F419455

General Info

Members Datasets Scaffolds Average Seq Length
353 238 706 282

Family's Representative Sequence

Representative Sequence 3300036401|Ga0373937_0260026|Ga0373937_0260026_203_1153
Length 316
Sequence LFFNPVAEFRMPLKCSQVCFLINYRSPISSMTMNIDRLLNGPPRVTRQVFSKNDTILYALGVGVGLGDPCDPEELRFVYERDLEALPTLAIVLAAPSFWLAGPELGIDWTRVVNAGQDMVLEGELPVEGEVSTELKIDAIWDKGAAKGALMCSSRQVRDAAGKLLATISQTHLLRGDGGFGGVDQPRDDGFAVPDRVPDHVVDLPTRPEQALIYRLSGDLNPLHIDPKISAAAGFGKPILHGSCTFGIAGRAIMKAAAGNRPERLRRMGARFSKPVYPGETIRTEIWQSGNTIMFRSRAVERDVVVLDRGIAEVRA

Samples

Sample ID Description Type Environment
1 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
2 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
3 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
4 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
66 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
102 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
103 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
104 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
105 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
106 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
107 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
108 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
109 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
110 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
111 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
112 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
113 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
114 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
115 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
116 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
117 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
118 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
119 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
120 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
121 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
122 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
123 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
124 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
125 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
126 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
127 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
128 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
129 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
130 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
131 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
132 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
133 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
134 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
136 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
137 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
138 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
139 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
140 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
141 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
142 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
143 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
144 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
145 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
146 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
147 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
148 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
149 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
150 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
151 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
152 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
153 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
154 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
155 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
156 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
157 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
158 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
159 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
160 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
161 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
162 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
163 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
164 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
165 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
166 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
167 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
168 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
169 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
