F419203

General Info

Members Datasets Scaffolds Average Seq Length
352 183 704 219

Family's Representative Sequence

Representative Sequence 3300050508|nmdc:mga09592_116729_c1|nmdc:mga09592_116729_c1_925_1674
Length 249
Sequence VSRKLLEAGSWKLEAHMVSGIIGRKVGMTQLFQKDGTVTPGTVIKAGPCVVVQTKTAQTDGYESVQLGLVEERPARVRKPLAGHYKKAGVPPTRVRREVKVAKGAESPKAGDQVLVNTVFTNGDRVDVIGVSRGKGFQGVVRRHHFRGGAATHGSMFHRAPGSIGASSYPSRVVKGMRAGGRMGGDQVTTRNLKVIAVDAENNLVIVHGAVPGAPGSYVVVRKAIARKPEPQKQAEKPGKTVVKKPAKK

Samples

Sample ID Description Type Environment
1 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
29 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
33 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
34 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
35 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
62 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
85 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
86 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
87 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
88 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
89 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
90 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
91 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
92 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
93 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
94 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
95 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
96 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
97 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
98 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
99 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
100 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
101 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
102 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
103 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
104 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
105 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
106 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
107 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
108 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
109 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
110 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
111 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
112 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
113 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
114 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
115 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
116 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
117 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
118 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
119 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
120 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
121 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
122 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
123 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
124 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
125 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
126 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
127 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
128 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
129 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
