F419522

General Info

Members Datasets Scaffolds Average Seq Length
353 236 297 250

Family's Representative Sequence

Representative Sequence 3300048921|Ga0496118_0036793|Ga0496118_0036793_1383_2291
Length 302
Sequence MWCCETDLLFRTIASDPNEKRGTVCRVSDTVLPLNEMTPPFKEQGLMTSRLFDLSGLRALVTGSSQGIGLALAQGLIEHGASVVLNGRDKVRLGEAAAALKAETGVAVDTADFDVTDGDAVKRGVEAIERDIGPIDILINNAGMQFRSPLEDFPADRWEQLLKTNISSVFYVGQAVARHMIGRGKGKIINIASVQSELARPGIAPYTATKGAVKNLTRGMCTDWAKHGLQINAIAPGYFKTPLNQALVDSEEFSSWLEKRTPAGRWGNVDELVGAAVFLSGKASSFVNGHTLYVDGGITTSL

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
3 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
4 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
5 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
6 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
7 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
8 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
9 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
10 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
11 2643221568 Rhizobium sp. Root564 Isolate Unclassified
12 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
13 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
14 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
15 2751185800 Brucella pituitosa AA2 Isolate Unclassified
16 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
17 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
18 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
19 2791355266 Rhizobium sp. L43 Isolate Nodule
20 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
21 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
22 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
23 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
24 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
25 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
26 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
27 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
28 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
29 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
30 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
31 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
32 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
33 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
34 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
35 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
36 2854911287 Brucella lupini LUP21 Isolate Unclassified
37 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
38 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
39 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
40 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
41 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
42 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
43 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
44 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
45 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
46 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
47 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
48 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
49 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
50 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
51 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
52 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
53 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
54 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
55 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
56 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
57 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
58 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
59 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
60 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
61 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
62 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
63 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
64 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
65 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
66 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
67 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
68 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
69 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
70 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
71 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
72 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
73 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
74 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
75 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
76 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
77 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
82 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
83 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
84 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
85 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
86 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
87 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
88 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
89 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
90 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
91 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
107 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
108 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
139 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
140 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
141 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
142 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
143 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
144 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
145 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
146 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
147 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
148 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
149 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
150 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
151 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
152 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
153 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
154 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
155 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
156 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
157 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
158 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
159 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
160 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
161 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
162 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
163 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
164 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
165 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
166 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
167 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
168 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
169 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
170 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
171 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
172 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
173 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
174 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
175 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
176 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
177 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
178 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
179 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
180 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
181 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
182 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
183 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
184 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
185 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
186 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
187 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