170 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
171 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
172 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
173 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
174 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
175 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
176 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
177 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
178 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
179 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
180 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
181 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
182 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
183 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
184 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
185 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
186 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
187 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
188 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
189 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
190 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
191 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
192 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
193 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
194 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
195 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
196 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
197 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
198 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
199 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
200 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
201 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
202 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
203 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
204 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
205 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
206 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
207 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
208 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
209 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
210 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
211 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
212 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
213 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
214 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
218 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
219 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
220 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
221 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
222 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
223 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
224 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
225 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
226 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
227 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
228 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
229 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
230 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
231 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
232 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
233 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
234 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
235 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
236 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
237 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
238 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.03
Metatranscriptomes 1.42
Isolates 2.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.97
Nodule 0
Rhizoplane 3.4
Rhizosphere 85.84
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373937_0260026 3300036401 Bacteria 1637
2 Ga0055524_1023451 3300003775 Bacteria 1986
3 Ga0055536_1000097 3300003781 Bacteria 75926
4 Ga0065165_1002786 3300005262 Bacteria 13818
5 Ga0065707_10086567 3300005295 Bacteria 5399
6 Ga0070658_10053250 3300005327 Bacteria 3284
7 Ga0070683_100034116 3300005329 Bacteria 4646
8 Ga0070666_10134204 3300005335 Bacteria 1721
9 Ga0070680_100005404 3300005336 Bacteria 9671
10 Ga0070680_100129959 3300005336 Bacteria 2106
11 Ga0068868_100204374 3300005338 Bacteria 1648
12 Ga0070660_100066530 3300005339 Bacteria 2806
13 Ga0070689_100224393 3300005340 Bacteria 1542
14 Ga0070689_100407949 3300005340 Bacteria 1150
15 Ga0070691_10111741 3300005341 Bacteria 1368
16 Ga0070692_10139017 3300005345 Bacteria 1373
17 Ga0070668_100004254 3300005347 Bacteria 10625
