 Ga0307515_100102063 496
141 3300031507 Ga0307509_10000069 Ga0307509_1000006946 496
142 3300006028 Ga0070717_10008724 Ga0070717_100087249 497
143 3300031507 Ga0307509_10062458 Ga0307509_100624582 497
144 3300039450 Ga0436363_1485290 Ga0436363_1485290_228_1739 497
145 3300028800 Ga0265338_10029999 Ga0265338_100299994 498
146 3300035113 Ga0373936_0000012 Ga0373936_0000012_94465_95994 498
147 3300053123 Ga0500614_001785 Ga0500614_001785_192_1709 498
148 3300044673 Ga0453683_0002564 Ga0453683_0002564_7513_9156 499
149 3300035119 Ga0373956_0004762 Ga0373956_0004762_2875_4446 500
150 3300035172 Ga0373955_0012718 Ga0373955_0012718_2404_3975 500
151 3300035724 Ga0373933_0048417 Ga0373933_0048417_949_2520 500
152 3300036401 Ga0373937_0001210 Ga0373937_0001210_4795_6366 500
153 3300061734 Ga0530510_0017130 Ga0530510_0017130_1378_3030 503
154 3300005458 Ga0070681_10026159 Ga0070681_100261597 504
155 3300013307 Ga0157372_10132659 Ga0157372_101326592 504
156 3300025909 Ga0207705_10053363 Ga0207705_100533632 504
157 3300025912 Ga0207707_10074282 Ga0207707_100742823 504
158 3300025921 Ga0207652_10025322 Ga0207652_100253222 504
159 3300005440 Ga0070705_100045787 Ga0070705_1000457872 507
160 3300005445 Ga0070708_100038583 Ga0070708_1000385832 507
161 3300005458 Ga0070681_10048978 Ga0070681_100489782 507
162 3300005536 Ga0070697_100006669 Ga0070697_1000066695 507
163 3300006871 Ga0075434_100197573 Ga0075434_1001975731 507
164 3300026023 Ga0207677_10069937 Ga0207677_100699372 507
165 3300031507 Ga0307509_10070519 Ga0307509_100705192 507
166 3300044712 Ga0453684_0011247 Ga0453684_0011247_646_2280 507
167 3300050512 nmdc:mga0n895_103530_c1 nmdc:mga0n895_103530_c1_410_1954 507
168 3300005336 Ga0070680_100165127 Ga0070680_1001651272 508
169 3300005467 Ga0070706_100000505 Ga0070706_10000050533 508
170 3300025910 Ga0207684_10000062 Ga0207684_1000006274 508
171 3300025922 Ga0207646_10029447 Ga0207646_100294474 508
172 3300044712 Ga0453684_0103186 Ga0453684_0103186_1905_3467 508
173 3300045051 Ga0451576_0178723 Ga0451576_0178723_636_2198 508
174 3300006852 Ga0075433_10109808 Ga0075433_101098082 510
175 3300007265 Ga0099794_10003772 Ga0099794_100037721 510
176 3300009147 Ga0114129_10005395 Ga0114129_100053958 510
177 3300050515 nmdc:mga0a205_111647_c1 nmdc:mga0a205_111647_c1_1030_2592 510
178 3300028577 Ga0265318_10000591 Ga0265318_1000059119 512
179 3300031235 Ga0265330_10007561 Ga0265330_100075614 512
180 3300031238 Ga0265332_10001740 Ga0265332_1000174010 512
181 3300031239 Ga0265328_10004087 Ga0265328_100040875 512
182 3300031240 Ga0265320_10004977 Ga0265320_100049771 512
183 3300031242 Ga0265329_10001562 Ga0265329_100015625 512
184 3300031250 Ga0265331_10001033 Ga0265331_1000103310 512
185 3300031344 Ga0265316_10016236 Ga0265316_100162362 512
186 3300031711 Ga0265314_10003757 Ga0265314_100037575 512
187 3300031712 Ga0265342_10003911 Ga0265342_1000391111 512
188 3300049822 Ga0501035_0001110 Ga0501035_0001110_20441_22090 515