188 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
189 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
190 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
191 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
192 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
199 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
200 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
201 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
202 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
203 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
204 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
205 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
206 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
207 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
208 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
209 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
210 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
212 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
213 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
214 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
215 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
216 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
217 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
218 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
219 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
220 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
221 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
222 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
223 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
224 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
225 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
226 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
227 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
228 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
229 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
230 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
231 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
232 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
233 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
234 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
235 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
236 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.14
Metatranscriptomes 0
Isolates 15.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.13
Nodule 7.93
Rhizoplane 3.97
Rhizosphere 53.54
Stem 0
Stem Tuber 0
Unclassified 16.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10013694 3300003187 Bacteria 3640
2 Ga0055536_1004418 3300003781 Bacteria 7199
3 Ga0055536_1004851 3300003781 Bacteria 6721
4 Ga0055534_1012922 3300003784 Bacteria 1628
5 Ga0055530_10000099 3300003791 Bacteria 73409
6 Ga0055530_10000705 3300003791 Bacteria 28140
7 Ga0055531_10009098 3300003794 Bacteria 5122
8 Ga0055531_10024677 3300003794 Bacteria 2209
9 Ga0055531_10028511 3300003794 Bacteria 1923
10 Ga0070676_10041465 3300005328 Bacteria 2670
11 Ga0070677_10003254 3300005333 Bacteria 5231
12 Ga0068869_100127573 3300005334 Bacteria 1952
13 Ga0068869_100224016 3300005334 Bacteria 1492
14 Ga0068868_100570248 3300005338 Bacteria 1000
15 Ga0070660_100010678 3300005339 Bacteria 6498
16 Ga0070668_100107428 3300005347 Bacteria 2218
17 Ga0070668_100191498 3300005347 Bacteria 1675
18 Ga0070669_100312590 3300005353 Bacteria 1267
19 Ga0070671_100251628 3300005355 Bacteria 1501
20 Ga0070674_100012607 3300005356 Bacteria 5195
21 Ga0070663_100240108 3300005455 Bacteria 1430
22 Ga0070662_100223678 3300005457 Bacteria 1503
23 Ga0070662_100291492 3300005457 Bacteria 1323
24 Ga0068853_100003517 3300005539 Bacteria 11984
25 Ga0068853_100019651 3300005539 Bacteria 5607
26 Ga0068853_100521224 3300005539 Bacteria 1124
27 Ga0070686_100192496 3300005544 Bacteria 1456
28 Ga0070665_100000129 3300005548 Bacteria 141818
29 Ga0070665_100000373 3300005548 Bacteria 66729
30 Ga0070665_100036428 3300005548 Bacteria 4948
31 Ga0068857_100038315 3300005577 Bacteria 4246
32 Ga0068857_100074712 3300005577 Bacteria 3021
33 Ga0068857_100822380 3300005577 Bacteria 888
34 Ga0068852_100005362 3300005616 Bacteria 9165
35 Ga0068851_10064028 3300005834 Bacteria 1889
36 Ga0068863_100016265 3300005841 Bacteria 7137
37 Ga0068858_100281801 3300005842 Bacteria 1583
38 Ga0068860_100377662 3300005843 Bacteria 1399
39 Ga0068862_100334885 3300005844 Bacteria 1400
40 Ga0081540_1002234 3300005983 Bacteria 15949
41 Ga0081539_10003955 3300005985 Bacteria 17165
42 Ga0075365_10052155 3300006038 Bacteria 2704
43 Ga0075365_10066338 3300006038 Bacteria 2421
44 Ga0075363_100013416 3300006048 Bacteria 3972
45 Ga0075364_10003690 3300006051 Bacteria 8740
46 Ga0075364_10034872 3300006051 Bacteria 3250
47 Ga0075362_10022150 3300006177 Bacteria 2674
48 Ga0075367_10104297 3300006178 Bacteria 1736
49 Ga0075369_10097028 3300006186 Bacteria 1320
50 Ga0075369_10199778 3300006186 Bacteria 922
51 Ga0075366_10151472 3300006195 Bacteria 1404
52 Ga0075366_10244537 3300006195 Bacteria 1094
53 Ga0075434_100006119 3300006871 Bacteria 11018
54 Ga0068865_100104820 3300006881 Bacteria 2076
55 Ga0105240_10004330 3300009093 Bacteria 21672
56 Ga0105240_10046019 3300009093 Bacteria 5532
57 Ga0105240_10840157 3300009093 Bacteria 992
58 Ga0105240_11219984 3300009093 Bacteria 796
59 Ga0105245_10084606 3300009098 Bacteria 2907
60 Ga0105245_10237872 3300009098 Bacteria 1764
61 Ga0105243_10103135 3300009148 Bacteria 2371
62 Ga0105237_10000166 3300009545 Bacteria 93389
63 Ga0105239_10003277 3300010375 Bacteria 19964
64 Ga0105239_10071250 3300010375 Bacteria 3819
65 Ga0105239_10196250 3300010375 Bacteria 2260
66 Ga0105239_10581728 3300010375 Bacteria 1276
67 Ga0105239_10620511 3300010375 Bacteria 1234
68 Ga0105246_10051538 3300011119 Bacteria 2827
69 Ga0157373_10251691 3300013100 Bacteria 1249
70 Ga0157371_10000626 3300013102 Bacteria 41946
71 Ga0157375_10162078 3300013308 Bacteria 2379
72 Ga0157375_10544656 3300013308 Bacteria 1322
73 Ga0163163_10041447 3300014325 Bacteria 4502
74 Ga0163163_10343552 3300014325 Bacteria 1548
75 Ga0163163_10567129 3300014325 Bacteria 1198
76 Ga0157380_10142410 3300014326 Bacteria 2062
77 Ga0157380_10433818 3300014326 Bacteria 1257
78 Ga0209675_1000227 3300025291 Bacteria 57390
79 Ga0209676_1000084 3300025292 Bacteria 274330
80 Ga0209676_1000330 3300025292 Bacteria 91216
81 Ga0209676_1000479 3300025292 Bacteria 65868
82 Ga0209025_1000416 3300025294 Bacteria 85510
83 Ga0209025_1003996 3300025294 Bacteria 13236
84 Ga0209025_1005526 3300025294 Bacteria 10258
85 Ga0209758_1032403 3300025297 Bacteria 2122
86 Ga0209758_1073764 3300025297 Bacteria 1061
87 Ga0209050_1000113 3300025298 Bacteria 209222
88 Ga0209050_1032027 3300025298 Bacteria 1626
89 Ga0209257_1000083 3300025304 Bacteria 296207
90 Ga0209257_1000126 3300025304 Bacteria 215705
91 Ga0209257_1000340 3300025304 Bacteria 97492
92 Ga0209257_1002928 3300025304 Bacteria 15726
93 Ga0207682_10004189 3300025893 Bacteria 6092
94 Ga0207688_10041629 3300025901 Bacteria 2556
95 Ga0207645_10022261 3300025907 Bacteria 4125
96 Ga0207643_10028444 3300025908 Bacteria 3104
97 Ga0207695_10019781 3300025913 Bacteria 7739
98 Ga0207695_10025395 3300025913 Bacteria 6632
99 Ga0207671_10001225 3300025914 Bacteria 30382
100 Ga0207657_10030723 3300025919 Bacteria 4872
101 Ga0207657_10188322 3300025919 Bacteria 1666
102 Ga0207687_10076595 3300025927 Bacteria 2403
103 Ga0207690_10588614 3300025932 Bacteria 907
104 Ga0207706_10268411 3300025933 Bacteria 1489
105 Ga0207669_10124524 3300025937 Bacteria 1758
106 Ga0207669_10239759 3300025937 Bacteria 1343
107 Ga0207704_10578026 3300025938 Bacteria 917
108 Ga0207691_10407082 3300025940 Bacteria 1160
109 Ga0207689_10153282 3300025942 Bacteria 1899
110 Ga0207689_10323116 3300025942 Bacteria 1281
111 Ga0207667_10096159 3300025949 Bacteria 3057
112 Ga0207712_10407401 3300025961 Bacteria 1144
113 Ga0207668_10108219 3300025972 Bacteria 2080
114 Ga0207668_10139909 3300025972 Bacteria 1860
115 Ga0207639_10018060 3300026041 Bacteria 5006
116 Ga0207678_10073196 3300026067 Bacteria 2937
117 Ga0207678_10164778 3300026067 Bacteria 1893
118 Ga0207708_10093896 3300026075 Bacteria 2315
119 Ga0207641_10013441 3300026088 Bacteria 6714
120 Ga0207641_10113926 3300026088 Bacteria 2402
121 Ga0207648_10068137 3300026089 Bacteria 3101