130 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
131 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
132 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
133 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
134 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
135 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
136 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
137 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
138 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
139 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
155 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
156 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
157 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
158 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
159 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
160 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
161 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
162 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
163 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
164 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
165 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
166 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
167 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
170 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
171 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
172 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
173 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
174 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
175 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
176 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
177 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
178 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
179 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
180 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
181 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
182 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
183 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.72
Metatranscriptomes 0.28
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.27
Nodule 0
Rhizoplane 3.41
Rhizosphere 94.32
Stem 0
Stem Tuber 0
Unclassified 1.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga09592_116729_c1 3300050508 Bacteria 2291
2 Ga0058863_10028837 3300004799 Bacteria 4278
3 Ga0065707_10177374 3300005295 Bacteria 1441
4 Ga0070683_100165357 3300005329 Bacteria 2099
5 Ga0070690_100178137 3300005330 Bacteria 1468
6 Ga0068869_100925340 3300005334 Bacteria 756
7 Ga0070666_10081248 3300005335 Bacteria 2215
8 Ga0068868_100672698 3300005338 Bacteria 924
9 Ga0070689_100425956 3300005340 Bacteria 1126
10 Ga0070689_100594617 3300005340 Bacteria 958
11 Ga0070687_100443335 3300005343 Bacteria 862
12 Ga0070668_100385234 3300005347 Bacteria 1194
13 Ga0070675_100590524 3300005354 Bacteria 1007
14 Ga0070675_100634442 3300005354 Bacteria 970
15 Ga0070674_100034038 3300005356 Bacteria 3398
16 Ga0070688_100079504 3300005365 Bacteria 2119
17 Ga0070688_100833256 3300005365 Bacteria 723
18 Ga0070667_100291503 3300005367 Bacteria 1468
19 Ga0070701_10473815 3300005438 Bacteria 808
20 Ga0070694_100862484 3300005444 Bacteria 746
21 Ga0070708_100362012 3300005445 Bacteria 1367
22 Ga0070662_100474666 3300005457 Bacteria 1041
23 Ga0068867_100278239 3300005459 Bacteria 1371
24 Ga0070684_100241704 3300005535 Bacteria 1650
25 Ga0070697_100175416 3300005536 Bacteria 1816