18 Ga0070669_100205745 3300005353 Bacteria 1551
19 Ga0070671_100000391 3300005355 Bacteria 30148
20 Ga0070671_100002841 3300005355 Bacteria 13453
21 Ga0070673_100159886 3300005364 Bacteria 1915
22 Ga0070667_100128328 3300005367 Bacteria 2212
23 Ga0070714_100259005 3300005435 Bacteria 1610
24 Ga0070714_100518327 3300005435 Bacteria 1138
25 Ga0070713_100027357 3300005436 Bacteria 4488
26 Ga0070713_100056760 3300005436 Bacteria 3257
27 Ga0070713_100094013 3300005436 Bacteria 2584
28 Ga0070711_100317497 3300005439 Bacteria 1244
29 Ga0070708_100124257 3300005445 Bacteria 2384
30 Ga0070681_10005626 3300005458 Bacteria 12107
31 Ga0070706_100629417 3300005467 Bacteria 996
32 Ga0070707_100271685 3300005468 Bacteria 1648
33 Ga0070699_100214447 3300005518 Bacteria 1714
34 Ga0070679_100067617 3300005530 Bacteria 3563
35 Ga0070679_100075971 3300005530 Bacteria 3349
36 Ga0070684_100043564 3300005535 Bacteria 3876
37 Ga0070696_100005845 3300005546 Bacteria 8210
38 Ga0070665_100000888 3300005548 Bacteria 38364
39 Ga0070665_100290979 3300005548 Bacteria 1636
40 Ga0070665_100316749 3300005548 Bacteria 1564
41 Ga0068855_100237967 3300005563 Bacteria 2035
42 Ga0068857_100058954 3300005577 Bacteria 3409
43 Ga0068857_100093371 3300005577 Bacteria 2694
44 Ga0068857_100322149 3300005577 Bacteria 1428
45 Ga0068859_100000168 3300005617 Bacteria 63325
46 Ga0068864_100022865 3300005618 Bacteria 5245
47 Ga0068863_100004525 3300005841 Bacteria 13709
48 Ga0068858_100005728 3300005842 Bacteria 12142
49 Ga0068858_100075255 3300005842 Bacteria 3136
50 Ga0068860_100049807 3300005843 Bacteria 3988
51 Ga0081455_10000215 3300005937 Bacteria 73808
52 Ga0081455_10000844 3300005937 Bacteria 39504
53 Ga0081455_10032773 3300005937 Bacteria 4677
54 Ga0075364_10031120 3300006051 Bacteria 3428
55 Ga0070712_100009829 3300006175 Bacteria 6029
56 Ga0070712_100074156 3300006175 Bacteria 2444
57 Ga0075367_10115133 3300006178 Bacteria 1653
58 Ga0075428_100083435 3300006844 Bacteria 3487
59 Ga0075430_100007359 3300006846 Bacteria 9301
60 Ga0075431_100045981 3300006847 Bacteria 4500
61 Ga0075434_100268113 3300006871 Bacteria 1727
62 Ga0097620_100000168 3300006931 Bacteria 63325
63 Ga0075435_100095405 3300007076 Bacteria 2460
64 Ga0075435_100267903 3300007076 Bacteria 1456
65 Ga0105240_10096584 3300009093 Bacteria 3601
66 Ga0105240_10245296 3300009093 Bacteria 2075
67 Ga0105247_10087815 3300009101 Bacteria 1970
68 Ga0114129_10056332 3300009147 Bacteria 5506
69 Ga0114129_10202466 3300009147 Bacteria 2688
70 Ga0114129_10458429 3300009147 Bacteria 1671
71 Ga0105248_10008070 3300009177 Bacteria 11555
72 Ga0105248_10462044 3300009177 Bacteria 1431
73 Ga0105237_10383827 3300009545 Bacteria 1410
74 Ga0105238_10034551 3300009551 Bacteria 5143
75 Ga0105238_10345410 3300009551 Bacteria 1477
76 Ga0105239_10299548 3300010375 Bacteria 1811
77 Ga0163162_10006234 3300013306 Bacteria 11560
78 Ga0163162_10065351 3300013306 Bacteria 3684
79 Ga0157372_10616037 3300013307 Bacteria 1265
80 Ga0163163_10016275 3300014325 Bacteria 6905
81 Ga0163163_10050116 3300014325 Bacteria 4111
82 Ga0157379_10001371 3300014968 Bacteria 19938
83 Ga0157379_10082205 3300014968 Bacteria 2886
84 Ga0157379_10170712 3300014968 Bacteria 1963
85 Ga0157376_10006160 3300014969 Bacteria 8447
86 Ga0206356_11118473 3300020070 Bacteria 1079
87 Ga0206351_10213201 3300020077 Bacteria 1566
88 Ga0206354_10169300 3300020081 Bacteria 1308
89 Ga0206353_11977678 3300020082 Bacteria 1120
90 Ga0213875_10023104 3300021388 Bacteria 2971
91 Ga0224712_10080930 3300022467 Bacteria 1340
92 Ga0209676_1000077 3300025292 Bacteria 298831
93 Ga0209564_1010581 3300025295 Bacteria 4230
94 Ga0209256_1001950 3300025299 Bacteria 18718
95 Ga0209257_1019038 3300025304 Bacteria 2606
96 Ga0207692_10387962 3300025898 Bacteria 868
97 Ga0207685_10034122 3300025905 Bacteria 1846
98 Ga0207699_10083665 3300025906 Bacteria 1986
99 Ga0207705_10325131 3300025909 Bacteria 1182
100 Ga0207695_10209724 3300025913 Bacteria 1859
101 Ga0207693_10009950 3300025915 Bacteria 7731
102 Ga0207693_10035418 3300025915 Bacteria 3936
103 Ga0207693_10039145 3300025915 Bacteria 3733
104 Ga0207663_10034208 3300025916 Bacteria 3036
105 Ga0207660_10014756 3300025917 Bacteria 5147
106 Ga0207657_10112294 3300025919 Bacteria 2249
107 Ga0207652_10032839 3300025921 Bacteria 4367
108 Ga0207681_10076499 3300025923 Bacteria 2350
109 Ga0207694_10193240 3300025924 Bacteria 1654
110 Ga0207700_10004652 3300025928 Bacteria 8131
111 Ga0207700_10019280 3300025928 Bacteria 4605
112 Ga0207700_10060899 3300025928 Bacteria 2860
113 Ga0207700_10126363 3300025928 Bacteria 2081
114 Ga0207700_10172337 3300025928 Bacteria 1806
115 Ga0207664_10006789 3300025929 Bacteria 7908
116 Ga0207664_10099978 3300025929 Bacteria 2394
117 Ga0207644_10000567 3300025931 Bacteria 23685