122 Ga0207648_10294843 3300026089 Bacteria 1453
123 Ga0207674_10049184 3300026116 Bacteria 4313
124 Ga0207675_100295410 3300026118 Bacteria 1577
125 Ga0207683_10441376 3300026121 Bacteria 1199
126 Ga0209974_10028198 3300027876 Bacteria 1859
127 Ga0268266_10000019 3300028379 Bacteria 556465
128 Ga0268266_10000167 3300028379 Bacteria 120012
129 Ga0268266_10001058 3300028379 Bacteria 34512
130 Ga0268266_10236374 3300028379 Bacteria 1685
131 Ga0268265_10258536 3300028380 Bacteria 1546
132 Ga0268265_10388940 3300028380 Bacteria 1285
133 Ga0307515_10002668 3300028794 Bacteria 38232
134 Ga0307509_10430616 3300031507 Bacteria 1018
135 Ga0307413_10297794 3300031824 Bacteria 1222
136 Ga0307410_10271110 3300031852 Bacteria 1328
137 Ga0307410_10292580 3300031852 Bacteria 1282
138 Ga0307412_10002686 3300031911 Bacteria 9868
139 Ga0307412_10013146 3300031911 Bacteria 4845
140 Ga0307412_10272005 3300031911 Bacteria 1326
141 Ga0307414_10020188 3300032004 Bacteria 4147
142 Ga0307414_10041894 3300032004 Bacteria 3106
143 Ga0307414_10054735 3300032004 Bacteria 2790
144 Ga0307411_10036421 3300032005 Bacteria 3083
145 Ga0373931_0006782 3300035691 Bacteria 5377
146 Ga0395898_0215579 3300037466 Bacteria 1831
147 Ga0395898_0515740 3300037466 Bacteria 1137
148 Ga0395905_0001781 3300037471 Bacteria 24995
149 Ga0395905_0021221 3300037471 Bacteria 6146
150 Ga0400483_032987 3300039062 Bacteria 1309
151 Ga0400483_050586 3300039062 Bacteria 1506
152 Ga0400483_093245 3300039062 Bacteria 1122
153 Ga0400483_200679 3300039062 Bacteria 2879
154 Ga0451853_3950760 3300041512 Bacteria 832
155 Ga0439443_000228 3300042003 Bacteria 4317
156 Ga0466965_0081656 3300044683 Bacteria 1635
157 Ga0466961_0128927 3300044693 Bacteria 1586
158 Ga0466961_0365575 3300044693 Bacteria 877
159 Ga0466961_0372729 3300044693 Bacteria 867
160 Ga0466963_0051214 3300044694 Bacteria 2736
161 Ga0466963_0327761 3300044694 Bacteria 1078
162 Ga0466971_0077886 3300044719 Bacteria 1510
163 Ga0466970_0028665 3300044765 Bacteria 2927
164 Ga0466957_0023805 3300044842 Bacteria 3623
165 Ga0466959_0082711 3300045049 Bacteria 2313
166 Ga0466958_0114885 3300045836 Bacteria 1682
167 Ga0466967_0015282 3300045976 Bacteria 6013
168 Ga0466967_0350637 3300045976 Bacteria 1428
169 Ga0466967_0451609 3300045976 Bacteria 1256
170 Ga0495638_0034634 3300046460 Bacteria 3224
171 Ga0495638_0100266 3300046460 Bacteria 1733
172 Ga0495610_0013370 3300046512 Bacteria 4882
173 Ga0495610_0072836 3300046512 Bacteria 1598
174 Ga0495620_0018829 3300046515 Bacteria 3412
175 Ga0495632_0142678 3300046519 Bacteria 1110
176 Ga0495643_0067549 3300046522 Bacteria 1883
177 Ga0495644_0116097 3300046523 Bacteria 1017
178 Ga0495654_0065552 3300046530 Bacteria 1733
179 Ga0495668_0000015 3300046616 Bacteria 441932
180 Ga0495625_0001583 3300046660 Bacteria 26987
181 Ga0495686_0030700 3300047472 Bacteria 3489
182 Ga0495686_0085108 3300047472 Bacteria 1926
183 Ga0496102_0006284 3300048905 Bacteria 10128
184 Ga0496104_0030727 3300048907 Bacteria 4993
185 Ga0496105_0007957 3300048908 Bacteria 8241
186 Ga0496108_0019163 3300048911 Bacteria 5616
187 Ga0496109_0063013 3300048912 Bacteria 3391
188 Ga0496109_0076144 3300048912 Bacteria 3086
189 Ga0496110_0015620 3300048913 Bacteria 6323
190 Ga0496111_0004897 3300048914 Bacteria 8506
191 Ga0496112_0011178 3300048915 Bacteria 8186
192 Ga0496113_0004503 3300048916 Bacteria 8579
193 Ga0496114_0006640 3300048917 Bacteria 9115
194 Ga0496114_0101490 3300048917 Bacteria 2457
195 Ga0496115_0014022 3300048918 Bacteria 6066
196 Ga0496116_0056735 3300048919 Bacteria 2565
197 Ga0496116_0065501 3300048919 Bacteria 2330
198 Ga0496116_0182315 3300048919 Bacteria 1122
199 Ga0496116_0282164 3300048919 Bacteria 803
200 Ga0496117_0001262 3300048920 Bacteria 37592
201 Ga0496117_0180247 3300048920 Bacteria 1215
202 Ga0496118_0003936 3300048921 Bacteria 18163
203 Ga0496118_0036793 3300048921 Bacteria 3951
204 Ga0496118_0129246 3300048921 Bacteria 1626
205 Ga0496118_0162453 3300048921 Bacteria 1379
206 Ga0496119_0108620 3300048922 Bacteria 1544
207 Ga0496121_0000003 3300048924 Bacteria 1191431
208 Ga0496121_0000005 3300048924 Bacteria 1034486
209 Ga0496122_0000770 3300048925 Bacteria 61729
210 Ga0496122_0042417 3300048925 Bacteria 3580
211 Ga0496123_0000018 3300048926 Bacteria 404553
212 Ga0496123_0043061 3300048926 Bacteria 3106
213 Ga0496123_0043907 3300048926 Bacteria 3063
214 Ga0496124_0002233 3300048927 Bacteria 25777
215 Ga0496124_0074195 3300048927 Bacteria 2812
216 Ga0496124_0081628 3300048927 Bacteria 2656
217 Ga0496124_0094589 3300048927 Bacteria 2430
218 Ga0496125_0000034 3300048928 Bacteria 348231
219 Ga0496125_0000170 3300048928 Bacteria 145369
220 Ga0496125_0000575 3300048928 Bacteria 62850
221 Ga0496125_0007945 3300048928 Bacteria 11203
222 Ga0496125_0079521 3300048928 Bacteria 2515
223 Ga0496126_0001062 3300048929 Bacteria 46308
224 Ga0496126_0040774 3300048929 Bacteria 4302
225 Ga0496126_0147817 3300048929 Bacteria 2016
226 Ga0496126_0178112 3300048929 Bacteria 1807
227 Ga0496126_0221339 3300048929 Bacteria 1590
228 Ga0496126_0382106 3300048929 Bacteria 1146
229 Ga0495678_047430 3300049459 Bacteria 1682
230 Ga0501031_0011508 3300049568 Bacteria 5768
231 Ga0501033_0000334 3300049570 Bacteria 44929
232 Ga0501037_0000035 3300049573 Bacteria 125589
233 Ga0501038_0029507 3300049574 Bacteria 4859
234 Ga0501038_0124482 3300049574 Bacteria 2123
235 Ga0501043_0000031 3300049579 Bacteria 140707
236 Ga0501043_0060811 3300049579 Bacteria 2966
237 Ga0501047_0027905 3300049581 Bacteria 5440
238 Ga0501047_0426044 3300049581 Bacteria 1158
239 Ga0501067_0016577 3300049583 Bacteria 4072
240 Ga0501067_0220477 3300049583 Bacteria 1056
241 Ga0501068_0011664 3300049584 Bacteria 4967
242 Ga0501069_0000056 3300049585 Bacteria 65784
243 Ga0501069_0002418 3300049585 Bacteria 9493
244 Ga0501070_0000141 3300049586 Bacteria 65875
245 Ga0501070_0002589 3300049586 Bacteria 15814
246 Ga0501070_0263434 3300049586 Bacteria 1408
247 Ga0501071_0011450 3300049587 Bacteria 5976
248 Ga0501071_0054652 3300049587 Bacteria 2881
249 Ga0501073_0040792 3300049589 Bacteria 3283
250 Ga0501074_0000223 3300049590 Bacteria 31404
251 Ga0501074_0312468 3300049590 Bacteria 1116
252 Ga0501077_0004999 3300049593 Bacteria 8040
253 Ga0501080_0001729 3300049742 Bacteria 18680
254 Ga0501080_0091658 3300049742 Bacteria 2823
255 Ga0501083_0001157 3300049744 Bacteria 17771
256 Ga0501241_016959 3300049758 Bacteria 1331
257 Ga0501282_006695 3300049778 Bacteria 1231
258 Ga0501035_0000036 3300049822 Bacteria 165008
259 Ga0501035_0006881 3300049822 Bacteria 10622
260 Ga0501035_0083446 3300049822 Bacteria 2819
261 Ga0501044_0000011 3300049823 Bacteria 257385
262 Ga0501044_0017467 3300049823 Bacteria 7699
263 Ga0501044_0148705 3300049823 Bacteria 2326
264 Ga0501044_0152207 3300049823 Bacteria 2295
265 nmdc:mga03683_25194_c1 3300050489 Bacteria 1397
266 nmdc:mga03n38_20828_c1 3300050490 Bacteria 2629
267 nmdc:mga00v17_129389_c1 3300050491 Bacteria 1612
268 nmdc:mga00v17_5966_c1 3300050491 Bacteria 6444
269 nmdc:mga0yw44_113443_c1 3300050492 Bacteria 1739
270 nmdc:mga0yw44_8366_c1 3300050492 Bacteria 5150
271 nmdc:mga0k408_123777_c1 3300050493 Bacteria 1533
272 nmdc:mga0k408_34478_c1 3300050493 Bacteria 2897
273 nmdc:mga07m45_207118_c1 3300050496 Bacteria 1141
274 nmdc:mga07m45_223586_c1 3300050496 Bacteria 1095
275 nmdc:mga0n895_9375_c1 3300050512 Bacteria 8561
276 nmdc:mga0sz30_49747_c1 3300050516 Bacteria 1776
277 Ga0500583_0023840 3300053092 Bacteria 2586
278 Ga0500641_0010083 3300053096 Bacteria 3406
279 Ga0500592_000328 3300053116 Bacteria 8085
280 Ga0500608_043910 3300053122 Bacteria 2146
281 Ga0500618_009909 3300053125 Bacteria 2581
282 Ga0500628_004800 3300053129 Bacteria 2243
283 Ga0500642_0008074 3300053130 Bacteria 3579
284 Ga0500568_0001613 3300053139 Bacteria 14273
285 Ga0500577_0001327 3300053142 Bacteria 6334
286 Ga0500604_0000046 3300053151 Bacteria 46720
287 Ga0500616_0000363 3300053153 Bacteria 64277
288 Ga0500616_0000411 3300053153 Bacteria 57962
289 Ga0500622_0000624 3300053156 Bacteria 31879
290 Ga0500622_0004396 3300053156 Bacteria 8878
291 Ga0500622_0053973 3300053156 Bacteria 2062
292 Ga0500627_0000029 3300053158 Bacteria 94759
293 Ga0500627_0104878 3300053158 Bacteria 1270
294 Ga0500634_0015368 3300053161 Bacteria 4063
295 Ga0501084_0057246 3300054114 Bacteria 3262
296 Ga0501082_0037922 3300060353 Bacteria 4156
297 Ga0466962_0032953 3300061719 Bacteria 2479