26 Ga0068853_100598644 3300005539 Bacteria 1047
27 Ga0070672_100004038 3300005543 Bacteria 9575
28 Ga0070672_100435573 3300005543 Bacteria 1127
29 Ga0070695_100267151 3300005545 Bacteria 1252
30 Ga0068852_100011754 3300005616 Bacteria 6610
31 Ga0068859_100054840 3300005617 Bacteria 4010
32 Ga0068851_10364205 3300005834 Bacteria 844
33 Ga0068870_10064018 3300005840 Bacteria 1985
34 Ga0068863_100252568 3300005841 Bacteria 1703
35 Ga0068863_100787241 3300005841 Bacteria 948
36 Ga0068863_100840202 3300005841 Bacteria 917
37 Ga0068858_100099065 3300005842 Bacteria 2718
38 Ga0075368_10079813 3300006042 Bacteria 1330
39 Ga0075367_10037756 3300006178 Bacteria 2808
40 Ga0075366_10007866 3300006195 Bacteria 5897
41 Ga0075366_10274929 3300006195 Bacteria 1029
42 Ga0075370_10094455 3300006353 Bacteria 1727
43 Ga0068871_100016445 3300006358 Bacteria 5571
44 Ga0075428_100072881 3300006844 Bacteria 3750
45 Ga0075428_100105364 3300006844 Bacteria 3075
46 Ga0075428_100119989 3300006844 Bacteria 2862
47 Ga0075430_100010485 3300006846 Bacteria 7846
48 Ga0075430_100054080 3300006846 Bacteria 3378
49 Ga0075430_100182976 3300006846 Bacteria 1743
50 Ga0075430_100214374 3300006846 Bacteria 1597
51 Ga0075430_100224935 3300006846 Bacteria 1556
52 Ga0075430_100360516 3300006846 Bacteria 1200
53 Ga0075431_100041342 3300006847 Bacteria 4752
54 Ga0075431_100093026 3300006847 Bacteria 3112
55 Ga0075431_100122205 3300006847 Bacteria 2686
56 Ga0075431_100134485 3300006847 Bacteria 2549
57 Ga0075431_100402200 3300006847 Bacteria 1370
58 Ga0075431_100716379 3300006847 Unclassified 978
59 Ga0075433_10199161 3300006852 Bacteria 1781
60 Ga0075433_10201036 3300006852 Bacteria 1771
61 Ga0075433_10205348 3300006852 Bacteria 1751
62 Ga0075433_10524026 3300006852 Bacteria 1043
63 Ga0075434_100049229 3300006871 Bacteria 4184
64 Ga0075434_100050884 3300006871 Bacteria 4115
65 Ga0075434_100100328 3300006871 Bacteria 2901
66 Ga0075434_100126397 3300006871 Bacteria 2574
67 Ga0075434_100792519 3300006871 Bacteria 964
68 Ga0075429_100074820 3300006880 Bacteria 2950
69 Ga0075429_100165682 3300006880 Bacteria 1936
70 Ga0068865_100083096 3300006881 Bacteria 2304
71 Ga0097620_100054842 3300006931 Bacteria 4010
72 Ga0075435_100050686 3300007076 Bacteria 3342
73 Ga0075435_100125186 3300007076 Bacteria 2147
74 Ga0075435_100156777 3300007076 Bacteria 1916
75 Ga0111539_10097818 3300009094 Bacteria 3448
76 Ga0111539_10499360 3300009094 Bacteria 1417
77 Ga0111539_10735382 3300009094 Bacteria 1148
78 Ga0105245_10250856 3300009098 Bacteria 1719
79 Ga0105245_11210482 3300009098 Bacteria 803
80 Ga0114129_10003061 3300009147 Bacteria 23447
81 Ga0114129_10003419 3300009147 Bacteria 22319
82 Ga0114129_10053973 3300009147 Bacteria 5636
83 Ga0114129_10084548 3300009147 Bacteria 4405
84 Ga0114129_10107844 3300009147 Bacteria 3845
85 Ga0114129_10276154 3300009147 Bacteria 2246
86 Ga0114129_10311822 3300009147 Bacteria 2094
87 Ga0114129_10757089 3300009147 Bacteria 1243
88 Ga0114129_10795886 3300009147 Bacteria 1206
89 Ga0114129_11646747 3300009147 Unclassified 784
90 Ga0105243_10088970 3300009148 Bacteria 2538
91 Ga0105242_10216574 3300009176 Bacteria 1709
92 Ga0105248_10651883 3300009177 Bacteria 1188
93 Ga0105249_10751863 3300009553 Bacteria 1037
94 Ga0157374_10222999 3300013296 Bacteria 1850
95 Ga0157374_10487603 3300013296 Bacteria 1236
96 Ga0157378_10191524 3300013297 Bacteria 1929
97 Ga0163162_10607648 3300013306 Bacteria 1219
98 Ga0157375_10118795 3300013308 Bacteria 2751
