F419390

General Info

Members Datasets Scaffolds Average Seq Length
353 214 350 196

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10539029|Ga0157372_105390291
Length 235
Sequence MLRWMEESGRITKKVVSFFYIKTFDGNVAKYLNFAALKKTIMEYDVEEINRLIRSRRSVFPKQYAEGQKVDDDIVTQILENATWAPNHGQTEPWKFVVFTGEGLQKLASFQAALYKKEAGDNFKEATYQNLLNNPLKASHVIALCLKRDPNKKFPEQEEIAAVSCAVQNMYLTTAAYGLGGYWTTGGVTYKSSAKEFFGLGEDDKLLGFFYLAHVAVPSPDSKRKPLEEKVEWVR

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
3 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
4 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
5 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
90 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
93 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
140 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
141 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
142 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
143 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
144 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
145 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
146 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
147 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
148 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
149 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
150 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
151 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
152 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
153 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
154 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
155 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
156 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
157 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
158 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
159 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
160 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
161 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
162 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
163 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
164 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
165 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
166 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
167 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
168 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
169 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
170 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
171 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
172 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
173 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
178 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
179 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
180 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
181 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
182 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
183 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
184 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
185 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
186 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
187 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
188 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
189 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
190 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
191 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
192 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
195 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
196 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
197 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
198 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
199 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
200 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
201 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
202 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
203 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
204 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
205 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
206 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
207 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
208 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
209 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
210 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
211 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
212 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
213 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
214 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.87
Metatranscriptomes 0
Isolates 1.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.93
Nodule 0
Rhizoplane 0
Rhizosphere 85.55
Stem 0
Stem Tuber 0
Unclassified 6.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_3727049 2162886012 Bacteria 1041
2 JGI24751J29686_10064292 3300002459 Unclassified 755
3 rootH2_10126694 3300003320 Unclassified 3741
4 rootL2_10032507 3300003322 Bacteria 9057
5 rootL2_10058048 3300003322 Bacteria 13406
6 rootL2_10189665 3300003322 Bacteria 2206
7 rootL2_10273598 3300003322 Unclassified 1530
8 rootL2_10311383 3300003322 Unclassified 2555
9 rootH1_10000619 3300003316 Bacteria 3651
10 rootH1_10000619 3300003323 Bacteria 100005
11 rootH1_10165137 3300003323 Bacteria 4339
12 rootH1_10186664 3300003323 Bacteria 2077
13 rootH1_10225322 3300003323 Bacteria 4419
14 Ga0065712_10086638 3300005290 Bacteria 2624