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025961 Ga0207712_10407401 Ga0207712_104074012 205
2 3300032004 Ga0307414_10041894 Ga0307414_100418942 224
3 3300006871 Ga0075434_100006119 Ga0075434_1000061196 226
4 3300005548 Ga0070665_100000129 Ga0070665_100000129128 227
5 3300028379 Ga0268266_10000019 Ga0268266_10000019368 227
6 3300032004 Ga0307414_10054735 Ga0307414_100547353 227
7 3300046530 Ga0495654_0065552 Ga0495654_0065552_277_1023 227
8 3300050512 nmdc:mga0n895_9375_c1 nmdc:mga0n895_9375_c1_4366_5160 227
9 3300053116 Ga0500592_000328 Ga0500592_000328_3875_4621 227
10 3300053158 Ga0500627_0000029 Ga0500627_0000029_52154_52900 227
11 3300003794 Ga0055531_10024677 Ga0055531_100246773 228
12 3300005841 Ga0068863_100016265 Ga0068863_1000162652 228
13 3300025304 Ga0209257_1002928 Ga0209257_10029288 228
14 3300026088 Ga0207641_10013441 Ga0207641_100134412 228
15 3300005539 Ga0068853_100521224 Ga0068853_1005212242 229
16 3300014325 Ga0163163_10567129 Ga0163163_105671292 229
17 3300046660 Ga0495625_0001583 Ga0495625_0001583_7886_8638 229
18 3300003781 Ga0055536_1004418 Ga0055536_10044182 230
19 3300025292 Ga0209676_1000084 Ga0209676_100008471 230
20 3300025298 Ga0209050_1032027 Ga0209050_10320272 230
21 3300046616 Ga0495668_0000015 Ga0495668_0000015_59495_60244 230
22 3300003784 Ga0055534_1012922 Ga0055534_10129221 231
23 3300005333 Ga0070677_10003254 Ga0070677_100032541 231
24 3300025291 Ga0209675_1000227 Ga0209675_10002276 231
25 3300025893 Ga0207682_10004189 Ga0207682_100041892 231
26 3300032005 Ga0307411_10036421 Ga0307411_100364213 231
27 3300047472 Ga0495686_0085108 Ga0495686_0085108_685_1440 231
28 3300003781 Ga0055536_1004851 Ga0055536_10048515 232
29 3300003791 Ga0055530_10000099 Ga0055530_1000009954 232
30 3300003791 Ga0055530_10000705 Ga0055530_100007056 232
31 3300003794 Ga0055531_10009098 Ga0055531_100090984 232
32 3300003794 Ga0055531_10028511 Ga0055531_100285112 232
33 3300005548 Ga0070665_100000373 Ga0070665_10000037327 232
34 3300025292 Ga0209676_1000330 Ga0209676_10003307 232
35 3300025292 Ga0209676_1000479 Ga0209676_100047963 232
36 3300025294 Ga0209025_1003996 Ga0209025_10039967 232
37 3300025297 Ga0209758_1073764 Ga0209758_10737641 232
38 3300025298 Ga0209050_1000113 Ga0209050_1000113124 232
39 3300025304 Ga0209257_1000083 Ga0209257_1000083133 232
40 3300025304 Ga0209257_1000126 Ga0209257_1000126107 232
41 3300025304 Ga0209257_1000340 Ga0209257_10003403 232
42 3300028379 Ga0268266_10001058 Ga0268266_1000105823 232
43 3300031911 Ga0307412_10013146 Ga0307412_100131463 232
44 3300032004 Ga0307414_10020188 Ga0307414_100201883 232
45 3300046523 Ga0495644_0116097 Ga0495644_0116097_76_882 232
46 3300048928 Ga0496125_0079521 Ga0496125_0079521_67_822 232
47 3300048929 Ga0496126_0382106 Ga0496126_0382106_147_902 232
48 3300005455 Ga0070663_100240108 Ga0070663_1002401081 233
49 3300009148 Ga0105243_10103135 Ga0105243_101031352 233
50 3300025940 Ga0207691_10407082 Ga0207691_104070821 233
51 3300031911 Ga0307412_10002686 Ga0307412_100026865 233
52 3300046460 Ga0495638_0100266 Ga0495638_0100266_744_1550 233
53 3300005334 Ga0068869_100224016 Ga0068869_1002240162 234
54 3300013308 Ga0157375_10544656 Ga0157375_105446561 234
55 3300014325 Ga0163163_10343552 Ga0163163_103435522 234
56 3300025942 Ga0207689_10323116 Ga0207689_103231161 234
57 3300035691 Ga0373931_0006782 Ga0373931_0006782_4319_5272 234
58 3300048907 Ga0496104_0030727 Ga0496104_0030727_1171_2124 234
59 3300048908 Ga0496105_0007957 Ga0496105_0007957_2847_3800 234
60 3300048911 Ga0496108_0019163 Ga0496108_0019163_4522_5475 234
61 3300048912 Ga0496109_0063013 Ga0496109_0063013_967_1920 234
62 3300048912 Ga0496109_0076144 Ga0496109_0076144_1877_2671 234
63 3300048913 Ga0496110_0015620 Ga0496110_0015620_350_1303 234
64 3300048914 Ga0496111_0004897 Ga0496111_0004897_4983_5936 234
65 3300048915 Ga0496112_0011178 Ga0496112_0011178_2728_3681 234
66 3300048916 Ga0496113_0004503 Ga0496113_0004503_4800_5753 234
67 3300048917 Ga0496114_0006640 Ga0496114_0006640_2896_3849 234
68 3300048918 Ga0496115_0014022 Ga0496115_0014022_4245_5198 234
69 3300049778 Ga0501282_006695 Ga0501282_006695_63_818 234
70 3300005338 Ga0068868_100570248 Ga0068868_1005702481 235
71 3300005347 Ga0070668_100107428 Ga0070668_1001074282 235
72 3300005353 Ga0070669_100312590 Ga0070669_1003125901 235
73 3300005457 Ga0070662_100291492 Ga0070662_1002914921 235
74 3300005544 Ga0070686_100192496 Ga0070686_1001924962 235
75 3300005577 Ga0068857_100822380 Ga0068857_1008223801 235
76 3300005842 Ga0068858_100281801 Ga0068858_1002818012 235
77 3300006881 Ga0068865_100104820 Ga0068865_1001048202 235
78 3300009098 Ga0105245_10237872 Ga0105245_102378722 235
79 3300011119 Ga0105246_10051538 Ga0105246_100515383 235
80 3300014326 Ga0157380_10142410 Ga0157380_101424102 235
81 3300025901 Ga0207688_10041629 Ga0207688_100416293 235
82 3300025938 Ga0207704_10578026 Ga0207704_105780261 235
83 3300025972 Ga0207668_10108219 Ga0207668_101082192 235
84 3300026067 Ga0207678_10164778 Ga0207678_101647781 235
85 3300026075 Ga0207708_10093896 Ga0207708_100938962 235
86 3300028380 Ga0268265_10258536 Ga0268265_102585361 235
87 3300048905 Ga0496102_0006284 Ga0496102_0006284_2709_3662 235
88 3300025297 Ga0209758_1032403 Ga0209758_10324032 236