118 Ga0207644_10009687 3300025931 Bacteria 6333
119 Ga0207665_10023831 3300025939 Bacteria 4031
120 Ga0207665_10032276 3300025939 Bacteria 3467
121 Ga0207711_10006940 3300025941 Bacteria 9506
122 Ga0207711_10333713 3300025941 Bacteria 1403
123 Ga0207661_10064877 3300025944 Bacteria 2962
124 Ga0207668_10001990 3300025972 Bacteria 11937
125 Ga0207677_10137888 3300026023 Bacteria 1863
126 Ga0207703_10010680 3300026035 Bacteria 7172
127 Ga0207703_10258247 3300026035 Bacteria 1574
128 Ga0207678_10003320 3300026067 Bacteria 14508
129 Ga0207702_10045277 3300026078 Bacteria 3702
130 Ga0207702_10135005 3300026078 Bacteria 2225
131 Ga0207641_10014242 3300026088 Bacteria 6515
132 Ga0207641_10056748 3300026088 Bacteria 3329
133 Ga0207641_10535711 3300026088 Bacteria 1140
134 Ga0207676_10220335 3300026095 Bacteria 1689
135 Ga0207674_10076944 3300026116 Bacteria 3344
136 Ga0207675_100245614 3300026118 Bacteria 1731
137 Ga0268266_10007121 3300028379 Bacteria 10144
138 Ga0268265_10438492 3300028380 Bacteria 1217
139 Ga0268264_10042954 3300028381 Bacteria 3744
140 Ga0265337_1031615 3300028556 Bacteria 1570
141 Ga0265319_1010009 3300028563 Bacteria 3983
142 Ga0265338_10003750 3300028800 Bacteria 21109
143 Ga0265338_10016490 3300028800 Bacteria 8032
144 Ga0265339_10000064 3300031249 Bacteria 92992
145 Ga0265339_10055057 3300031249 Bacteria 2159
146 Ga0265316_10072024 3300031344 Bacteria 2663
147 Ga0307513_10032082 3300031456 Bacteria 5931
148 Ga0307513_10109363 3300031456 Bacteria 2762
149 Ga0307408_100084621 3300031548 Bacteria 2379
150 Ga0265313_10000020 3300031595 Bacteria 145873
151 Ga0265314_10111870 3300031711 Bacteria 1734
152 Ga0265342_10024365 3300031712 Bacteria 3821
153 Ga0307516_10009048 3300031730 Bacteria 11157
154 Ga0307413_10003515 3300031824 Bacteria 6610
155 Ga0307410_10036488 3300031852 Bacteria 3201
156 Ga0307407_10021151 3300031903 Bacteria 3349
157 Ga0307412_10071968 3300031911 Bacteria 2362
158 Ga0307409_100071743 3300031995 Bacteria 2755
159 Ga0307416_100002540 3300032002 Bacteria 10509
160 Ga0307414_10020609 3300032004 Bacteria 4113
161 Ga0307411_10020751 3300032005 Bacteria 3830
162 Ga0307411_10286007 3300032005 Bacteria 1315
163 Ga0307507_10125473 3300033179 Bacteria 2033
164 Ga0307510_10001481 3300033180 Bacteria 25913
165 Ga0373926_0003676 3300035083 Bacteria 4985
166 Ga0373926_0023770 3300035083 Bacteria 2130
167 Ga0373923_0115094 3300035111 Bacteria 1197
168 Ga0373923_0163846 3300035111 Bacteria 1015
169 Ga0373945_0001509 3300035116 Bacteria 7101
170 Ga0373956_0017308 3300035119 Bacteria 3037
171 Ga0373943_0000888 3300035170 Bacteria 13158
172 Ga0373946_0066815 3300035171 Bacteria 1542
173 Ga0373946_0072234 3300035171 Bacteria 1493
174 Ga0373955_0000923 3300035172 Bacteria 12618
175 Ga0373955_0174213 3300035172 Bacteria 1274
176 Ga0373924_0004640 3300035410 Bacteria 4816
177 Ga0373935_0016139 3300035692 Bacteria 4520
178 Ga0373935_0022988 3300035692 Bacteria 3829
179 Ga0373935_0197574 3300035692 Bacteria 1388
180 Ga0373927_0001545 3300035695 Bacteria 17282
181 Ga0373927_0012934 3300035695 Bacteria 5549
182 Ga0373927_0023414 3300035695 Bacteria 4044
183 Ga0373933_0000829 3300035724 Bacteria 18900
184 Ga0373933_0347609 3300035724 Bacteria 963
185 Ga0373947_0000629 3300035725 Bacteria 20890
186 Ga0373937_0001573 3300036401 Bacteria 19169
187 Ga0373937_0084727 3300036401 Bacteria 2932
188 Ga0373937_0090259 3300036401 Bacteria 2838
189 Ga0373937_0340097 3300036401 Bacteria 1421
190 Ga0373925_0003681 3300037068 Bacteria 11791
191 Ga0373925_0206557 3300037068 Bacteria 1563
192 Ga0395900_0573671 3300037418 Bacteria 1071
193 Ga0395898_0106998 3300037466 Bacteria 2682
194 Ga0395901_0386433 3300038443 Bacteria 1440
195 Ga0395901_0433107 3300038443 Bacteria 1347
196 Ga0466963_0077205 3300044694 Bacteria 2250
197 Ga0466957_0007717 3300044842 Bacteria 6087
198 Ga0466959_0017546 3300045049 Bacteria 5248
199 Ga0466958_0146441 3300045836 Bacteria 1488
200 Ga0495592_0005897 3300046454 Bacteria 9093
201 Ga0495592_0015355 3300046454 Bacteria 5810
202 Ga0495592_0111761 3300046454 Bacteria 1933
203 Ga0495603_0163687 3300046455 Bacteria 1290
204 Ga0495629_0013456 3300046459 Bacteria 5901
205 Ga0495638_0001067 3300046460 Bacteria 26737
206 Ga0495638_0001288 3300046460 Bacteria 23391
207 Ga0495638_0065936 3300046460 Bacteria 2227
208 Ga0495651_0001344 3300046462 Bacteria 19037
209 Ga0495651_0034649 3300046462 Bacteria 3934
210 Ga0495653_0001729 3300046463 Bacteria 17204
211 Ga0495653_0269311 3300046463 Bacteria 1122
212 Ga0495650_0001498 3300046471 Bacteria 22265
213 Ga0495580_0030826 3300046472 Bacteria 3879
214 Ga0495582_0052744 3300046473 Bacteria 2242
215 Ga0495582_0055929 3300046473 Bacteria 2175
216 Ga0495582_0077389 3300046473 Bacteria 1845
217 Ga0495639_0064451 3300046475 Bacteria 1684
218 Ga0495639_0143729 3300046475 Bacteria 1148