15 Ga0065715_10116062 3300005293 Bacteria 2389
16 Ga0070658_10460858 3300005327 Bacteria 1096
17 Ga0070683_100003276 3300005329 Bacteria 13091
18 Ga0070683_101349909 3300005329 Unclassified 685
19 Ga0070690_100047302 3300005330 Bacteria 2737
20 Ga0070670_100015216 3300005331 Bacteria 6603
21 Ga0070670_100200615 3300005331 Bacteria 1733
22 Ga0070670_100337171 3300005331 Bacteria 1323
23 Ga0070670_100944534 3300005331 Bacteria 783
24 Ga0068869_100027920 3300005334 Bacteria 3939
25 Ga0068869_100142898 3300005334 Bacteria 1849
26 Ga0070666_10000135 3300005335 Bacteria 51126
27 Ga0070666_10024633 3300005335 Bacteria 3921
28 Ga0070666_10581458 3300005335 Bacteria 816
29 Ga0068868_100019666 3300005338 Bacteria 5063
30 Ga0068868_100028082 3300005338 Bacteria 4298
31 Ga0070660_100891018 3300005339 Unclassified 750
32 Ga0070689_100105597 3300005340 Bacteria 2234
33 Ga0070661_100087368 3300005344 Bacteria 2306
34 Ga0070668_100033421 3300005347 Bacteria 3917
35 Ga0070668_100194747 3300005347 Bacteria 1661
36 Ga0070669_100002775 3300005353 Bacteria 12634
37 Ga0070675_100012892 3300005354 Bacteria 6561
38 Ga0070675_100275710 3300005354 Bacteria 1477
39 Ga0070674_100081047 3300005356 Bacteria 2319
40 Ga0070674_100910892 3300005356 Bacteria 766
41 Ga0070673_100040608 3300005364 Bacteria 3571
42 Ga0070673_100086175 3300005364 Bacteria 2559
43 Ga0070673_100087422 3300005364 Bacteria 2540
44 Ga0070688_100000319 3300005365 Bacteria 24587
45 Ga0070688_100185895 3300005365 Bacteria 1444
46 Ga0070667_100154498 3300005367 Bacteria 2017
47 Ga0070667_100355983 3300005367 Bacteria 1326
48 Ga0070701_10034456 3300005438 Bacteria 2536
49 Ga0070700_100094657 3300005441 Bacteria 1956
50 Ga0070678_100704426 3300005456 Bacteria 910
51 Ga0070662_100074338 3300005457 Bacteria 2514
52 Ga0068867_100058656 3300005459 Bacteria 2853
53 Ga0068867_100387503 3300005459 Bacteria 1175
54 Ga0070685_10067405 3300005466 Bacteria 2111
55 Ga0070684_100071976 3300005535 Bacteria 3043
56 Ga0068853_100038576 3300005539 Bacteria 4069
57 Ga0068853_100148416 3300005539 Unclassified 2109
58 Ga0068853_100171839 3300005539 Bacteria 1961
59 Ga0068853_100486668 3300005539 Bacteria 1164
60 Ga0068853_100594289 3300005539 Bacteria 1051
61 Ga0070672_100013172 3300005543 Bacteria 5832
62 Ga0070672_100143086 3300005543 Bacteria 1974
63 Ga0070672_100194000 3300005543 Bacteria 1697
64 Ga0070686_100991471 3300005544 Unclassified 688
65 Ga0070665_100000009 3300005548 Bacteria 562640
66 Ga0070665_100351152 3300005548 Bacteria 1480
67 Ga0070664_100003769 3300005564 Bacteria 12229
68 Ga0068857_100064851 3300005577 Bacteria 3248
69 Ga0068854_100142604 3300005578 Bacteria 1840
70 Ga0068856_100017340 3300005614 Bacteria 6983
71 Ga0068852_100017247 3300005616 Bacteria 5662
72 Ga0068852_100350876 3300005616 Bacteria 1441
73 Ga0068852_101264907 3300005616 Bacteria 759
74 Ga0068859_100000127 3300005617 Bacteria 72136
75 Ga0068859_100043407 3300005617 Bacteria 4518
76 Ga0068859_100300491 3300005617 Bacteria 1698
77 Ga0068859_100609314 3300005617 Unclassified 1185
78 Ga0068864_100049584 3300005618 Bacteria 3612
79 Ga0068864_100316036 3300005618 Unclassified 1466
80 Ga0068864_100346631 3300005618 Unclassified 1400
81 Ga0068861_100001554 3300005719 Bacteria 14585
82 Ga0068861_100109959 3300005719 Bacteria 2207
83 Ga0068861_100576175 3300005719 Bacteria 1029
84 Ga0068851_10007012 3300005834 Bacteria 5168
85 Ga0068870_10015688 3300005840 Unclassified 3602
86 Ga0068863_100000404 3300005841 Bacteria 43876
87 Ga0068863_100100827 3300005841 Bacteria 2744
88 Ga0068858_100014075 3300005842 Bacteria 7544
89 Ga0068860_100001035 3300005843 Bacteria 30588
90 Ga0068860_100003319 3300005843 Bacteria 16565
91 Ga0068860_100147592 3300005843 Bacteria 2263
92 Ga0068860_100455068 3300005843 Bacteria 1273
93 Ga0068862_100005213 3300005844 Bacteria 10920
94 Ga0068862_100704170 3300005844 Unclassified 979
95 Ga0070716_100588088 3300006173 Bacteria 835
96 Ga0097621_100002660 3300006237 Bacteria 12228
97 Ga0068871_100016043 3300006358 Bacteria 5629
98 Ga0068871_100113526 3300006358 Bacteria 2282
99 Ga0075428_100004911 3300006844 Bacteria 14853
100 Ga0075430_100072890 3300006846 Bacteria 2880
101 Ga0075431_100431417 3300006847 Bacteria 1316
102 Ga0075429_100385988 3300006880 Bacteria 1226
103 Ga0068865_100032816 3300006881 Bacteria 3472
104 Ga0068865_100083202 3300006881 Bacteria 2303
105 Ga0068865_100102010 3300006881 Bacteria 2102
106 Ga0068865_100482342 3300006881 Unclassified 1031
107 Ga0097620_100000127 3300006931 Bacteria 72136
108 Ga0097620_100043407 3300006931 Bacteria 4518
109 Ga0097620_100300486 3300006931 Bacteria 1698
110 Ga0097620_100609365 3300006931 Unclassified 1185
111 Ga0111539_10001883 3300009094 Bacteria 27869
112 Ga0111539_10014544 3300009094 Bacteria 9825
113 Ga0111539_10056686 3300009094 Bacteria 4655
114 Ga0105245_10423422 3300009098 Bacteria 1335
115 Ga0105243_10219958 3300009148 Bacteria 1678
116 Ga0105243_10979759 3300009148 Bacteria 847
117 Ga0105241_10012092 3300009174 Bacteria 6339
118 Ga0105242_10023999 3300009176 Bacteria 4813
119 Ga0105242_10311876 3300009176 Bacteria 1440
120 Ga0105248_11186953 3300009177 Unclassified 863
121 Ga0105237_10001607 3300009545 Bacteria 29352
122 Ga0105237_10654730 3300009545 Unclassified 1057
123 Ga0105238_11123074 3300009551 Unclassified 809
124 Ga0105249_10021998 3300009553 Bacteria 5710
125 Ga0105249_10032963 3300009553 Bacteria 4688
126 Ga0105249_10063180 3300009553 Bacteria 3401
127 Ga0105239_10905418 3300010375 Bacteria 1013
128 Ga0105246_10013038 3300011119 Bacteria 5201
129 Ga0105246_10086547 3300011119 Bacteria 2247