89 3300026118 Ga0207675_100295410 Ga0207675_1002954102 237
90 3300031507 Ga0307509_10430616 Ga0307509_104306161 237
91 3300050496 nmdc:mga07m45_207118_c1 nmdc:mga07m45_207118_c1_83_865 237
92 3300006178 Ga0075367_10104297 Ga0075367_101042971 238
93 3300006195 Ga0075366_10151472 Ga0075366_101514722 238
94 3300050493 nmdc:mga0k408_123777_c1 nmdc:mga0k408_123777_c1_284_1072 238
95 iso_pu_bacteria 2906386501 2906387863 238
96 3300048921 Ga0496118_0003936 Ga0496118_0003936_14669_15400 239
97 3300053139 Ga0500568_0001613 Ga0500568_0001613_1943_2698 239
98 3300053153 Ga0500616_0000411 Ga0500616_0000411_57_812 239
99 3300009093 Ga0105240_11219984 Ga0105240_112199841 240
100 3300025937 Ga0207669_10124524 Ga0207669_101245242 240
101 3300041512 Ga0451853_3950760 Ga0451853_3950760_33_821 240
102 3300049758 Ga0501241_016959 Ga0501241_016959_402_1169 240
103 3300053151 Ga0500604_0000046 Ga0500604_0000046_45296_46048 240
104 3300005843 Ga0068860_100377662 Ga0068860_1003776623 242
105 3300005844 Ga0068862_100334885 Ga0068862_1003348852 242
106 3300025908 Ga0207643_10028444 Ga0207643_100284442 242
107 3300025942 Ga0207689_10153282 Ga0207689_101532822 242
108 3300028380 Ga0268265_10388940 Ga0268265_103889401 242
109 3300048921 Ga0496118_0162453 Ga0496118_0162453_50_838 242
110 3300048929 Ga0496126_0178112 Ga0496126_0178112_781_1569 242
111 3300005334 Ga0068869_100127573 Ga0068869_1001275732 243
112 iso_pu_bacteria 2643221560 2643822242 243
113 iso_pu_bacteria 2643221588 2643950559 243
114 3300053125 Ga0500618_009909 Ga0500618_009909_198_965 244
115 3300005983 Ga0081540_1002234 Ga0081540_100223411 245
116 3300010375 Ga0105239_10620511 Ga0105239_106205111 245
117 3300014325 Ga0163163_10041447 Ga0163163_100414472 245
118 3300031824 Ga0307413_10297794 Ga0307413_102977941 245
119 3300049574 Ga0501038_0124482 Ga0501038_0124482_191_958 245
120 3300049579 Ga0501043_0060811 Ga0501043_0060811_1763_2530 245
121 3300049581 Ga0501047_0027905 Ga0501047_0027905_3282_4049 245
122 3300049585 Ga0501069_0002418 Ga0501069_0002418_3134_3901 245
123 3300049586 Ga0501070_0002589 Ga0501070_0002589_8485_9252 245
124 3300049587 Ga0501071_0054652 Ga0501071_0054652_1762_2529 245
125 3300049742 Ga0501080_0091658 Ga0501080_0091658_1606_2373 245
126 3300049822 Ga0501035_0006881 Ga0501035_0006881_4443_5210 245
127 3300049823 Ga0501044_0017467 Ga0501044_0017467_5258_6025 245
128 3300006038 Ga0075365_10052155 Ga0075365_100521552 246
129 3300006186 Ga0075369_10097028 Ga0075369_100970282 246
130 3300009093 Ga0105240_10004330 Ga0105240_100043305 246
131 3300009093 Ga0105240_10046019 Ga0105240_100460193 246
132 3300010375 Ga0105239_10581728 Ga0105239_105817282 246
133 3300025913 Ga0207695_10019781 Ga0207695_100197813 246
134 3300025913 Ga0207695_10025395 Ga0207695_100253953 246
135 3300026088 Ga0207641_10113926 Ga0207641_101139262 246
136 3300031852 Ga0307410_10292580 Ga0307410_102925802 246
137 3300046512 Ga0495610_0072836 Ga0495610_0072836_462_1229 246
138 3300048921 Ga0496118_0129246 Ga0496118_0129246_485_1252 246
139 3300048926 Ga0496123_0043907 Ga0496123_0043907_383_1150 246
140 3300048928 Ga0496125_0007945 Ga0496125_0007945_3951_4718 246
141 3300050492 nmdc:mga0yw44_113443_c1 nmdc:mga0yw44_113443_c1_796_1560 246
142 3300050516 nmdc:mga0sz30_49747_c1 nmdc:mga0sz30_49747_c1_642_1409 246
143 3300053156 Ga0500622_0000624 Ga0500622_0000624_16224_16991 246
144 iso_pu_bacteria 2509276021 2509390954 246
145 iso_pu_bacteria 2585427634 2586001281 246
146 iso_pu_bacteria 2791355266 2793361804 246
147 iso_pu_bacteria 2838680041 2838686111 246
148 iso_pu_bacteria 2838694306 2838700518 246
149 iso_pu_bacteria 2838707686 2838713797 246
150 iso_pu_bacteria 2841864319 2841865710 246
151 iso_pu_bacteria 2842077413 2842083050 246
152 iso_pu_bacteria 2842118031 2842124142 246
153 iso_pu_bacteria 2842217011 2842222494 246
154 iso_pu_bacteria 2842237096 2842243210 246
155 iso_pu_bacteria 2842291075 2842297309 246
156 iso_pu_bacteria 2842341865 2842345661 246
157 iso_pu_bacteria 2842363717 2842363955 246
158 iso_pu_bacteria 2842370503 2842376270 246
159 iso_pu_bacteria 2842377471 2842383703 246
160 iso_pu_bacteria 2842384541 2842390842 246
161 iso_pu_bacteria 2889790730 2889791048 246
162 iso_pu_bacteria 2889914905 2889915429 246
163 iso_pu_bacteria 2935894831 2935900834 246
164 3300048917 Ga0496114_0101490 Ga0496114_0101490_906_1655 247
165 3300050492 nmdc:mga0yw44_8366_c1 nmdc:mga0yw44_8366_c1_2749_3504 247
166 iso_pu_bacteria 2508501122 2509110322 247
167 iso_pu_bacteria 2510065059 2510317084 247
168 iso_pu_bacteria 2510917026 2511168751 247
169 iso_pu_bacteria 2512047086 2512530714 247
170 iso_pu_bacteria 2513237305 2514418149 247
171 iso_pu_bacteria 2582581315 2585327812 247
172 iso_pu_bacteria 2585427594 2585848018 247
173 iso_pu_bacteria 2643221568 2643857233 247
174 iso_pu_bacteria 2721755686 2723573558 247
175 iso_pu_bacteria 2738541317 2738945090 247
176 iso_pu_bacteria 2751185800 2753357856 247
177 iso_pu_bacteria 2765235802 2765468988 247
178 iso_pu_bacteria 2775506902 2776270171 247
179 iso_pu_bacteria 2775506904 2776280591 247
180 iso_pu_bacteria 2839993093 2839993094 247
181 iso_pu_bacteria 2840764183 2840768186 247
182 iso_pu_bacteria 2854916844 2854920104 247