99 Ga0157375_10505551 3300013308 Bacteria 1372
100 Ga0163163_10151677 3300014325 Bacteria 2361
101 Ga0157380_10769855 3300014326 Bacteria 976
102 Ga0157379_10337562 3300014968 Bacteria 1378
103 Ga0157376_10315631 3300014969 Bacteria 1484
104 Ga0163161_10036682 3300017792 Bacteria 3511
105 Ga0207697_10005231 3300025315 Bacteria 6054
106 Ga0207697_10137383 3300025315 Bacteria 1059
107 Ga0207656_10245921 3300025321 Bacteria 875
108 Ga0207688_10093298 3300025901 Bacteria 1731
109 Ga0207688_10100806 3300025901 Bacteria 1667
110 Ga0207680_10156707 3300025903 Bacteria 1523
111 Ga0207643_10334973 3300025908 Bacteria 947
112 Ga0207649_10006692 3300025920 Bacteria 6263
113 Ga0207646_10027640 3300025922 Bacteria 5171
114 Ga0207650_10071199 3300025925 Bacteria 2615
115 Ga0207650_10191412 3300025925 Bacteria 1635
116 Ga0207687_10317028 3300025927 Bacteria 1261
117 Ga0207686_10051320 3300025934 Bacteria 2569
118 Ga0207669_10069377 3300025937 Bacteria 2205
119 Ga0207691_10006942 3300025940 Bacteria 10919
120 Ga0207691_10206081 3300025940 Bacteria 1710
121 Ga0207691_10359319 3300025940 Bacteria 1245
122 Ga0207711_10289645 3300025941 Bacteria 1509
123 Ga0207689_10159233 3300025942 Bacteria 1861
124 Ga0207661_10124466 3300025944 Bacteria 2200
125 Ga0207651_10521435 3300025960 Bacteria 1030
126 Ga0207658_10001060 3300025986 Bacteria 22265
127 Ga0207658_10074721 3300025986 Bacteria 2576
128 Ga0207677_10306457 3300026023 Bacteria 1314
129 Ga0207677_10476959 3300026023 Bacteria 1074
130 Ga0207648_10557860 3300026089 Bacteria 1053
131 Ga0207676_10304255 3300026095 Bacteria 1457
132 Ga0207676_10312882 3300026095 Bacteria 1438
133 Ga0207675_100482137 3300026118 Bacteria 1233
134 Ga0207683_10339552 3300026121 Bacteria 1377
135 Ga0209813_10043254 3300027866 Bacteria 1380
136 Ga0207428_10048989 3300027907 Bacteria 3387
137 Ga0265330_10001550 3300031235 Bacteria 13214
138 Ga0265316_10016978 3300031344 Bacteria 6302
139 Ga0307408_100010079 3300031548 Bacteria 6229
140 Ga0307408_100051179 3300031548 Bacteria 2974
141 Ga0307408_100078832 3300031548 Bacteria 2456
142 Ga0307408_100483079 3300031548 Bacteria 1081
143 Ga0316579_10102114 3300031691 Bacteria 1374
144 Ga0316579_10287533 3300031691 Bacteria 795
145 Ga0265342_10120452 3300031712 Bacteria 1478
146 Ga0316576_10002836 3300031727 Bacteria 9983
147 Ga0316576_10002865 3300031727 Bacteria 9949
148 Ga0316576_10048945 3300031727 Bacteria 3068
149 Ga0316576_10074499 3300031727 Bacteria 2510
150 Ga0307405_10015136 3300031731 Bacteria 4168
151 Ga0307405_10295678 3300031731 Bacteria 1226
152 Ga0307405_10505865 3300031731 Bacteria 969
153 Ga0307413_10160945 3300031824 Bacteria 1577
154 Ga0307410_10225881 3300031852 Bacteria 1443
155 Ga0307410_10442876 3300031852 Bacteria 1058
156 Ga0307406_10082603 3300031901 Bacteria 2140
157 Ga0307406_10115443 3300031901 Bacteria 1856
158 Ga0307406_10199495 3300031901 Bacteria 1471
159 Ga0307412_10198418 3300031911 Bacteria 1522
160 Ga0307412_10681080 3300031911 Unclassified 880
161 Ga0307409_100591680 3300031995 Bacteria 1095
162 Ga0307416_100103879 3300032002 Bacteria 2482
163 Ga0307414_10127509 3300032004 Bacteria 1969
164 Ga0307411_10022570 3300032005 Bacteria 3708
165 Ga0307411_10070377 3300032005 Bacteria 2367
166 Ga0307411_10593417 3300032005 Bacteria 951
167 Ga0307411_10768306 3300032005 Bacteria 846
168 Ga0307415_100012803 3300032126 Bacteria 4867
169 Ga0373953_0235970 3300035117 Bacteria 793
170 Ga0373957_0123403 3300035120 Bacteria 1050
171 Ga0316574_0377470 3300035398 Bacteria 895