130 Ga0157373_10072250 3300013100 Bacteria 2435
131 Ga0157371_10007925 3300013102 Bacteria 8522
132 Ga0157371_10022290 3300013102 Bacteria 4644
133 Ga0157371_10139137 3300013102 Unclassified 1729
134 Ga0157370_10377040 3300013104 Bacteria 1307
135 Ga0157370_10487987 3300013104 Unclassified 1132
136 Ga0157374_10102818 3300013296 Bacteria 2741
137 Ga0157374_10261134 3300013296 Bacteria 1706
138 Ga0157374_10671081 3300013296 Bacteria 1049
139 Ga0157378_10007196 3300013297 Bacteria 9719
140 Ga0157378_10232897 3300013297 Bacteria 1756
141 Ga0157378_10836674 3300013297 Bacteria 948
142 Ga0163162_10000624 3300013306 Bacteria 32874
143 Ga0163162_10014268 3300013306 Bacteria 7761
144 Ga0163162_10159217 3300013306 Bacteria 2379
145 Ga0163162_10172275 3300013306 Bacteria 2289
146 Ga0157372_10149245 3300013307 Bacteria 2697
147 Ga0157372_10228360 3300013307 Bacteria 2157
148 Ga0157372_10400491 3300013307 Bacteria 1599
149 Ga0157372_10539029 3300013307 Bacteria 1360
150 Ga0157372_10615542 3300013307 Unclassified 1266
151 Ga0157372_11161611 3300013307 Unclassified 893
152 Ga0157372_11359504 3300013307 Bacteria 819
153 Ga0157372_11399182 3300013307 Bacteria 806
154 Ga0157375_10007513 3300013308 Bacteria 9530
155 Ga0157375_10020569 3300013308 Bacteria 6032
156 Ga0163163_10006242 3300014325 Bacteria 10400
157 Ga0163163_10766083 3300014325 Bacteria 1028
158 Ga0163163_11208325 3300014325 Bacteria 818
159 Ga0157380_10000943 3300014326 Bacteria 18406
160 Ga0157380_10872875 3300014326 Bacteria 923
161 Ga0157380_11085908 3300014326 Unclassified 838
162 Ga0157380_11594234 3300014326 Bacteria 708
163 Ga0157377_10002674 3300014745 Bacteria 7916
164 Ga0157377_10077966 3300014745 Bacteria 1930
165 Ga0157377_10082564 3300014745 Bacteria 1881
166 Ga0157379_10803114 3300014968 Bacteria 888
167 Ga0157376_10001271 3300014969 Bacteria 16567
168 Ga0157376_10641372 3300014969 Bacteria 1061
169 Ga0182005_1000147 3300015265 Bacteria 49428
170 Ga0163161_10394990 3300017792 Bacteria 1108
171 Ga0209436_104809 3300025208 Bacteria 3249
172 Ga0209258_100041 3300025242 Bacteria 381381
173 Ga0209148_1000090 3300025254 Bacteria 250982
174 Ga0207426_1004205 3300025302 Bacteria 7169
175 Ga0207656_10136593 3300025321 Unclassified 1153
176 Ga0207656_10462124 3300025321 Bacteria 642
177 Ga0207680_10000057 3300025903 Bacteria 50978
178 Ga0207647_10000636 3300025904 Bacteria 27349
179 Ga0207705_10129131 3300025909 Bacteria 1880
180 Ga0207654_10002312 3300025911 Bacteria 9784
181 Ga0207695_10067029 3300025913 Bacteria 3683
182 Ga0207671_10003914 3300025914 Bacteria 14516
183 Ga0207662_10043658 3300025918 Bacteria 2644
184 Ga0207657_10735223 3300025919 Bacteria 765
185 Ga0207649_10128309 3300025920 Bacteria 1719
186 Ga0207681_10013928 3300025923 Bacteria 4982
187 Ga0207650_10072729 3300025925 Bacteria 2588
188 Ga0207650_10177010 3300025925 Bacteria 1698
189 Ga0207650_10252049 3300025925 Bacteria 1429
190 Ga0207650_10272181 3300025925 Bacteria 1376
191 Ga0207659_10044954 3300025926 Bacteria 3110
192 Ga0207659_10221625 3300025926 Bacteria 1521
193 Ga0207687_10699505 3300025927 Unclassified 860
194 Ga0207690_10283311 3300025932 Bacteria 1291
195 Ga0207706_10005530 3300025933 Bacteria 11783
196 Ga0207709_10809758 3300025935 Bacteria 756
197 Ga0207670_10031189 3300025936 Bacteria 3412
198 Ga0207669_10134411 3300025937 Bacteria 1705
199 Ga0207704_10328545 3300025938 Bacteria 1182
200 Ga0207704_10551525 3300025938 Unclassified 937
201 Ga0207665_10636316 3300025939 Bacteria 835
202 Ga0207691_10069140 3300025940 Bacteria 3190
203 Ga0207691_10090624 3300025940 Bacteria 2741
204 Ga0207689_10000482 3300025942 Bacteria 37605
205 Ga0207689_10009105 3300025942 Bacteria 8593
206 Ga0207689_10017564 3300025942 Bacteria 6048
207 Ga0207689_10153855 3300025942 Bacteria 1896
208 Ga0207667_10380173 3300025949 Bacteria 1439
209 Ga0207651_10026840 3300025960 Bacteria 3606
210 Ga0207651_10196157 3300025960 Bacteria 1614
211 Ga0207712_10017409 3300025961 Bacteria 4666
212 Ga0207712_10056898 3300025961 Bacteria 2756
213 Ga0207712_10246919 3300025961 Unclassified 1441
214 Ga0207668_10015331 3300025972 Bacteria 4760
215 Ga0207668_10138822 3300025972 Bacteria 1866
216 Ga0207640_10916969 3300025981 Bacteria 766
217 Ga0207658_10685903 3300025986 Bacteria 925
218 Ga0207677_10040017 3300026023 Bacteria 3087
219 Ga0207677_10065801 3300026023 Bacteria 2531
220 Ga0207677_10113564 3300026023 Bacteria 2022
221 Ga0207703_10000924 3300026035 Bacteria 28603
222 Ga0207703_10177738 3300026035 Bacteria 1876
223 Ga0207639_10028406 3300026041 Bacteria 4083
224 Ga0207639_10585320 3300026041 Unclassified 1028
225 Ga0207639_10591185 3300026041 Bacteria 1023
226 Ga0207708_10219068 3300026075 Bacteria 1524
227 Ga0207702_10074451 3300026078 Bacteria 2931
228 Ga0207641_10000229 3300026088 Bacteria 72315
229 Ga0207641_10098579 3300026088 Bacteria 2570
230 Ga0207648_10064327 3300026089 Bacteria 3197
231 Ga0207648_10069372 3300026089 Bacteria 3071
232 Ga0207676_10125817 3300026095 Unclassified 2170
233 Ga0207676_10331092 3300026095 Unclassified 1401
234 Ga0207674_10026726 3300026116 Bacteria 6122
235 Ga0207675_100004042 3300026118 Bacteria 14209
236 Ga0207675_100018483 3300026118 Bacteria 6501
237 Ga0207675_100467371 3300026118 Bacteria 1252
238 Ga0207683_10032265 3300026121 Bacteria 4550
239 Ga0207683_10475655 3300026121 Bacteria 1153
240 Ga0207698_10024974 3300026142 Bacteria 4201
241 Ga0207698_10092501 3300026142 Unclassified 2479
242 Ga0207698_10270006 3300026142 Bacteria 1567
243 Ga0207698_10421239 3300026142 Bacteria 1281
244 Ga0209995_1043400 3300027471 Unclassified 760
245 Ga0207428_10060089 3300027907 Bacteria 3011