183 iso_pu_bacteria 2891373044 2891376841 247
184 iso_pu_bacteria 2904578770 2904584093 247
185 iso_pu_bacteria 2913308742 2913309716 247
186 iso_pu_bacteria 2919119836 2919124972 247
187 iso_pu_bacteria 2919166419 2919170377 247
188 iso_pu_bacteria 2920760137 2920764458 247
189 iso_pu_bacteria 2924221636 2924225903 247
190 iso_pu_bacteria 2928521798 2928526795 247
191 iso_pu_bacteria 2929138655 2929141240 247
192 iso_pu_bacteria 2929138655 2929142598 247
193 iso_pu_bacteria 2954011201 2954013236 247
194 iso_pu_bacteria 2957484790 2957487492 247
195 iso_pu_bacteria 2967706974 2967711305 247
196 iso_pu_bacteria 2970136068 2970137413 247
197 iso_pu_bacteria 3002141150 3002145203 247
198 3300005577 Ga0068857_100074712 Ga0068857_1000747122 248
199 3300009098 Ga0105245_10084606 Ga0105245_100846063 248
200 3300014326 Ga0157380_10433818 Ga0157380_104338182 248
201 3300025927 Ga0207687_10076595 Ga0207687_100765953 248
202 3300042003 Ga0439443_000228 Ga0439443_000228_95_853 248
203 3300044694 Ga0466963_0051214 Ga0466963_0051214_267_1013 248
204 3300044719 Ga0466971_0077886 Ga0466971_0077886_401_1147 248
205 3300045836 Ga0466958_0114885 Ga0466958_0114885_61_807 248
206 3300045976 Ga0466967_0015282 Ga0466967_0015282_2087_2833 248
207 3300045976 Ga0466967_0350637 Ga0466967_0350637_337_1083 248
208 3300053092 Ga0500583_0023840 Ga0500583_0023840_1595_2362 248
209 3300053096 Ga0500641_0010083 Ga0500641_0010083_2047_2814 248
210 3300053130 Ga0500642_0008074 Ga0500642_0008074_108_875 248
211 3300053142 Ga0500577_0001327 Ga0500577_0001327_3003_3770 248
212 3300053161 Ga0500634_0015368 Ga0500634_0015368_2027_2794 248
213 3300061719 Ga0466962_0032953 Ga0466962_0032953_1364_2110 248
214 3300010375 Ga0105239_10196250 Ga0105239_101962502 249
215 3300025294 Ga0209025_1005526 Ga0209025_10055262 249
216 3300028794 Ga0307515_10002668 Ga0307515_1000266822 249
217 3300037466 Ga0395898_0515740 Ga0395898_0515740_47_796 249
218 3300037471 Ga0395905_0001781 Ga0395905_0001781_22903_23664 249
219 3300037471 Ga0395905_0021221 Ga0395905_0021221_4213_4974 249
220 3300044694 Ga0466963_0327761 Ga0466963_0327761_107_856 249
221 3300044842 Ga0466957_0023805 Ga0466957_0023805_1489_2238 249
222 3300045976 Ga0466967_0451609 Ga0466967_0451609_232_981 249
223 3300046460 Ga0495638_0034634 Ga0495638_0034634_2044_2805 249
224 3300048927 Ga0496124_0094589 Ga0496124_0094589_949_1698 249
225 3300049823 Ga0501044_0148705 Ga0501044_0148705_720_1481 249
226 3300050493 nmdc:mga0k408_34478_c1 nmdc:mga0k408_34478_c1_1097_1858 249
227 3300053122 Ga0500608_043910 Ga0500608_043910_1188_1949 249
228 3300053156 Ga0500622_0004396 Ga0500622_0004396_4889_5650 249
229 3300053158 Ga0500627_0104878 Ga0500627_0104878_69_830 249
230 iso_pu_bacteria 2854911287 2854916428 249
231 3300005548 Ga0070665_100036428 Ga0070665_1000364285 250
232 3300005985 Ga0081539_10003955 Ga0081539_100039552 250
233 3300006048 Ga0075363_100013416 Ga0075363_1000134163 250
234 3300006177 Ga0075362_10022150 Ga0075362_100221503 250
235 3300006186 Ga0075369_10199778 Ga0075369_101997781 250
236 3300006195 Ga0075366_10244537 Ga0075366_102445372 250
237 3300009093 Ga0105240_10840157 Ga0105240_108401572 250
238 3300009545 Ga0105237_10000166 Ga0105237_1000016669 250
239 3300010375 Ga0105239_10003277 Ga0105239_1000327717 250
240 3300025914 Ga0207671_10001225 Ga0207671_1000122522 250
241 3300026041 Ga0207639_10018060 Ga0207639_100180603 250
242 3300027876 Ga0209974_10028198 Ga0209974_100281982 250
243 3300028379 Ga0268266_10000167 Ga0268266_1000016742 250
244 3300031911 Ga0307412_10272005 Ga0307412_102720052 250
245 3300039062 Ga0400483_050586 Ga0400483_050586_514_1272 250
246 3300039062 Ga0400483_200679 Ga0400483_200679_1856_2614 250
247 3300044693 Ga0466961_0128927 Ga0466961_0128927_287_1039 250
248 3300049590 Ga0501074_0312468 Ga0501074_0312468_203_967 250
249 3300050489 nmdc:mga03683_25194_c1 nmdc:mga03683_25194_c1_407_1171 250
250 3300050490 nmdc:mga03n38_20828_c1 nmdc:mga03n38_20828_c1_1019_1783 250
251 3300050491 nmdc:mga00v17_129389_c1 nmdc:mga00v17_129389_c1_25_789 250
252 3300050496 nmdc:mga07m45_223586_c1 nmdc:mga07m45_223586_c1_18_782 250
253 3300003187 JGI25151J46595_10013694 JGI25151J46595_100136942 251
254 3300005328 Ga0070676_10041465 Ga0070676_100414653 251
255 3300005339 Ga0070660_100010678 Ga0070660_1000106785 251
256 3300005347 Ga0070668_100191498 Ga0070668_1001914983 251
257 3300005355 Ga0070671_100251628 Ga0070671_1002516282 251
258 3300005356 Ga0070674_100012607 Ga0070674_1000126072 251
259 3300005457 Ga0070662_100223678 Ga0070662_1002236782 251
260 3300005539 Ga0068853_100003517 Ga0068853_10000351710 251
261 3300005539 Ga0068853_100019651 Ga0068853_1000196514 251
262 3300005577 Ga0068857_100038315 Ga0068857_1000383152 251
263 3300005616 Ga0068852_100005362 Ga0068852_1000053624 251
264 3300005834 Ga0068851_10064028 Ga0068851_100640282 251
265 3300006038 Ga0075365_10066338 Ga0075365_100663381 251
266 3300006051 Ga0075364_10003690 Ga0075364_1000369010 251
267 3300006051 Ga0075364_10034872 Ga0075364_100348723 251
268 3300010375 Ga0105239_10071250 Ga0105239_100712504 251
269 3300013100 Ga0157373_10251691 Ga0157373_102516912 251
270 3300013102 Ga0157371_10000626 Ga0157371_1000062621 251
271 3300013308 Ga0157375_10162078 Ga0157375_101620782 251