219 Ga0495662_0007202 3300046476 Bacteria 5509
220 Ga0495662_0129742 3300046476 Bacteria 1239
221 Ga0495662_0167494 3300046476 Bacteria 1082
222 Ga0495664_0004953 3300046477 Bacteria 7291
223 Ga0495664_0015491 3300046477 Bacteria 4334
224 Ga0495664_0017311 3300046477 Bacteria 4118
225 Ga0495584_0003237 3300046491 Bacteria 9030
226 Ga0495594_0086310 3300046499 Bacteria 1756
227 Ga0495583_0013553 3300046506 Bacteria 4540
228 Ga0495583_0062472 3300046506 Bacteria 1658
229 Ga0495608_0002298 3300046511 Bacteria 13794
230 Ga0495610_0000013 3300046512 Bacteria 465872
231 Ga0495618_0002859 3300046514 Bacteria 10937
232 Ga0495618_0004995 3300046514 Bacteria 8106
233 Ga0495618_0249218 3300046514 Bacteria 1114
234 Ga0495628_0006467 3300046516 Bacteria 10232
235 Ga0495628_0054122 3300046516 Bacteria 3164
236 Ga0495648_0011186 3300046524 Bacteria 6778
237 Ga0495648_0036844 3300046524 Bacteria 3148
238 Ga0495666_0010708 3300046526 Bacteria 4573
239 Ga0495642_0001807 3300046528 Bacteria 9178
240 Ga0495642_0051118 3300046528 Bacteria 1700
241 Ga0495652_0015160 3300046529 Bacteria 6902
242 Ga0495652_0015291 3300046529 Bacteria 6867
243 Ga0495654_0040547 3300046530 Bacteria 2320
244 Ga0495665_0031229 3300046531 Bacteria 2851
245 Ga0495665_0253031 3300046531 Bacteria 906
246 Ga0495640_0005574 3300046533 Bacteria 10011
247 Ga0495640_0011606 3300046533 Bacteria 6770
248 Ga0495640_0311829 3300046533 Bacteria 975
249 Ga0495587_0001279 3300046536 Bacteria 16737
250 Ga0495587_0004243 3300046536 Bacteria 9478
251 Ga0495609_0053229 3300046538 Bacteria 1800
252 Ga0495645_0142879 3300046543 Bacteria 1668
253 Ga0495667_0001050 3300046559 Bacteria 17936
254 Ga0495667_0072449 3300046559 Bacteria 2245
255 Ga0495668_0005815 3300046616 Bacteria 8243
256 Ga0495668_0011383 3300046616 Bacteria 5330
257 Ga0495634_0007005 3300046642 Bacteria 8505
258 Ga0495634_0126658 3300046642 Bacteria 1631
259 Ga0495611_0000490 3300046648 Bacteria 23633
260 Ga0495625_0022096 3300046660 Bacteria 4883
261 Ga0495625_0287458 3300046660 Bacteria 1056
262 Ga0495635_0014058 3300046663 Bacteria 5601
263 Ga0495635_0029109 3300046663 Bacteria 3839
264 Ga0495635_0094305 3300046663 Bacteria 2046
265 Ga0495657_0037843 3300046675 Bacteria 3323
266 Ga0495657_0146564 3300046675 Bacteria 1468
267 Ga0495599_0002557 3300046678 Bacteria 10596
268 Ga0495599_0037097 3300046678 Bacteria 3062
269 Ga0495623_0000818 3300046679 Bacteria 20977
270 Ga0495646_0001020 3300046680 Bacteria 16162
271 Ga0495647_0072546 3300046681 Bacteria 1381
272 Ga0495613_0090180 3300046689 Bacteria 2220
273 Ga0495671_0049825 3300046692 Bacteria 2087
274 Ga0495671_0050264 3300046692 Bacteria 2076
275 Ga0495581_0007429 3300047315 Bacteria 6335
276 Ga0495604_0000478 3300047317 Bacteria 35243
277 Ga0495604_0036899 3300047317 Bacteria 3851
278 Ga0495604_0081407 3300047317 Bacteria 2424
279 Ga0495674_0017099 3300047319 Bacteria 6756
280 Ga0495674_0588442 3300047319 Bacteria 882
281 Ga0495672_0044551 3300047320 Bacteria 2661
282 Ga0495672_0057711 3300047320 Bacteria 2253
283 Ga0495672_0088085 3300047320 Bacteria 1712
284 Ga0495680_0002409 3300047322 Bacteria 19174
285 Ga0495680_0056796 3300047322 Bacteria 3029
286 Ga0495675_0004118 3300047444 Bacteria 8808
287 Ga0495677_0000162 3300047445 Bacteria 32133
288 Ga0495677_0005162 3300047445 Bacteria 4969
289 Ga0495673_0001592 3300047469 Bacteria 17685
290 Ga0495673_0006608 3300047469 Bacteria 6799
291 Ga0495681_0000071 3300047470 Bacteria 94222
292 Ga0495684_0001237 3300047471 Bacteria 20565
293 Ga0495684_0002093 3300047471 Bacteria 16016
294 Ga0495684_0021058 3300047471 Bacteria 5022
295 Ga0495684_0023743 3300047471 Bacteria 4715
296 Ga0495684_0212577 3300047471 Bacteria 1421
297 Ga0495686_0007504 3300047472 Bacteria 8168
298 Ga0495593_0081223 3300047673 Bacteria 1676
299 Ga0495602_0015212 3300048088 Bacteria 7775
300 Ga0495614_0157976 3300048089 Bacteria 1014
301 Ga0496101_0354659 3300048904 Bacteria 1153
302 Ga0496102_0369479 3300048905 Bacteria 1350
303 Ga0496104_0003148 3300048907 Bacteria 14211
304 Ga0496105_0164395 3300048908 Bacteria 1821
305 Ga0496109_0020514 3300048912 Bacteria 5837
306 Ga0496109_0255413 3300048912 Bacteria 1651
307 Ga0496111_0114603 3300048914 Bacteria 1987
308 Ga0496112_0201901 3300048915 Bacteria 1947
309 Ga0496112_0238898 3300048915 Bacteria 1770
310 Ga0496112_0297039 3300048915 Bacteria 1561
311 Ga0496113_0070801 3300048916 Bacteria 2652
312 Ga0496113_0299747 3300048916 Bacteria 1287
313 Ga0496116_0009703 3300048919 Bacteria 8179
314 Ga0496117_0000034 3300048920 Bacteria 328334
315 Ga0496119_0011609 3300048922 Bacteria 7267
316 Ga0496122_0000511 3300048925 Bacteria 80182
317 Ga0496123_0000011 3300048926 Bacteria 493925
318 Ga0496124_0011868 3300048927 Bacteria 8674
319 Ga0496125_0010356 3300048928 Bacteria 9432