246 Ga0207428_10075114 3300027907 Bacteria 2649
247 Ga0207428_10612049 3300027907 Unclassified 784
248 Ga0268266_10000014 3300028379 Bacteria 644033
249 Ga0268265_10014771 3300028380 Unclassified 5328
250 Ga0268265_10233284 3300028380 Bacteria 1619
251 Ga0268265_10280691 3300028380 Bacteria 1490
252 Ga0268264_10008850 3300028381 Bacteria 8345
253 Ga0268264_10028403 3300028381 Unclassified 4576
254 Ga0268264_10345710 3300028381 Bacteria 1414
255 Ga0268264_11545795 3300028381 Unclassified 674
256 Ga0307517_10128393 3300028786 Bacteria 1838
257 Ga0307515_10004330 3300028794 Bacteria 29440
258 Ga0307515_10582390 3300028794 Bacteria 729
259 Ga0307511_10001217 3300030521 Bacteria 27290
260 Ga0307513_10110382 3300031456 Bacteria 2746
261 Ga0307513_10130660 3300031456 Bacteria 2458
262 Ga0307509_10065330 3300031507 Bacteria 3822
263 Ga0307408_100015641 3300031548 Bacteria 5055
264 Ga0307413_10098413 3300031824 Bacteria 1926
265 Ga0307409_100706563 3300031995 Bacteria 1008
266 Ga0307414_10219087 3300032004 Unclassified 1561
267 Ga0307414_11026631 3300032004 Bacteria 760
268 Ga0307411_10354167 3300032005 Bacteria 1198
269 Ga0307415_100306915 3300032126 Unclassified 1317
270 Ga0307507_10069910 3300033179 Bacteria 3190
271 Ga0395898_0743440 3300037466 Unclassified 922
272 Ga0395905_0022800 3300037471 Bacteria 5919
273 Ga0395905_0250282 3300037471 Unclassified 1655
274 Ga0395901_0385116 3300038443 Bacteria 1443
275 Ga0439439_0056260 3300041406 Bacteria 1039
276 Ga0439453_0030736 3300041408 Bacteria 1017
277 Ga0439449_0252399 3300042007 Unclassified 663
278 Ga0439457_051837 3300042014 Bacteria 922
279 Ga0453683_0335184 3300044673 Bacteria 970
280 Ga0466964_0640952 3300044706 Unclassified 587
281 Ga0453684_0237688 3300044712 Bacteria 2099
282 Ga0466959_0643407 3300045049 Unclassified 712
283 Ga0495638_0051360 3300046460 Bacteria 2571
284 Ga0495650_0015592 3300046471 Bacteria 3891
285 Ga0495648_0008289 3300046524 Bacteria 8198
286 Ga0495611_0008961 3300046648 Bacteria 4232
287 Ga0495625_0347135 3300046660 Unclassified 939
288 Ga0495661_0192783 3300046665 Bacteria 1072
289 Ga0495672_0026409 3300047320 Bacteria 3705
290 Ga0495672_0116949 3300047320 Bacteria 1423
291 Ga0495686_0129559 3300047472 Bacteria 1497
292 Ga0495686_0164693 3300047472 Bacteria 1293
293 Ga0495686_0231343 3300047472 Bacteria 1047
294 Ga0496121_0000030 3300048924 Bacteria 412079
295 Ga0496123_0225904 3300048926 Bacteria 941
296 Ga0501298_022020 3300049521 Bacteria 1198
297 Ga0501034_0390027 3300049571 Bacteria 1316
298 Ga0501037_0095737 3300049573 Unclassified 2146
299 Ga0501043_0430124 3300049579 Bacteria 994
300 Ga0501047_0321436 3300049581 Bacteria 1387
301 Ga0501198_024813 3300049649 Bacteria 972
302 Ga0501207_054281 3300049654 Bacteria 722
303 Ga0501217_001144 3300049661 Unclassified 4862
304 Ga0501222_009271 3300049662 Bacteria 1302
305 Ga0501235_052248 3300049669 Bacteria 948
306 Ga0501236_000062 3300049670 Bacteria 9699
307 Ga0501242_000881 3300049674 Bacteria 2849
308 Ga0501243_016960 3300049675 Bacteria 1179
309 Ga0501243_018570 3300049675 Bacteria 1134
310 Ga0501247_000279 3300049677 Unclassified 3666
311 Ga0501250_011187 3300049680 Bacteria 1042
312 Ga0501257_001225 3300049686 Bacteria 5264
313 Ga0501259_003966 3300049688 Bacteria 2351
314 Ga0501219_000201 3300049703 Bacteria 11144
315 Ga0501264_000602 3300049761 Bacteria 5102
316 Ga0501266_031316 3300049763 Unclassified 761
317 Ga0501035_0462581 3300049822 Bacteria 1048
318 Ga0501044_0279264 3300049823 Bacteria 1604
319 Ga0501226_014047 3300049853 Bacteria 884
320 Ga0501284_00038 3300050005 Bacteria 54754
321 nmdc:mga0k408_232658_c1 3300050493 Bacteria 1100
322 nmdc:mga09592_189645_c1 3300050508 Bacteria 1779
323 nmdc:mga09592_497089_c1 3300050508 Bacteria 1050
324 nmdc:mga06r32_421130_c1 3300050510 Bacteria 1316
325 nmdc:mga08y16_106273_c1 3300050511 Bacteria 2922
326 nmdc:mga08y16_83572_c1 3300050511 Bacteria 3328
327 nmdc:mga08y16_90878_c1 3300050511 Unclassified 3182
328 Ga0500644_0000062 3300053088 Bacteria 63042
329 Ga0500646_0026330 3300053090 Bacteria 1576
330 Ga0500646_0031117 3300053090 Bacteria 1468
331 Ga0500583_0006778 3300053092 Bacteria 3973
332 Ga0500583_0007235 3300053092 Bacteria 3890
333 Ga0500583_0408763 3300053092 Unclassified 650
334 Ga0500569_001089 3300053109 Bacteria 4965
335 Ga0500593_193457 3300053117 Unclassified 742
336 Ga0500607_011721 3300053121 Bacteria 5177
337 Ga0500559_0021905 3300053136 Bacteria 2711
338 Ga0500559_0044547 3300053136 Bacteria 1941
339 Ga0500568_0000473 3300053139 Bacteria 29794
340 Ga0500577_0003784 3300053142 Bacteria 3951
341 Ga0500588_0143371 3300053146 Unclassified 859
342 Ga0500604_0000714 3300053151 Bacteria 9102
343 Ga0500604_0001705 3300053151 Bacteria 6164
344 Ga0500616_0018082 3300053153 Bacteria 3989
345 Ga0500622_0000075 3300053156 Bacteria 109513
346 Ga0500622_0000086 3300053156 Bacteria 99366
347 Ga0500622_0000120 3300053156 Bacteria 81979
348 Ga0500622_0002000 3300053156 Bacteria 15249
349 Ga0500627_0216628 3300053158 Unclassified 855
350 Ga0500636_0023826 3300053177 Bacteria 3619

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049686 Ga0501257_001225 Ga0501257_001225_1346_1828 158
2 3300044706 Ga0466964_0640952 Ga0466964_0640952_45_566 171
3 3300003322 rootL2_10032507 rootL2_100325078 185
4 3300013102 Ga0157371_10139137 Ga0157371_101391372 185
5 3300013104 Ga0157370_10377040 Ga0157370_103770402 185
6 3300042007 Ga0439449_0252399 Ga0439449_0252399_37_609 185
7 3300042014 Ga0439457_051837 Ga0439457_051837_236_808 185
8 3300048926 Ga0496123_0225904 Ga0496123_0225904_300_872 185