272 3300025294 Ga0209025_1000416 Ga0209025_100041647 251
273 3300025907 Ga0207645_10022261 Ga0207645_100222613 251
274 3300025919 Ga0207657_10030723 Ga0207657_100307234 251
275 3300025919 Ga0207657_10188322 Ga0207657_101883221 251
276 3300025932 Ga0207690_10588614 Ga0207690_105886141 251
277 3300025933 Ga0207706_10268411 Ga0207706_102684112 251
278 3300025937 Ga0207669_10239759 Ga0207669_102397592 251
279 3300025949 Ga0207667_10096159 Ga0207667_100961594 251
280 3300025972 Ga0207668_10139909 Ga0207668_101399093 251
281 3300026067 Ga0207678_10073196 Ga0207678_100731963 251
282 3300026089 Ga0207648_10068137 Ga0207648_100681371 251
283 3300026089 Ga0207648_10294843 Ga0207648_102948432 251
284 3300026116 Ga0207674_10049184 Ga0207674_100491844 251
285 3300026121 Ga0207683_10441376 Ga0207683_104413761 251
286 3300028379 Ga0268266_10236374 Ga0268266_102363742 251
287 3300031852 Ga0307410_10271110 Ga0307410_102711102 251
288 3300037466 Ga0395898_0215579 Ga0395898_0215579_43_798 251
289 3300039062 Ga0400483_032987 Ga0400483_032987_348_1118 251
290 3300039062 Ga0400483_093245 Ga0400483_093245_76_831 251
291 3300044683 Ga0466965_0081656 Ga0466965_0081656_201_956 251
292 3300044693 Ga0466961_0365575 Ga0466961_0365575_35_790 251
293 3300044693 Ga0466961_0372729 Ga0466961_0372729_12_767 251
294 3300044765 Ga0466970_0028665 Ga0466970_0028665_427_1182 251
295 3300045049 Ga0466959_0082711 Ga0466959_0082711_209_964 251
296 3300046512 Ga0495610_0013370 Ga0495610_0013370_1037_1804 251
297 3300046515 Ga0495620_0018829 Ga0495620_0018829_70_837 251
298 3300046519 Ga0495632_0142678 Ga0495632_0142678_304_1071 251
299 3300046522 Ga0495643_0067549 Ga0495643_0067549_422_1189 251
300 3300047472 Ga0495686_0030700 Ga0495686_0030700_1266_2033 251
301 3300048919 Ga0496116_0056735 Ga0496116_0056735_130_897 251
302 3300048919 Ga0496116_0065501 Ga0496116_0065501_330_1100 251
303 3300048919 Ga0496116_0182315 Ga0496116_0182315_101_871 251
304 3300048919 Ga0496116_0282164 Ga0496116_0282164_31_786 251
305 3300048920 Ga0496117_0001262 Ga0496117_0001262_25972_26727 251
306 3300048920 Ga0496117_0180247 Ga0496117_0180247_145_915 251
307 3300048921 Ga0496118_0036793 Ga0496118_0036793_1383_2291 251
308 3300048922 Ga0496119_0108620 Ga0496119_0108620_221_976 251
309 3300048924 Ga0496121_0000003 Ga0496121_0000003_852960_853715 251
310 3300048924 Ga0496121_0000005 Ga0496121_0000005_69564_70364 251
311 3300048925 Ga0496122_0000770 Ga0496122_0000770_36035_36790 251
312 3300048925 Ga0496122_0042417 Ga0496122_0042417_718_1548 251
313 3300048926 Ga0496123_0000018 Ga0496123_0000018_152478_153233 251
314 3300048926 Ga0496123_0043061 Ga0496123_0043061_2273_3028 251
315 3300048927 Ga0496124_0002233 Ga0496124_0002233_22265_23023 251
316 3300048927 Ga0496124_0074195 Ga0496124_0074195_470_1225 251
317 3300048927 Ga0496124_0081628 Ga0496124_0081628_895_1695 251
318 3300048928 Ga0496125_0000034 Ga0496125_0000034_132325_133125 251
319 3300048928 Ga0496125_0000170 Ga0496125_0000170_49131_49886 251
320 3300048928 Ga0496125_0000575 Ga0496125_0000575_43298_44053 251
321 3300048929 Ga0496126_0001062 Ga0496126_0001062_228_983 251
322 3300048929 Ga0496126_0040774 Ga0496126_0040774_2863_3675 251
323 3300048929 Ga0496126_0147817 Ga0496126_0147817_14_814 251
324 3300048929 Ga0496126_0221339 Ga0496126_0221339_185_1030 251
325 3300049459 Ga0495678_047430 Ga0495678_047430_457_1224 251
326 3300049568 Ga0501031_0011508 Ga0501031_0011508_2486_3253 251
327 3300049570 Ga0501033_0000334 Ga0501033_0000334_26031_26798 251
328 3300049573 Ga0501037_0000035 Ga0501037_0000035_74448_75215 251
329 3300049574 Ga0501038_0029507 Ga0501038_0029507_2142_2909 251
330 3300049579 Ga0501043_0000031 Ga0501043_0000031_40843_41610 251
331 3300049581 Ga0501047_0426044 Ga0501047_0426044_234_1001 251
332 3300049583 Ga0501067_0016577 Ga0501067_0016577_945_1739 251
333 3300049583 Ga0501067_0220477 Ga0501067_0220477_256_1023 251
334 3300049584 Ga0501068_0011664 Ga0501068_0011664_4165_4932 251
335 3300049585 Ga0501069_0000056 Ga0501069_0000056_49323_50090 251
336 3300049586 Ga0501070_0000141 Ga0501070_0000141_49325_50092 251
337 3300049586 Ga0501070_0263434 Ga0501070_0263434_194_961 251
338 3300049587 Ga0501071_0011450 Ga0501071_0011450_2795_3562 251
339 3300049589 Ga0501073_0040792 Ga0501073_0040792_603_1370 251
340 3300049590 Ga0501074_0000223 Ga0501074_0000223_27248_28015 251
341 3300049593 Ga0501077_0004999 Ga0501077_0004999_3555_4349 251
342 3300049742 Ga0501080_0001729 Ga0501080_0001729_10602_11369 251
343 3300049744 Ga0501083_0001157 Ga0501083_0001157_3996_4763 251
344 3300049822 Ga0501035_0000036 Ga0501035_0000036_113867_114634 251
345 3300049822 Ga0501035_0083446 Ga0501035_0083446_1812_2579 251
346 3300049823 Ga0501044_0000011 Ga0501044_0000011_222581_223348 251
347 3300049823 Ga0501044_0152207 Ga0501044_0152207_1290_2057 251
348 3300050491 nmdc:mga00v17_5966_c1 nmdc:mga00v17_5966_c1_4467_5267 251
349 3300053129 Ga0500628_004800 Ga0500628_004800_1160_1927 251
350 3300053153 Ga0500616_0000363 Ga0500616_0000363_15569_16336 251
351 3300053156 Ga0500622_0053973 Ga0500622_0053973_691_1458 251
352 3300054114 Ga0501084_0057246 Ga0501084_0057246_1728_2522 251
353 3300060353 Ga0501082_0037922 Ga0501082_0037922_2205_2972 251