172 Ga0373933_0455989 3300035724 Bacteria 836
173 Ga0373947_0256147 3300035725 Bacteria 1158
174 Ga0373937_0165911 3300036401 Bacteria 2071
175 Ga0373937_0184871 3300036401 Bacteria 1957
176 Ga0436362_1201015 3300039453 Archaea 802
177 Ga0451807_2318577 3300041486 Bacteria 775
178 Ga0439450_008724 3300042008 Bacteria 1900
179 Ga0439435_0051548 3300042436 Bacteria 1179
180 Ga0439464_0033360 3300042439 Bacteria 1449
181 Ga0439460_0091726 3300042461 Bacteria 966
182 Ga0451577_0062491 3300042876 Bacteria 3321
183 Ga0451577_0253234 3300042876 Bacteria 1594
184 Ga0451577_0317317 3300042876 Bacteria 1413
185 Ga0453683_0053445 3300044673 Bacteria 2527
186 Ga0453684_0025507 3300044712 Bacteria 8578
187 Ga0453684_0062702 3300044712 Bacteria 4759
188 Ga0453684_0307866 3300044712 Bacteria 1799
189 Ga0453684_0320972 3300044712 Bacteria 1754
190 Ga0451576_0279573 3300045051 Bacteria 1745
191 Ga0466967_0057920 3300045976 Bacteria 3423
192 Ga0495603_0121766 3300046455 Bacteria 1520
193 Ga0495629_0067049 3300046459 Bacteria 2505
194 Ga0495639_0064146 3300046475 Bacteria 1688
195 Ga0495608_0150078 3300046511 Bacteria 1485
196 Ga0495630_0165673 3300046517 Bacteria 1683
197 Ga0495667_0005206 3300046559 Bacteria 8791
198 Ga0495657_0245872 3300046675 Bacteria 1078
199 Ga0495599_0040155 3300046678 Bacteria 2939
200 Ga0495658_0067609 3300046683 Bacteria 2067
201 Ga0495658_0107006 3300046683 Bacteria 1677
202 Ga0495658_0333483 3300046683 Bacteria 963
203 Ga0495600_0078578 3300046809 Bacteria 2155
204 Ga0495636_0016275 3300047318 Bacteria 2970
205 Ga0495684_0186193 3300047471 Bacteria 1537
206 Ga0496102_0095046 3300048905 Bacteria 2762
207 Ga0496102_0242603 3300048905 Bacteria 1699
208 Ga0496105_0047912 3300048908 Bacteria 3527
209 Ga0496106_0076733 3300048909 Bacteria 2562
210 Ga0496106_0135058 3300048909 Bacteria 1937
211 Ga0496108_0289779 3300048911 Bacteria 1425
212 Ga0496109_0287695 3300048912 Bacteria 1549
213 Ga0496110_0138491 3300048913 Bacteria 2200
214 Ga0496114_0072770 3300048917 Bacteria 2891
215 Ga0496114_0435634 3300048917 Bacteria 1161
216 Ga0496115_0753932 3300048918 Bacteria 761
217 Ga0501031_0202963 3300049568 Bacteria 1293
218 Ga0501032_0029495 3300049569 Bacteria 3763
219 Ga0501032_0044742 3300049569 Bacteria 2995
220 Ga0501032_0223000 3300049569 Bacteria 1226
221 Ga0501033_0079542 3300049570 Bacteria 2405
222 Ga0501034_0238169 3300049571 Bacteria 1766
223 Ga0501034_0425945 3300049571 Bacteria 1247
224 Ga0501036_0033541 3300049572 Bacteria 4341
225 Ga0501036_0092819 3300049572 Bacteria 2550
226 Ga0501036_0185917 3300049572 Bacteria 1748
227 Ga0501036_0255126 3300049572 Bacteria 1469
228 Ga0501036_0780230 3300049572 Bacteria 787
229 Ga0501037_0151605 3300049573 Bacteria 1656
230 Ga0501038_0189724 3300049574 Bacteria 1654
231 Ga0501038_0333861 3300049574 Bacteria 1183
232 Ga0501038_0340280 3300049574 Bacteria 1170
233 Ga0501038_0663631 3300049574 Bacteria 784
234 Ga0501039_0127505 3300049575 Bacteria 1996
235 Ga0501039_0184354 3300049575 Bacteria 1641
236 Ga0501040_0052192 3300049576 Bacteria 2798
237 Ga0501040_0142187 3300049576 Bacteria 1691
238 Ga0501041_0039049 3300049577 Bacteria 2880
239 Ga0501041_0432929 3300049577 Bacteria 835
240 Ga0501042_0014364 3300049578 Bacteria 5405
241 Ga0501042_0020339 3300049578 Bacteria 4619
242 Ga0501043_0151080 3300049579 Bacteria 1817
243 Ga0501046_0176634 3300049580 Bacteria 1599
244 Ga0501046_0188675 3300049580 Bacteria 1538
245 Ga0501046_0372581 3300049580 Bacteria 1034