9 iso_pu_bacteria 2883068021 2883073027 185
10 3300046665 Ga0495661_0192783 Ga0495661_0192783_286_861 186
11 iso_pu_bacteria 2818991442 2819573316 187
12 iso_pu_bacteria 2821136567 2821136730 187
13 iso_pu_bacteria 2904467357 2904468525 187
14 3300026121 Ga0207683_10475655 Ga0207683_104756552 188
15 3300049571 Ga0501034_0390027 Ga0501034_0390027_222_794 188
16 3300005843 Ga0068860_100003319 Ga0068860_10000331912 191
17 3300013296 Ga0157374_10671081 Ga0157374_106710812 191
18 3300013306 Ga0163162_10159217 Ga0163162_101592172 191
19 3300015265 Ga0182005_1000147 Ga0182005_100014752 191
20 3300025208 Ga0209436_104809 Ga0209436_1048093 191
21 3300025242 Ga0209258_100041 Ga0209258_100041153 191
22 3300025254 Ga0209148_1000090 Ga0209148_100009083 191
23 3300025302 Ga0207426_1004205 Ga0207426_10042055 191
24 3300028381 Ga0268264_10008850 Ga0268264_100088506 191
25 3300031507 Ga0307509_10065330 Ga0307509_100653305 191
26 3300048924 Ga0496121_0000030 Ga0496121_0000030_230215_230796 191
27 3300049573 Ga0501037_0095737 Ga0501037_0095737_476_1060 191
28 3300049581 Ga0501047_0321436 Ga0501047_0321436_692_1276 191
29 3300049822 Ga0501035_0462581 Ga0501035_0462581_175_759 191
30 3300049823 Ga0501044_0279264 Ga0501044_0279264_263_847 191
31 3300053088 Ga0500644_0000062 Ga0500644_0000062_12135_12716 191
32 3300053090 Ga0500646_0031117 Ga0500646_0031117_576_1157 191
33 3300053092 Ga0500583_0007235 Ga0500583_0007235_1365_1946 191
34 3300053109 Ga0500569_001089 Ga0500569_001089_4368_4949 191
35 3300053121 Ga0500607_011721 Ga0500607_011721_1390_1971 191
36 3300053136 Ga0500559_0021905 Ga0500559_0021905_274_870 191
37 3300053136 Ga0500559_0044547 Ga0500559_0044547_190_771 191
38 3300053142 Ga0500577_0003784 Ga0500577_0003784_2494_3075 191
39 3300053151 Ga0500604_0000714 Ga0500604_0000714_8163_8762 191
40 3300053156 Ga0500622_0000120 Ga0500622_0000120_78015_78596 191
41 3300053177 Ga0500636_0023826 Ga0500636_0023826_1826_2407 191
42 3300003322 rootL2_10058048 rootL2_1005804811 192
43 3300003322 rootL2_10273598 rootL2_102735981 192
44 3300003322 rootL2_10311383 rootL2_103113831 192
45 3300003323 rootH1_10000619 rootH1_1000061977 192
46 3300003323 rootH1_10165137 rootH1_101651372 192
47 3300003323 rootH1_10186664 rootH1_101866642 192
48 3300003323 rootH1_10225322 rootH1_102253223 192
49 3300005539 Ga0068853_100148416 Ga0068853_1001484162 192
50 3300005544 Ga0070686_100991471 Ga0070686_1009914711 192
51 3300005614 Ga0068856_100017340 Ga0068856_1000173405 192
52 3300005618 Ga0068864_100346631 Ga0068864_1003466312 192
53 3300006844 Ga0075428_100004911 Ga0075428_1000049119 192
54 3300006846 Ga0075430_100072890 Ga0075430_1000728901 192
55 3300006847 Ga0075431_100431417 Ga0075431_1004314172 192
56 3300009094 Ga0111539_10001883 Ga0111539_1000188326 192
57 3300010375 Ga0105239_10905418 Ga0105239_109054181 192
58 3300013307 Ga0157372_10615542 Ga0157372_106155422 192
59 3300014325 Ga0163163_11208325 Ga0163163_112083251 192
60 3300014326 Ga0157380_10000943 Ga0157380_1000094320 192
61 3300017792 Ga0163161_10394990 Ga0163161_103949902 192
62 3300026041 Ga0207639_10585320 Ga0207639_105853202 192
63 3300026078 Ga0207702_10074451 Ga0207702_100744513 192
64 3300026095 Ga0207676_10331092 Ga0207676_103310922 192
65 3300027907 Ga0207428_10612049 Ga0207428_106120491 192
66 3300031456 Ga0307513_10130660 Ga0307513_101306602 192
67 3300031548 Ga0307408_100015641 Ga0307408_1000156413 192
68 3300047472 Ga0495686_0129559 Ga0495686_0129559_489_1067 192
69 3300047472 Ga0495686_0231343 Ga0495686_0231343_198_785 192
70 3300049661 Ga0501217_001144 Ga0501217_001144_220_816 192
71 3300049662 Ga0501222_009271 Ga0501222_009271_78_674 192
72 3300049669 Ga0501235_052248 Ga0501235_052248_186_782 192
73 3300049670 Ga0501236_000062 Ga0501236_000062_3003_3599 192
74 3300049677 Ga0501247_000279 Ga0501247_000279_188_784 192
75 3300049703 Ga0501219_000201 Ga0501219_000201_10374_10973 192
76 3300049761 Ga0501264_000602 Ga0501264_000602_28_624 192
77 3300049853 Ga0501226_014047 Ga0501226_014047_81_677 192
78 3300050005 Ga0501284_00038 Ga0501284_00038_6056_6655 192
79 3300050508 nmdc:mga09592_497089_c1 nmdc:mga09592_497089_c1_90_677 192
80 3300050510 nmdc:mga06r32_421130_c1 nmdc:mga06r32_421130_c1_235_822 192
81 3300050511 nmdc:mga08y16_90878_c1 nmdc:mga08y16_90878_c1_1083_1670 192
82 3300053090 Ga0500646_0026330 Ga0500646_0026330_613_1353 192
83 3300053153 Ga0500616_0018082 Ga0500616_0018082_2100_2681 192
84 3300003320 rootH2_10126694 rootH2_101266943 193
85 3300003322 rootL2_10189665 rootL2_101896652 193
86 3300005327 Ga0070658_10460858 Ga0070658_104608582 193
87 3300005330 Ga0070690_100047302 Ga0070690_1000473023 193
88 3300005347 Ga0070668_100033421 Ga0070668_1000334214 193
89 3300005356 Ga0070674_100081047 Ga0070674_1000810472 193
90 3300005539 Ga0068853_100038576 Ga0068853_1000385763 193
91 3300005719 Ga0068861_100109959 Ga0068861_1001099592 193
92 3300009094 Ga0111539_10014544 Ga0111539_100145448 193
93 3300013307 Ga0157372_10539029 Ga0157372_105390291 193
94 3300013307 Ga0157372_11161611 Ga0157372_111616112 193
95 3300014326 Ga0157380_10872875 Ga0157380_108728751 193
96 3300014326 Ga0157380_11594234 Ga0157380_115942341 193
97 3300025321 Ga0207656_10462124 Ga0207656_104621241 193
98 3300025909 Ga0207705_10129131 Ga0207705_101291312 193
99 3300026041 Ga0207639_10028406 Ga0207639_100284063 193
100 3300026118 Ga0207675_100018483 Ga0207675_1000184832 193
101 3300027907 Ga0207428_10075114 Ga0207428_100751142 193
102 3300028380 Ga0268265_10280691 Ga0268265_102806912 193
103 3300028794 Ga0307515_10582390 Ga0307515_105823901 193
104 3300031456 Ga0307513_10110382 Ga0307513_101103822 193