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

58

252

0.98

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

63

299

0.97

PF08659

KR

KR domain

58

240

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
4g81-assembly1.cif.gz_D error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9803 5 251
4ibo-assembly1.cif.gz_C crystal structure of a putative gluconate dehydrogenase from agrobacterium tumefaciens (target efi-506446) 0.9712 5 251
5u9p-assembly1.cif.gz_C crystal structure of a gluconate 5-dehydrogenase from burkholderia cenocepacia j2315 in complex with nadp and tartrate 0.9708 5 251
3svt-assembly1.cif.gz_B structure of a short-chain type dehydrogenase/reductase from mycobacterium ulcerans 0.9632 7 250
4z9x-assembly1.cif.gz_A crystal structure of 2-keto-3-deoxy-d-gluconate dehydrogenase from streptococcus pyogenes 0.9617 5 249
ID Description Score Start End Superfamily
4iboB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9802 5 251 3.40.50.720
5u9pA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9734 5 251 3.40.50.720
af_Q0JDU3_1_168_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9685 83 247 3.40.50.720
af_Q54N15_5_159_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9676 60 179 3.40.50.720
af_F4J128_251_373_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9612 92 191 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A352RTL2-F1-model_v4 Gluconate 5-dehydrogenase 0.9781 85 251 GO:0016616
GO:0030497
AF-A0A7Y4UGX8-F1-model_v4 SDR family oxidoreductase 0.9777 99 249 GO:0016616
AF-A0A1A8VD90-F1-model_v4 Retinol dehydrogenase 8b 0.9742 85 178 GO:0004745
GO:0005829
GO:0016020
GO:0042572
AF-W1XNE0-F1-model_v4 Gluconate 5-dehydrogenase 0.9731 94 214 GO:0016491
AF-A0A352RTL2-F1-model_v4 Gluconate 5-dehydrogenase 0.9724 85 251 GO:0016616
GO:0030497

Feature Viewer

pLDDT pTM Quality
96.08 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map