320 Ga0496126_0000672 3300048929 Bacteria 63309
321 Ga0496126_0013607 3300048929 Bacteria 8261
322 Ga0501033_0238072 3300049570 Bacteria 1292
323 Ga0501047_0259498 3300049581 Bacteria 1586
324 Ga0501044_0000144 3300049823 Bacteria 87628
325 Ga0501045_0188018 3300049824 Bacteria 1539
326 nmdc:mga03n38_109120_c1 3300050490 Bacteria 1345
327 nmdc:mga05p37_10559_c1 3300050507 Bacteria 10950
328 nmdc:mga05p37_50084_c1 3300050507 Bacteria 5136
329 nmdc:mga05p37_995049_c1 3300050507 Bacteria 891
330 nmdc:mga06r32_259650_c1 3300050510 Bacteria 1725
331 nmdc:mga06r32_70183_c1 3300050510 Bacteria 3387
332 nmdc:mga08x19_227590_c1 3300050514 Bacteria 1283
333 Ga0495601_0084592 3300053077 Bacteria 2037
334 Ga0495612_0009289 3300053078 Bacteria 3988
335 Ga0495612_0021063 3300053078 Bacteria 2615
336 Ga0495595_0011997 3300053084 Bacteria 3634
337 Ga0495595_0084417 3300053084 Bacteria 1517
338 Ga0495619_0007063 3300053085 Bacteria 7104
339 Ga0495619_0138551 3300053085 Bacteria 1674
340 Ga0495619_0360628 3300053085 Bacteria 1005
341 Ga0500578_0059019 3300053086 Bacteria 2452
342 Ga0500643_000437 3300053087 Bacteria 31375
343 Ga0500627_0000044 3300053158 Bacteria 62047
344 Ga0500645_004498 3300053730 Bacteria 5335
345 2643820856 2643221560 Bacteria 4801179
346 2643834731 2643221563 Bacteria 4726935
347 2644055658 2643221608 Bacteria 4724829
348 2816504954 2816332139 Bacteria 9138787
349 2824672904 2824671348 Bacteria 8369588
350 2824689452 2824687955 Bacteria 8360029
351 2884701888 2884693830 Bacteria 11273186
352 2895433305 2895427314 Bacteria 13147766
353 2915359657 2915358134 Bacteria 6050864
354 Ga0373937_0260026
355 Ga0055524_1023451
356 Ga0055536_1000097
357 Ga0065165_1002786
358 Ga0065707_10086567
359 Ga0070658_10053250
360 Ga0070683_100034116
361 Ga0070666_10134204
362 Ga0070680_100005404
363 Ga0070680_100129959
364 Ga0068868_100204374
365 Ga0070660_100066530
366 Ga0070689_100224393
367 Ga0070689_100407949
368 Ga0070691_10111741
369 Ga0070692_10139017
370 Ga0070668_100004254
371 Ga0070669_100205745
372 Ga0070671_100000391
373 Ga0070671_100002841
374 Ga0070673_100159886
375 Ga0070667_100128328
376 Ga0070714_100259005
377 Ga0070714_100518327
378 Ga0070713_100027357
379 Ga0070713_100056760
380 Ga0070713_100094013
381 Ga0070711_100317497
382 Ga0070708_100124257
383 Ga0070681_10005626
384 Ga0070706_100629417
385 Ga0070707_100271685
386 Ga0070699_100214447
387 Ga0070679_100067617
388 Ga0070679_100075971
389 Ga0070684_100043564
390 Ga0070696_100005845
391 Ga0070665_100000888
392 Ga0070665_100290979
393 Ga0070665_100316749
394 Ga0068855_100237967
395 Ga0068857_100058954
396 Ga0068857_100093371
397 Ga0068857_100322149
398 Ga0068859_100000168
399 Ga0068864_100022865
400 Ga0068863_100004525
401 Ga0068858_100005728
402 Ga0068858_100075255
403 Ga0068860_100049807
404 Ga0081455_10000215
405 Ga0081455_10000844
406 Ga0081455_10032773
407 Ga0075364_10031120
408 Ga0070712_100009829
409 Ga0070712_100074156
410 Ga0075367_10115133
411 Ga0075428_100083435
412 Ga0075430_100007359
413 Ga0075431_100045981
414 Ga0075434_100268113
415 Ga0097620_100000168
416 Ga0075435_100095405
417 Ga0075435_100267903
418 Ga0105240_10096584
419 Ga0105240_10245296
420 Ga0105247_10087815
421 Ga0114129_10056332
422 Ga0114129_10202466
423 Ga0114129_10458429
424 Ga0105248_10008070
425 Ga0105248_10462044
426 Ga0105237_10383827
427 Ga0105238_10034551
428 Ga0105238_10345410
429 Ga0105239_10299548
430 Ga0163162_10006234
431 Ga0163162_10065351
432 Ga0157372_10616037
433 Ga0163163_10016275
434 Ga0163163_10050116
435 Ga0157379_10001371
436 Ga0157379_10082205
437 Ga0157379_10170712
438 Ga0157376_10006160
439 Ga0206356_11118473
440 Ga0206351_10213201
441 Ga0206354_10169300
442 Ga0206353_11977678
443 Ga0213875_10023104
444 Ga0224712_10080930
445 Ga0209676_1000077
446 Ga0209564_1010581
447 Ga0209256_1001950
448 Ga0209257_1019038
449 Ga0207692_10387962
450 Ga0207685_10034122
451 Ga0207699_10083665
452 Ga0207705_10325131
453 Ga0207695_10209724
454 Ga0207693_10009950
455 Ga0207693_10035418
456 Ga0207693_10039145
457 Ga0207663_10034208
458 Ga0207660_10014756
459 Ga0207657_10112294
460 Ga0207652_10032839
461 Ga0207681_10076499
462 Ga0207694_10193240
463 Ga0207700_10004652
464 Ga0207700_10019280
465 Ga0207700_10060899
466 Ga0207700_10126363
467 Ga0207700_10172337
468 Ga0207664_10006789
469 Ga0207664_10099978
470 Ga0207644_10000567
471 Ga0207644_10009687
472 Ga0207665_10023831
473 Ga0207665_10032276
474 Ga0207711_10006940
475 Ga0207711_10333713
476 Ga0207661_10064877
477 Ga0207668_10001990
478 Ga0207677_10137888
479 Ga0207703_10010680
480 Ga0207703_10258247
481 Ga0207678_10003320
482 Ga0207702_10045277
483 Ga0207702_10135005
484 Ga0207641_10014242
485 Ga0207641_10056748
486 Ga0207641_10535711
487 Ga0207676_10220335
488 Ga0207674_10076944
489 Ga0207675_100245614