105 3300032004 Ga0307414_10219087 Ga0307414_102190871 193
106 3300032005 Ga0307411_10354167 Ga0307411_103541672 193
107 3300041408 Ga0439453_0030736 Ga0439453_0030736_277_858 193
108 3300045049 Ga0466959_0643407 Ga0466959_0643407_30_614 193
109 3300046471 Ga0495650_0015592 Ga0495650_0015592_709_1293 193
110 3300047320 Ga0495672_0116949 Ga0495672_0116949_554_1135 193
111 3300049675 Ga0501243_018570 Ga0501243_018570_203_826 193
112 3300050511 nmdc:mga08y16_83572_c1 nmdc:mga08y16_83572_c1_1744_2367 193
113 3300053092 Ga0500583_0408763 Ga0500583_0408763_14_610 193
114 3300053117 Ga0500593_193457 Ga0500593_193457_57_650 193
115 3300053139 Ga0500568_0000473 Ga0500568_0000473_15614_16195 193
116 3300053151 Ga0500604_0001705 Ga0500604_0001705_49_642 193
117 3300053156 Ga0500622_0000075 Ga0500622_0000075_54427_55020 193
118 3300053156 Ga0500622_0000086 Ga0500622_0000086_15231_15824 193
119 3300053158 Ga0500627_0216628 Ga0500627_0216628_32_625 193
120 2162886012 MBSR1b_contig_3727049 MBSR1b_0960.00002640 194
121 3300002459 JGI24751J29686_10064292 JGI24751J29686_100642921 194
122 3300005290 Ga0065712_10086638 Ga0065712_100866382 194
123 3300005293 Ga0065715_10116062 Ga0065715_101160622 194
124 3300005329 Ga0070683_100003276 Ga0070683_1000032762 194
125 3300005329 Ga0070683_101349909 Ga0070683_1013499091 194
126 3300005331 Ga0070670_100015216 Ga0070670_1000152163 194
127 3300005331 Ga0070670_100200615 Ga0070670_1002006152 194
128 3300005331 Ga0070670_100337171 Ga0070670_1003371712 194
129 3300005331 Ga0070670_100944534 Ga0070670_1009445342 194
130 3300005334 Ga0068869_100027920 Ga0068869_1000279202 194
131 3300005334 Ga0068869_100142898 Ga0068869_1001428982 194
132 3300005335 Ga0070666_10000135 Ga0070666_1000013511 194
133 3300005335 Ga0070666_10024633 Ga0070666_100246334 194
134 3300005335 Ga0070666_10581458 Ga0070666_105814581 194
135 3300005338 Ga0068868_100019666 Ga0068868_1000196665 194
136 3300005338 Ga0068868_100028082 Ga0068868_1000280822 194
137 3300005339 Ga0070660_100891018 Ga0070660_1008910181 194
138 3300005340 Ga0070689_100105597 Ga0070689_1001055972 194
139 3300005344 Ga0070661_100087368 Ga0070661_1000873683 194
140 3300005347 Ga0070668_100194747 Ga0070668_1001947471 194
141 3300005353 Ga0070669_100002775 Ga0070669_10000277513 194
142 3300005354 Ga0070675_100012892 Ga0070675_1000128923 194
143 3300005354 Ga0070675_100275710 Ga0070675_1002757102 194
144 3300005356 Ga0070674_100910892 Ga0070674_1009108921 194
145 3300005364 Ga0070673_100040608 Ga0070673_1000406082 194
146 3300005364 Ga0070673_100086175 Ga0070673_1000861753 194
147 3300005364 Ga0070673_100087422 Ga0070673_1000874222 194
148 3300005365 Ga0070688_100000319 Ga0070688_10000031917 194
149 3300005365 Ga0070688_100185895 Ga0070688_1001858953 194
150 3300005367 Ga0070667_100154498 Ga0070667_1001544982 194
151 3300005367 Ga0070667_100355983 Ga0070667_1003559832 194
152 3300005438 Ga0070701_10034456 Ga0070701_100344562 194
153 3300005441 Ga0070700_100094657 Ga0070700_1000946573 194
154 3300005456 Ga0070678_100704426 Ga0070678_1007044261 194
155 3300005457 Ga0070662_100074338 Ga0070662_1000743383 194
156 3300005459 Ga0068867_100058656 Ga0068867_1000586563 194
157 3300005459 Ga0068867_100387503 Ga0068867_1003875032 194
158 3300005466 Ga0070685_10067405 Ga0070685_100674052 194
159 3300005535 Ga0070684_100071976 Ga0070684_1000719764 194
160 3300005539 Ga0068853_100171839 Ga0068853_1001718394 194
161 3300005539 Ga0068853_100486668 Ga0068853_1004866681 194
162 3300005539 Ga0068853_100594289 Ga0068853_1005942892 194
163 3300005543 Ga0070672_100013172 Ga0070672_1000131725 194
164 3300005543 Ga0070672_100143086 Ga0070672_1001430861 194
165 3300005543 Ga0070672_100194000 Ga0070672_1001940002 194
166 3300005548 Ga0070665_100000009 Ga0070665_100000009345 194
167 3300005548 Ga0070665_100351152 Ga0070665_1003511522 194
168 3300005564 Ga0070664_100003769 Ga0070664_1000037693 194
169 3300005577 Ga0068857_100064851 Ga0068857_1000648513 194
170 3300005578 Ga0068854_100142604 Ga0068854_1001426043 194
171 3300005616 Ga0068852_100017247 Ga0068852_1000172473 194
172 3300005616 Ga0068852_100350876 Ga0068852_1003508763 194
173 3300005616 Ga0068852_101264907 Ga0068852_1012649071 194
174 3300005617 Ga0068859_100000127 Ga0068859_10000012742 194
175 3300005617 Ga0068859_100043407 Ga0068859_1000434072 194
176 3300005617 Ga0068859_100300491 Ga0068859_1003004913 194
177 3300005617 Ga0068859_100609314 Ga0068859_1006093141 194
178 3300005618 Ga0068864_100049584 Ga0068864_1000495844 194
179 3300005618 Ga0068864_100316036 Ga0068864_1003160363 194
180 3300005719 Ga0068861_100001554 Ga0068861_10000155414 194
181 3300005719 Ga0068861_100576175 Ga0068861_1005761752 194
182 3300005834 Ga0068851_10007012 Ga0068851_100070122 194
183 3300005840 Ga0068870_10015688 Ga0068870_100156884 194
184 3300005841 Ga0068863_100000404 Ga0068863_10000040442 194
185 3300005841 Ga0068863_100100827 Ga0068863_1001008273 194
186 3300005842 Ga0068858_100014075 Ga0068858_1000140755 194
187 3300005843 Ga0068860_100001035 Ga0068860_10000103530 194
188 3300005843 Ga0068860_100147592 Ga0068860_1001475922 194
189 3300005843 Ga0068860_100455068 Ga0068860_1004550681 194
190 3300005844 Ga0068862_100005213 Ga0068862_1000052133 194
191 3300005844 Ga0068862_100704170 Ga0068862_1007041702 194
192 3300006173 Ga0070716_100588088 Ga0070716_1005880882 194
193 3300006237 Ga0097621_100002660 Ga0097621_1000026605 194
194 3300006358 Ga0068871_100016043 Ga0068871_1000160433 194
195 3300006358 Ga0068871_100113526 Ga0068871_1001135263 194
196 3300006880 Ga0075429_100385988 Ga0075429_1003859881 194