189 3300044712 Ga0453684_0004266 Ga0453684_0004266_20816_22423 517
190 3300044712 Ga0453684_0001130 Ga0453684_0001130_81358_82995 518
191 3300009148 Ga0105243_10044290 Ga0105243_100442904 520
192 3300014497 Ga0182008_10054381 Ga0182008_100543811 520
193 3300042876 Ga0451577_0040064 Ga0451577_0040064_1811_3415 523
194 3300044673 Ga0453683_0012833 Ga0453683_0012833_1827_3431 523
195 3300044673 Ga0453683_0076662 Ga0453683_0076662_104_1747 523
196 3300044712 Ga0453684_0063450 Ga0453684_0063450_2532_4136 523
197 3300042876 Ga0451577_0000119 Ga0451577_0000119_167182_168789 524
198 3300042876 Ga0451577_0181901 Ga0451577_0181901_185_1813 524
199 3300044673 Ga0453683_0003728 Ga0453683_0003728_7568_9175 524
200 3300044712 Ga0453684_0000258 Ga0453684_0000258_184699_186306 524
201 3300044712 Ga0453684_0002024 Ga0453684_0002024_18231_19859 524
202 3300044712 Ga0453684_0071030 Ga0453684_0071030_1312_2940 524
203 3300044712 Ga0453684_0100280 Ga0453684_0100280_1274_2881 524
204 3300045051 Ga0451576_0000966 Ga0451576_0000966_48603_50210 524
205 3300045051 Ga0451576_0031232 Ga0451576_0031232_1643_3250 524
206 3300044673 Ga0453683_0000715 Ga0453683_0000715_19412_21139 526
207 3300044712 Ga0453684_0005592 Ga0453684_0005592_9634_11361 526
208 3300045051 Ga0451576_0006566 Ga0451576_0006566_5262_6989 526
209 3300006028 Ga0070717_10006725 Ga0070717_100067256 529
210 3300001991 JGI24743J22301_10003927 JGI24743J22301_100039272 557
211 3300005328 Ga0070676_10000457 Ga0070676_1000045719 557
212 3300005330 Ga0070690_100001609 Ga0070690_1000016096 557
213 3300005331 Ga0070670_100004825 Ga0070670_1000048256 557
214 3300005333 Ga0070677_10000257 Ga0070677_1000025712 557
215 3300005334 Ga0068869_100000821 Ga0068869_10000082112 557
216 3300005335 Ga0070666_10006821 Ga0070666_100068216 557
217 3300005337 Ga0070682_100065516 Ga0070682_1000655162 557
218 3300005338 Ga0068868_100000319 Ga0068868_10000031924 557
219 3300005339 Ga0070660_100000968 Ga0070660_10000096813 557
220 3300005340 Ga0070689_100003822 Ga0070689_1000038227 557
221 3300005343 Ga0070687_100000001 Ga0070687_10000000185 557
222 3300005344 Ga0070661_100000972 Ga0070661_10000097215 557
223 3300005345 Ga0070692_10001883 Ga0070692_100018833 557
224 3300005347 Ga0070668_100000728 Ga0070668_10000072811 557
225 3300005353 Ga0070669_100002062 Ga0070669_10000206212 557
226 3300005354 Ga0070675_100034674 Ga0070675_1000346741 557
227 3300005355 Ga0070671_100002728 Ga0070671_1000027288 557
228 3300005355 Ga0070671_100061643 Ga0070671_1000616432 557
229 3300005356 Ga0070674_100000935 Ga0070674_10000093517 557
230 3300005364 Ga0070673_100002021 Ga0070673_1000020216 557
231 3300005365 Ga0070688_100000541 Ga0070688_1000005413 557
232 3300005366 Ga0070659_100005646 Ga0070659_1000056464 557
233 3300005367 Ga0070667_100006323 Ga0070667_1000063237 557
234 3300005438 Ga0070701_10018144 Ga0070701_100181442 557
235 3300005440 Ga0070705_100012854 Ga0070705_1000128542 557