490 Ga0268266_10007121
491 Ga0268265_10438492
492 Ga0268264_10042954
493 Ga0265337_1031615
494 Ga0265319_1010009
495 Ga0265338_10003750
496 Ga0265338_10016490
497 Ga0265339_10000064
498 Ga0265339_10055057
499 Ga0265316_10072024
500 Ga0307513_10032082
501 Ga0307513_10109363
502 Ga0307408_100084621
503 Ga0265313_10000020
504 Ga0265314_10111870
505 Ga0265342_10024365
506 Ga0307516_10009048
507 Ga0307413_10003515
508 Ga0307410_10036488
509 Ga0307407_10021151
510 Ga0307412_10071968
511 Ga0307409_100071743
512 Ga0307416_100002540
513 Ga0307414_10020609
514 Ga0307411_10020751
515 Ga0307411_10286007
516 Ga0307507_10125473
517 Ga0307510_10001481
518 Ga0373926_0003676
519 Ga0373926_0023770
520 Ga0373923_0115094
521 Ga0373923_0163846
522 Ga0373945_0001509
523 Ga0373956_0017308
524 Ga0373943_0000888
525 Ga0373946_0066815
526 Ga0373946_0072234
527 Ga0373955_0000923
528 Ga0373955_0174213
529 Ga0373924_0004640
530 Ga0373935_0016139
531 Ga0373935_0022988
532 Ga0373935_0197574
533 Ga0373927_0001545
534 Ga0373927_0012934
535 Ga0373927_0023414
536 Ga0373933_0000829
537 Ga0373933_0347609
538 Ga0373947_0000629
539 Ga0373937_0001573
540 Ga0373937_0084727
541 Ga0373937_0090259
542 Ga0373937_0340097
543 Ga0373925_0003681
544 Ga0373925_0206557
545 Ga0395900_0573671
546 Ga0395898_0106998
547 Ga0395901_0386433
548 Ga0395901_0433107
549 Ga0466963_0077205
550 Ga0466957_0007717
551 Ga0466959_0017546
552 Ga0466958_0146441
553 Ga0495592_0005897
554 Ga0495592_0015355
555 Ga0495592_0111761
556 Ga0495603_0163687
557 Ga0495629_0013456
558 Ga0495638_0001067
559 Ga0495638_0001288
560 Ga0495638_0065936
561 Ga0495651_0001344
562 Ga0495651_0034649
563 Ga0495653_0001729
564 Ga0495653_0269311
565 Ga0495650_0001498
566 Ga0495580_0030826
567 Ga0495582_0052744
568 Ga0495582_0055929
569 Ga0495582_0077389
570 Ga0495639_0064451
571 Ga0495639_0143729
572 Ga0495662_0007202
573 Ga0495662_0129742
574 Ga0495662_0167494
575 Ga0495664_0004953
576 Ga0495664_0015491
577 Ga0495664_0017311
578 Ga0495584_0003237
579 Ga0495594_0086310
580 Ga0495583_0013553
581 Ga0495583_0062472
582 Ga0495608_0002298
583 Ga0495610_0000013
584 Ga0495618_0002859
585 Ga0495618_0004995
586 Ga0495618_0249218
587 Ga0495628_0006467
588 Ga0495628_0054122
589 Ga0495648_0011186
590 Ga0495648_0036844
591 Ga0495666_0010708
592 Ga0495642_0001807
593 Ga0495642_0051118
594 Ga0495652_0015160
595 Ga0495652_0015291
596 Ga0495654_0040547
597 Ga0495665_0031229
598 Ga0495665_0253031
599 Ga0495640_0005574
600 Ga0495640_0011606
601 Ga0495640_0311829
602 Ga0495587_0001279
603 Ga0495587_0004243
604 Ga0495609_0053229
605 Ga0495645_0142879
606 Ga0495667_0001050
607 Ga0495667_0072449
608 Ga0495668_0005815
609 Ga0495668_0011383
610 Ga0495634_0007005
611 Ga0495634_0126658
612 Ga0495611_0000490
613 Ga0495625_0022096
614 Ga0495625_0287458
615 Ga0495635_0014058
616 Ga0495635_0029109
617 Ga0495635_0094305
618 Ga0495657_0037843
619 Ga0495657_0146564
620 Ga0495599_0002557
621 Ga0495599_0037097
622 Ga0495623_0000818
623 Ga0495646_0001020
624 Ga0495647_0072546
625 Ga0495613_0090180
626 Ga0495671_0049825
627 Ga0495671_0050264
628 Ga0495581_0007429
629 Ga0495604_0000478
630 Ga0495604_0036899
631 Ga0495604_0081407
632 Ga0495674_0017099
633 Ga0495674_0588442
634 Ga0495672_0044551
635 Ga0495672_0057711
636 Ga0495672_0088085
637 Ga0495680_0002409
638 Ga0495680_0056796
639 Ga0495675_0004118
640 Ga0495677_0000162
641 Ga0495677_0005162
642 Ga0495673_0001592
643 Ga0495673_0006608
644 Ga0495681_0000071
645 Ga0495684_0001237
646 Ga0495684_0002093
647 Ga0495684_0021058
648 Ga0495684_0023743
649 Ga0495684_0212577
650 Ga0495686_0007504
651 Ga0495593_0081223
652 Ga0495602_0015212
653 Ga0495614_0157976
654 Ga0496101_0354659
655 Ga0496102_0369479
656 Ga0496104_0003148
657 Ga0496105_0164395
658 Ga0496109_0020514
659 Ga0496109_0255413
660 Ga0496111_0114603
661 Ga0496112_0201901
662 Ga0496112_0238898
663 Ga0496112_0297039
664 Ga0496113_0070801
665 Ga0496113_0299747
666 Ga0496116_0009703
667 Ga0496117_0000034
668 Ga0496119_0011609
669 Ga0496122_0000511
670 Ga0496123_0000011
671 Ga0496124_0011868
672 Ga0496125_0010356
673 Ga0496126_0000672
674 Ga0496126_0013607
675 Ga0501033_0238072
676 Ga0501047_0259498
677 Ga0501044_0000144
678 Ga0501045_0188018
679 nmdc:mga03n38_109120_c1
680 nmdc:mga05p37_10559_c1
681 nmdc:mga05p37_50084_c1
682 nmdc:mga05p37_995049_c1
683 nmdc:mga06r32_259650_c1
684 nmdc:mga06r32_70183_c1
685 nmdc:mga08x19_227590_c1
686 Ga0495601_0084592
687 Ga0495612_0009289
688 Ga0495612_0021063
689 Ga0495595_0011997
690 Ga0495595_0084417
691 Ga0495619_0007063
692 Ga0495619_0138551
693 Ga0495619_0360628
694 Ga0500578_0059019
695 Ga0500643_000437
696 Ga0500627_0000044
697 Ga0500645_004498
698 2643820856
699 2643834731
700 2644055658
701 2816504954
702 2824672904
703 2824689452
704 2884701888
705 2895433305
706 2915359657