197 3300006881 Ga0068865_100032816 Ga0068865_1000328161 194
198 3300006881 Ga0068865_100083202 Ga0068865_1000832023 194
199 3300006881 Ga0068865_100102010 Ga0068865_1001020101 194
200 3300006881 Ga0068865_100482342 Ga0068865_1004823421 194
201 3300006931 Ga0097620_100000127 Ga0097620_10000012729 194
202 3300006931 Ga0097620_100043407 Ga0097620_1000434072 194
203 3300006931 Ga0097620_100300486 Ga0097620_1003004862 194
204 3300006931 Ga0097620_100609365 Ga0097620_1006093651 194
205 3300009094 Ga0111539_10056686 Ga0111539_100566862 194
206 3300009098 Ga0105245_10423422 Ga0105245_104234222 194
207 3300009148 Ga0105243_10219958 Ga0105243_102199581 194
208 3300009148 Ga0105243_10979759 Ga0105243_109797591 194
209 3300009174 Ga0105241_10012092 Ga0105241_100120924 194
210 3300009176 Ga0105242_10023999 Ga0105242_100239993 194
211 3300009176 Ga0105242_10311876 Ga0105242_103118762 194
212 3300009177 Ga0105248_11186953 Ga0105248_111869532 194
213 3300009545 Ga0105237_10001607 Ga0105237_100016075 194
214 3300009545 Ga0105237_10654730 Ga0105237_106547302 194
215 3300009551 Ga0105238_11123074 Ga0105238_111230742 194
216 3300009553 Ga0105249_10021998 Ga0105249_100219983 194
217 3300009553 Ga0105249_10032963 Ga0105249_100329635 194
218 3300009553 Ga0105249_10063180 Ga0105249_100631804 194
219 3300011119 Ga0105246_10013038 Ga0105246_100130382 194
220 3300011119 Ga0105246_10086547 Ga0105246_100865473 194
221 3300013100 Ga0157373_10072250 Ga0157373_100722502 194
222 3300013102 Ga0157371_10007925 Ga0157371_100079257 194
223 3300013102 Ga0157371_10022290 Ga0157371_100222902 194
224 3300013104 Ga0157370_10487987 Ga0157370_104879872 194
225 3300013296 Ga0157374_10102818 Ga0157374_101028183 194
226 3300013296 Ga0157374_10261134 Ga0157374_102611343 194
227 3300013297 Ga0157378_10007196 Ga0157378_100071966 194
228 3300013297 Ga0157378_10232897 Ga0157378_102328973 194
229 3300013297 Ga0157378_10836674 Ga0157378_108366741 194
230 3300013306 Ga0163162_10000624 Ga0163162_1000062418 194
231 3300013306 Ga0163162_10014268 Ga0163162_100142685 194
232 3300013306 Ga0163162_10172275 Ga0163162_101722752 194
233 3300013307 Ga0157372_10149245 Ga0157372_101492453 194
234 3300013307 Ga0157372_10228360 Ga0157372_102283602 194
235 3300013307 Ga0157372_10400491 Ga0157372_104004912 194
236 3300013307 Ga0157372_11359504 Ga0157372_113595041 194
237 3300013307 Ga0157372_11399182 Ga0157372_113991822 194
238 3300013308 Ga0157375_10007513 Ga0157375_100075133 194
239 3300013308 Ga0157375_10020569 Ga0157375_100205694 194
240 3300014325 Ga0163163_10006242 Ga0163163_100062429 194
241 3300014325 Ga0163163_10766083 Ga0163163_107660832 194
242 3300014326 Ga0157380_11085908 Ga0157380_110859081 194
243 3300014745 Ga0157377_10002674 Ga0157377_100026745 194
244 3300014745 Ga0157377_10077966 Ga0157377_100779662 194
245 3300014745 Ga0157377_10082564 Ga0157377_100825642 194
246 3300014968 Ga0157379_10803114 Ga0157379_108031141 194
247 3300014969 Ga0157376_10001271 Ga0157376_1000127110 194
248 3300014969 Ga0157376_10641372 Ga0157376_106413722 194
249 3300025321 Ga0207656_10136593 Ga0207656_101365931 194
250 3300025903 Ga0207680_10000057 Ga0207680_100000579 194
251 3300025904 Ga0207647_10000636 Ga0207647_1000063625 194
252 3300025911 Ga0207654_10002312 Ga0207654_100023123 194
253 3300025913 Ga0207695_10067029 Ga0207695_100670294 194
254 3300025914 Ga0207671_10003914 Ga0207671_100039145 194
255 3300025918 Ga0207662_10043658 Ga0207662_100436581 194
256 3300025919 Ga0207657_10735223 Ga0207657_107352231 194
257 3300025920 Ga0207649_10128309 Ga0207649_101283092 194
258 3300025923 Ga0207681_10013928 Ga0207681_100139283 194
259 3300025925 Ga0207650_10072729 Ga0207650_100727293 194
260 3300025925 Ga0207650_10177010 Ga0207650_101770102 194
261 3300025925 Ga0207650_10252049 Ga0207650_102520493 194
262 3300025925 Ga0207650_10272181 Ga0207650_102721811 194
263 3300025926 Ga0207659_10044954 Ga0207659_100449542 194
264 3300025926 Ga0207659_10221625 Ga0207659_102216251 194
265 3300025927 Ga0207687_10699505 Ga0207687_106995051 194
266 3300025932 Ga0207690_10283311 Ga0207690_102833112 194
267 3300025933 Ga0207706_10005530 Ga0207706_100055309 194
268 3300025935 Ga0207709_10809758 Ga0207709_108097581 194
269 3300025936 Ga0207670_10031189 Ga0207670_100311891 194
270 3300025937 Ga0207669_10134411 Ga0207669_101344111 194
271 3300025938 Ga0207704_10328545 Ga0207704_103285451 194
272 3300025938 Ga0207704_10551525 Ga0207704_105515252 194
273 3300025939 Ga0207665_10636316 Ga0207665_106363161 194
274 3300025940 Ga0207691_10069140 Ga0207691_100691403 194
275 3300025940 Ga0207691_10090624 Ga0207691_100906243 194
276 3300025942 Ga0207689_10000482 Ga0207689_100004828 194
277 3300025942 Ga0207689_10009105 Ga0207689_100091055 194
278 3300025942 Ga0207689_10017564 Ga0207689_100175643 194
279 3300025942 Ga0207689_10153855 Ga0207689_101538552 194
280 3300025949 Ga0207667_10380173 Ga0207667_103801732 194
281 3300025960 Ga0207651_10026840 Ga0207651_100268402 194
282 3300025960 Ga0207651_10196157 Ga0207651_101961571 194
283 3300025961 Ga0207712_10017409 Ga0207712_100174093 194
284 3300025961 Ga0207712_10056898 Ga0207712_100568982 194
285 3300025961 Ga0207712_10246919 Ga0207712_102469191 194
286 3300025972 Ga0207668_10015331 Ga0207668_100153314 194
287 3300025972 Ga0207668_10138822 Ga0207668_101388222 194
288 3300025981 Ga0207640_10916969 Ga0207640_109169691 194
289 3300025986 Ga0207658_10685903 Ga0207658_106859031 194
290 3300026023 Ga0207677_10040017 Ga0207677_100400173 194
291 3300026023 Ga0207677_10065801 Ga0207677_100658012 194
292 3300026023 Ga0207677_10113564 Ga0207677_101135642 194