236 3300005441 Ga0070700_100006737 Ga0070700_1000067372 557
237 3300005444 Ga0070694_100050426 Ga0070694_1000504262 557
238 3300005455 Ga0070663_100015351 Ga0070663_1000153513 557
239 3300005456 Ga0070678_100000476 Ga0070678_10000047617 557
240 3300005457 Ga0070662_100002372 Ga0070662_1000023726 557
241 3300005459 Ga0068867_100008832 Ga0068867_1000088321 557
242 3300005466 Ga0070685_10014429 Ga0070685_100144294 557
243 3300005539 Ga0068853_100000581 Ga0068853_1000005814 557
244 3300005543 Ga0070672_100008137 Ga0070672_1000081372 557
245 3300005544 Ga0070686_100002121 Ga0070686_1000021218 557
246 3300005545 Ga0070695_100015099 Ga0070695_1000150994 557
247 3300005546 Ga0070696_100033501 Ga0070696_1000335011 557
248 3300005548 Ga0070665_100130580 Ga0070665_1001305802 557
249 3300005549 Ga0070704_100009468 Ga0070704_1000094684 557
250 3300005563 Ga0068855_100002860 Ga0068855_1000028607 557
251 3300005564 Ga0070664_100001665 Ga0070664_1000016652 557
252 3300005564 Ga0070664_100005483 Ga0070664_1000054837 557
253 3300005577 Ga0068857_100003118 Ga0068857_1000031187 557
254 3300005577 Ga0068857_100007586 Ga0068857_1000075869 557
255 3300005578 Ga0068854_100002187 Ga0068854_1000021877 557
256 3300005614 Ga0068856_100000478 Ga0068856_10000047828 557
257 3300005615 Ga0070702_100016658 Ga0070702_1000166584 557
258 3300005616 Ga0068852_100002165 Ga0068852_10000216513 557
259 3300005618 Ga0068864_100001550 Ga0068864_1000015508 557
260 3300005718 Ga0068866_10001770 Ga0068866_100017707 557
261 3300005719 Ga0068861_100001466 Ga0068861_10000146612 557
262 3300005834 Ga0068851_10000290 Ga0068851_1000029019 557
263 3300005840 Ga0068870_10000085 Ga0068870_1000008525 557
264 3300005841 Ga0068863_100002421 Ga0068863_1000024218 557
265 3300005842 Ga0068858_100044865 Ga0068858_1000448651 557
266 3300005844 Ga0068862_100007583 Ga0068862_1000075833 557
267 3300005983 Ga0081540_1000162 Ga0081540_10001629 557
268 3300005983 Ga0081540_1003667 Ga0081540_100366712 557
269 3300006237 Ga0097621_100003694 Ga0097621_1000036943 557
270 3300006358 Ga0068871_100009826 Ga0068871_1000098264 557
271 3300006881 Ga0068865_100001485 Ga0068865_1000014853 557
272 3300009093 Ga0105240_10021881 Ga0105240_100218814 557
273 3300009098 Ga0105245_10000703 Ga0105245_1000070312 557
274 3300009101 Ga0105247_10000492 Ga0105247_1000049215 557
275 3300009174 Ga0105241_10002408 Ga0105241_100024087 557
276 3300009177 Ga0105248_10005923 Ga0105248_100059236 557
277 3300009545 Ga0105237_10000276 Ga0105237_1000027653 557
278 3300009551 Ga0105238_10000744 Ga0105238_1000074412 557
279 3300009553 Ga0105249_10001984 Ga0105249_1000198411 557
280 3300010375 Ga0105239_10000686 Ga0105239_1000068611 557
281 3300011119 Ga0105246_10000797 Ga0105246_1000079711 557
282 3300013100 Ga0157373_10007018 Ga0157373_100070182 557
283 3300013102 Ga0157371_10000234 Ga0157371_1000023471 557
284 3300013105 Ga0157369_10006018 Ga0157369_100060188 557
285 3300013296 Ga0157374_10001417 Ga0157374_1000141717 557