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01575

MaoC_dehydratas

MaoC like domain

191

309

0.96

PF22622

MFE-2_hydrat-2_N

MFE-2 hydratase 2 N-terminal domain

49

176

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
1s9c-assembly3.cif.gz_F crystal structure analysis of the 2-enoyl-coa hydratase 2 domain of human peroxisomal multifunctional enzyme type 2 0.9212 9 282
1s9c-assembly6.cif.gz_K crystal structure analysis of the 2-enoyl-coa hydratase 2 domain of human peroxisomal multifunctional enzyme type 2 0.9172 10 282
1s9c-assembly5.cif.gz_J crystal structure analysis of the 2-enoyl-coa hydratase 2 domain of human peroxisomal multifunctional enzyme type 2 0.9152 10 282
1s9c-assembly4.cif.gz_H crystal structure analysis of the 2-enoyl-coa hydratase 2 domain of human peroxisomal multifunctional enzyme type 2 0.9135 10 282
2cdh-assembly1.cif.gz_S architecture of the thermomyces lanuginosus fungal fatty acid synthase at 5 angstrom resolution. 0.9128 9 282
ID Description Score Start End Superfamily
3kh8B02 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9802 161 282 3.10.129.10
1s9cL02 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9726 160 282 3.10.129.10
af_Q54XZ0_160_288_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9671 161 284 3.10.129.10
1pn2D02 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9644 161 284 3.10.129.10
af_I1K7F5_17_306_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9426 11 284 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A1G4SS88-F1-model_v4 deleted 0.9942 1 284
AF-A0A1G4SS88-F1-model_v4 deleted 0.9907 1 284
AF-A0A0S7K0Z6-F1-model_v4 deleted 0.9893 168 282
AF-A0A4Q4CUA7-F1-model_v4 MaoC family dehydratase 0.9879 165 282 GO:0003857
GO:0004300
GO:0006635
GO:0044594
AF-A0A7S3J0K8-F1-model_v4 MaoC-like domain-containing protein 0.9855 161 283 GO:0003857
GO:0004300
GO:0005777
GO:0006635
GO:0044594

Map