293 3300026035 Ga0207703_10000924 Ga0207703_1000092411 194
294 3300026035 Ga0207703_10177738 Ga0207703_101777383 194
295 3300026041 Ga0207639_10591185 Ga0207639_105911852 194
296 3300026075 Ga0207708_10219068 Ga0207708_102190682 194
297 3300026088 Ga0207641_10000229 Ga0207641_1000022942 194
298 3300026088 Ga0207641_10098579 Ga0207641_100985795 194
299 3300026089 Ga0207648_10064327 Ga0207648_100643273 194
300 3300026089 Ga0207648_10069372 Ga0207648_100693722 194
301 3300026095 Ga0207676_10125817 Ga0207676_101258171 194
302 3300026116 Ga0207674_10026726 Ga0207674_100267263 194
303 3300026118 Ga0207675_100004042 Ga0207675_1000040424 194
304 3300026118 Ga0207675_100467371 Ga0207675_1004673712 194
305 3300026121 Ga0207683_10032265 Ga0207683_100322655 194
306 3300026142 Ga0207698_10024974 Ga0207698_100249745 194
307 3300026142 Ga0207698_10092501 Ga0207698_100925012 194
308 3300026142 Ga0207698_10270006 Ga0207698_102700063 194
309 3300026142 Ga0207698_10421239 Ga0207698_104212392 194
310 3300027471 Ga0209995_1043400 Ga0209995_10434001 194
311 3300027907 Ga0207428_10060089 Ga0207428_100600893 194
312 3300028379 Ga0268266_10000014 Ga0268266_10000014327 194
313 3300028380 Ga0268265_10014771 Ga0268265_100147711 194
314 3300028380 Ga0268265_10233284 Ga0268265_102332842 194
315 3300028381 Ga0268264_10028403 Ga0268264_100284032 194
316 3300028381 Ga0268264_10345710 Ga0268264_103457102 194
317 3300028381 Ga0268264_11545795 Ga0268264_115457951 194
318 3300028786 Ga0307517_10128393 Ga0307517_101283932 194
319 3300028794 Ga0307515_10004330 Ga0307515_1000433023 194
320 3300030521 Ga0307511_10001217 Ga0307511_1000121715 194
321 3300031824 Ga0307413_10098413 Ga0307413_100984132 194
322 3300031995 Ga0307409_100706563 Ga0307409_1007065631 194
323 3300032004 Ga0307414_11026631 Ga0307414_110266311 194
324 3300032126 Ga0307415_100306915 Ga0307415_1003069151 194
325 3300033179 Ga0307507_10069910 Ga0307507_100699104 194
326 3300037466 Ga0395898_0743440 Ga0395898_0743440_221_817 194
327 3300037471 Ga0395905_0022800 Ga0395905_0022800_2448_3035 194
328 3300037471 Ga0395905_0250282 Ga0395905_0250282_413_1000 194
329 3300038443 Ga0395901_0385116 Ga0395901_0385116_71_658 194
330 3300041406 Ga0439439_0056260 Ga0439439_0056260_316_903 194
331 3300044673 Ga0453683_0335184 Ga0453683_0335184_40_627 194
332 3300044712 Ga0453684_0237688 Ga0453684_0237688_213_800 194
333 3300046460 Ga0495638_0051360 Ga0495638_0051360_1272_1877 194
334 3300046524 Ga0495648_0008289 Ga0495648_0008289_4653_5258 194
335 3300046648 Ga0495611_0008961 Ga0495611_0008961_2407_3012 194
336 3300046660 Ga0495625_0347135 Ga0495625_0347135_11_595 194
337 3300047320 Ga0495672_0026409 Ga0495672_0026409_2416_3000 194
338 3300047472 Ga0495686_0164693 Ga0495686_0164693_103_687 194
339 3300049521 Ga0501298_022020 Ga0501298_022020_434_1021 194
340 3300049579 Ga0501043_0430124 Ga0501043_0430124_80_667 194
341 3300049649 Ga0501198_024813 Ga0501198_024813_365_952 194
342 3300049654 Ga0501207_054281 Ga0501207_054281_52_639 194
343 3300049674 Ga0501242_000881 Ga0501242_000881_35_622 194
344 3300049675 Ga0501243_016960 Ga0501243_016960_366_953 194
345 3300049680 Ga0501250_011187 Ga0501250_011187_334_921 194
346 3300049688 Ga0501259_003966 Ga0501259_003966_1680_2267 194
347 3300049763 Ga0501266_031316 Ga0501266_031316_59_646 194
348 3300050493 nmdc:mga0k408_232658_c1 nmdc:mga0k408_232658_c1_321_905 194
349 3300050508 nmdc:mga09592_189645_c1 nmdc:mga09592_189645_c1_90_674 194
350 3300050511 nmdc:mga08y16_106273_c1 nmdc:mga08y16_106273_c1_1406_1990 194
351 3300053092 Ga0500583_0006778 Ga0500583_0006778_2264_2869 194
352 3300053146 Ga0500588_0143371 Ga0500588_0143371_99_767 194
353 3300053156 Ga0500622_0002000 Ga0500622_0002000_3256_3861 194

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00881

Nitroreductase

Nitroreductase family

53

214

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
8dil-assembly1.cif.gz_A crystal structure of putative nitroreductase from salmonella enterica 0.8961 8 192
8dil-assembly3.cif.gz_E crystal structure of putative nitroreductase from salmonella enterica 0.896 8 192
7tmg-assembly1.cif.gz_B crystal structure of nad(p)h nitroreductase from klebsiella pneumoniae (long b-axis) 0.8957 8 192
3bm1-assembly1.cif.gz_A crystal structure of a minimal nitroreductase ydja from escherichia coli k12 with and without fmn cofactor 0.8943 8 192
3bm1-assembly1.cif.gz_B crystal structure of a minimal nitroreductase ydja from escherichia coli k12 with and without fmn cofactor 0.8909 8 192
ID Description Score Start End Superfamily
3k6hB01 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8732 8 173 3.40.109.10
af_Q2G001_1_177_3.40.109.10 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8709 8 189 3.40.109.10
3k6hB01 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.854 8 173 3.40.109.10
af_Q2G001_1_177_3.40.109.10 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8528 8 189 3.40.109.10
2i7hE00 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8448 1 192 3.40.109.10
ID Description Score Start End GO Terms
AF-A0A1M3FZR4-F1-model_v4 Putative NAD(P)H nitroreductase (EC 1.-.-.-) 0.9885 1 192 GO:0016491
AF-A0A699V6K7-F1-model_v4 Nitroreductase domain-containing protein 0.986 22 168 GO:0016491
AF-A0A7L4ZXI2-F1-model_v4 Putative NAD(P)H nitroreductase (EC 1.-.-.-) 0.9858 1 194 GO:0016491
AF-A0A4Q6BF73-F1-model_v4 Putative NAD(P)H nitroreductase (EC 1.-.-.-) 0.9839 1 194 GO:0016491
AF-A0A4Q6BF73-F1-model_v4 Putative NAD(P)H nitroreductase (EC 1.-.-.-) 0.9789 1 194 GO:0016491

Feature Viewer

pLDDT pTM Quality
95.9 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map