286 3300013297 Ga0157378_10000488 Ga0157378_100004889 557
287 3300013306 Ga0163162_10010695 Ga0163162_100106953 557
288 3300013307 Ga0157372_10003128 Ga0157372_100031286 557
289 3300013308 Ga0157375_10004505 Ga0157375_100045056 557
290 3300014325 Ga0163163_10004857 Ga0163163_100048574 557
291 3300014968 Ga0157379_10000471 Ga0157379_1000047111 557
292 3300014969 Ga0157376_10003479 Ga0157376_100034795 557
293 3300025315 Ga0207697_10000389 Ga0207697_1000038919 557
294 3300025321 Ga0207656_10000890 Ga0207656_100008903 557
295 3300025899 Ga0207642_10000989 Ga0207642_100009893 557
296 3300025900 Ga0207710_10006664 Ga0207710_100066643 557
297 3300025901 Ga0207688_10000003 Ga0207688_1000000350 557
298 3300025903 Ga0207680_10001715 Ga0207680_100017157 557
299 3300025904 Ga0207647_10005253 Ga0207647_100052533 557
300 3300025907 Ga0207645_10001790 Ga0207645_1000179011 557
301 3300025908 Ga0207643_10000011 Ga0207643_10000011120 557
302 3300025909 Ga0207705_10001396 Ga0207705_100013962 557
303 3300025911 Ga0207654_10012350 Ga0207654_100123504 557
304 3300025913 Ga0207695_10022092 Ga0207695_100220922 557
305 3300025914 Ga0207671_10001549 Ga0207671_1000154923 557
306 3300025918 Ga0207662_10000004 Ga0207662_10000004112 557
307 3300025919 Ga0207657_10005694 Ga0207657_1000569411 557
308 3300025920 Ga0207649_10002850 Ga0207649_100028508 557
309 3300025920 Ga0207649_10008357 Ga0207649_100083573 557
310 3300025923 Ga0207681_10000598 Ga0207681_1000059814 557
311 3300025924 Ga0207694_10003200 Ga0207694_100032006 557
312 3300025925 Ga0207650_10000993 Ga0207650_100009937 557
313 3300025926 Ga0207659_10002952 Ga0207659_100029523 557
314 3300025927 Ga0207687_10005000 Ga0207687_100050006 557
315 3300025931 Ga0207644_10007124 Ga0207644_100071241 557
316 3300025932 Ga0207690_10003999 Ga0207690_100039997 557
317 3300025933 Ga0207706_10000152 Ga0207706_1000015253 557
318 3300025936 Ga0207670_10000208 Ga0207670_1000020827 557
319 3300025937 Ga0207669_10000558 Ga0207669_100005585 557
320 3300025938 Ga0207704_10000423 Ga0207704_1000042313 557
321 3300025940 Ga0207691_10000457 Ga0207691_1000045711 557
322 3300025941 Ga0207711_10001955 Ga0207711_100019558 557
323 3300025942 Ga0207689_10000245 Ga0207689_1000024526 557
324 3300025944 Ga0207661_10006089 Ga0207661_100060893 557
325 3300025945 Ga0207679_10000447 Ga0207679_1000044728 557
326 3300025945 Ga0207679_10001548 Ga0207679_100015486 557
327 3300025949 Ga0207667_10003606 Ga0207667_1000360612 557
328 3300025960 Ga0207651_10000491 Ga0207651_100004916 557
329 3300025961 Ga0207712_10000573 Ga0207712_1000057318 557
330 3300025972 Ga0207668_10002430 Ga0207668_100024302 557
331 3300025981 Ga0207640_10000709 Ga0207640_1000070918 557
332 3300025986 Ga0207658_10001389 Ga0207658_1000138913 557
333 3300026023 Ga0207677_10000407 Ga0207677_1000040724 557
334 3300026035 Ga0207703_10001839 Ga0207703_100018398 557
335 3300026041 Ga0207639_10001153 Ga0207639_100011534 557
336 3300026067 Ga0207678_10006655 Ga0207678_100066553 557
337 3300026078 Ga0207702_10004732 Ga0207702_100047326 557
338 3300026088 Ga0207641_10007392 Ga0207641_100073927 557
339 3300026089 Ga0207648_10000094 Ga0207648_1000009467 557
340 3300026095 Ga0207676_10021116 Ga0207676_100211163 557
341 3300026116 Ga0207674_10000255 Ga0207674_100002557 557
342 3300026116 Ga0207674_10012517 Ga0207674_100125179 557
343 3300026118 Ga0207675_100000004 Ga0207675_100000004120 557
344 3300026121 Ga0207683_10000007 Ga0207683_1000000794 557
345 3300026142 Ga0207698_10001286 Ga0207698_1000128613 557
346 3300028379 Ga0268266_10004317 Ga0268266_100043177 557
347 3300028380 Ga0268265_10000375 Ga0268265_1000037513 557
348 3300028381 Ga0268264_10000729 Ga0268264_100007298 557
349 3300046683 Ga0495658_0012288 Ga0495658_0012288_743_2416 557
350 3300048905 Ga0496102_0026492 Ga0496102_0026492_3362_5035 557
351 3300048909 Ga0496106_0004085 Ga0496106_0004085_4930_6603 557
352 3300048911 Ga0496108_0052951 Ga0496108_0052951_1322_2995 557
353 3300048912 Ga0496109_0003227 Ga0496109_0003227_6306_7979 557
354 3300048915 Ga0496112_0000583 Ga0496112_0000583_20465_22138 557

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05761

5_nucleotid

5' nucleotidase family

62

535

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3a8q-assembly4.cif.gz_D low-resolution crystal structure of the tiam2 phccex domain 0.9505 401 470
4k2p-assembly4.cif.gz_D the structure of a quintuple mutant of the tiam1 ph-cc-ex domain 0.936 401 470
4k2p-assembly3.cif.gz_C the structure of a quintuple mutant of the tiam1 ph-cc-ex domain 0.9349 401 470
4l0r-assembly1.cif.gz_B crystal structure of fgf2-interacting protein from homo sapiens. northeast structural genomics consortium target hr9027a. 0.9342 403 471
4k2p-assembly2.cif.gz_B the structure of a quintuple mutant of the tiam1 ph-cc-ex domain 0.9324 401 470
ID Description Score Start End Superfamily
4l0rB00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.9342 403 471 1.20.58.90
af_A0A1D8PLW1_1_216_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.9171 398 480 1.20.1270.60
4l0rA00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.9153 402 472 1.20.58.90
af_Q86YG4_1_162_3.30.720.10 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1;Signal recognition particle alu RNA binding heterodimer, srp9/1 0.9044 61 200 3.30.720.10
af_Q95X21_175_370_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8948 208 406 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A2N1R4B2-F1-model_v4 5'-nucleotidase 0.9539 61 305 GO:0008253
AF-A0A0S8EM13-F1-model_v4 5'-nucleotidase 0.9507 69 198 GO:0008253
AF-A0A2N1R4B2-F1-model_v4 5'-nucleotidase 0.9464 61 305 GO:0008253
AF-A0A4V2BD48-F1-model_v4 5'-nucleotidase 0.9348 61 289 GO:0008253
AF-A0A849WWK6-F1-model_v4 5'-nucleotidase 0.9271 60 229 GO:0008253

Feature Viewer

pLDDT pTM Quality
77.53 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map