246 Ga0501047_0049792 3300049581 Bacteria 4044
247 Ga0501047_0102676 3300049581 Bacteria 2738
248 Ga0501047_0388828 3300049581 Bacteria 1228
249 Ga0501048_0031213 3300049582 Bacteria 3854
250 Ga0501048_0034967 3300049582 Bacteria 3620
251 Ga0501048_0220620 3300049582 Bacteria 1345
252 Ga0501048_0529193 3300049582 Bacteria 845
253 Ga0501069_0110578 3300049585 Bacteria 1564
254 Ga0501069_0251403 3300049585 Bacteria 1031
255 Ga0501071_0004203 3300049587 Bacteria 9116
256 Ga0501072_0022227 3300049588 Bacteria 4921
257 Ga0501072_0088345 3300049588 Bacteria 2459
258 Ga0501072_0190964 3300049588 Bacteria 1633
259 Ga0501072_0212041 3300049588 Bacteria 1543
260 Ga0501072_0255208 3300049588 Bacteria 1396
261 Ga0501072_0265679 3300049588 Bacteria 1365
262 Ga0501073_0036691 3300049589 Bacteria 3481
263 Ga0501073_0056367 3300049589 Bacteria 2749
264 Ga0501073_0128363 3300049589 Bacteria 1757
265 Ga0501073_0140942 3300049589 Bacteria 1670
266 Ga0501074_0081910 3300049590 Bacteria 2314
267 Ga0501074_0198460 3300049590 Bacteria 1430
268 Ga0501075_0071151 3300049591 Bacteria 2629
269 Ga0501075_0126440 3300049591 Bacteria 1946
270 Ga0501075_0130247 3300049591 Bacteria 1916
271 Ga0501076_0008777 3300049592 Bacteria 7427
272 Ga0501076_0023954 3300049592 Bacteria 4711
273 Ga0501076_0473864 3300049592 Bacteria 1031
274 Ga0501077_0160991 3300049593 Bacteria 1425
275 Ga0501077_0190710 3300049593 Bacteria 1302
276 Ga0501077_0287590 3300049593 Bacteria 1047
277 Ga0501249_083203 3300049679 Bacteria 754
278 Ga0501079_0147016 3300049741 Bacteria 1837
279 Ga0501079_0223204 3300049741 Bacteria 1472
280 Ga0501079_0294477 3300049741 Bacteria 1269
281 Ga0501079_0739651 3300049741 Bacteria 774
282 Ga0501080_0118581 3300049742 Bacteria 2454
283 Ga0501080_0160040 3300049742 Bacteria 2080
284 Ga0501080_0173140 3300049742 Bacteria 1990
285 Ga0501080_0197875 3300049742 Bacteria 1845
286 Ga0501080_0402322 3300049742 Bacteria 1231
287 Ga0501080_0755637 3300049742 Bacteria 855
288 Ga0501081_0303599 3300049743 Bacteria 1171
289 Ga0501081_0317724 3300049743 Bacteria 1144
290 Ga0501083_0014118 3300049744 Bacteria 5584
291 Ga0501083_0018057 3300049744 Bacteria 4917
292 Ga0501083_0236485 3300049744 Bacteria 1189
293 Ga0501035_0133944 3300049822 Bacteria 2158
294 Ga0501035_0337709 3300049822 Bacteria 1263
295 Ga0501044_0434457 3300049823 Bacteria 1221
296 Ga0501045_0023487 3300049824 Bacteria 4421
297 Ga0501045_0149693 3300049824 Bacteria 1736
298 Ga0501045_0312554 3300049824 Bacteria 1169
299 nmdc:mga0k408_67588_c1 3300050493 Bacteria 2083
300 nmdc:mga07m45_226735_c1 3300050496 Bacteria 1087
301 nmdc:mga05p37_442_c1 3300050507 Bacteria 41162
302 nmdc:mga05p37_504501_c1 3300050507 Bacteria 1388
303 nmdc:mga05p37_531590_c1 3300050507 Bacteria 1343
304 nmdc:mga05p37_613213_c1 3300050507 Bacteria 1226
305 nmdc:mga05p37_63739_c1 3300050507 Bacteria 4536
306 nmdc:mga05p37_65_c1 3300050507 Bacteria 48888
307 nmdc:mga05p37_667590_c1 3300050507 Unclassified 1161
308 nmdc:mga05p37_712577_c1 3300050507 Bacteria 1113
309 nmdc:mga05p37_9234_c1 3300050507 Bacteria 11652
310 nmdc:mga09592_20919_c1 3300050508 Bacteria 5388
311 nmdc:mga09592_419271_c1 3300050508 Bacteria 1156
312 nmdc:mga09592_557825_c1 3300050508 Bacteria 983
313 nmdc:mga09592_559001_c1 3300050508 Bacteria 982
314 nmdc:mga0qj67_111016_c1 3300050509 Bacteria 2214
315 nmdc:mga0qj67_153873_c1 3300050509 Bacteria 1866
316 nmdc:mga0qj67_37408_c1 3300050509 Bacteria 3802
317 nmdc:mga0qj67_60584_c1 3300050509 Bacteria 3004
318 nmdc:mga0qj67_6337_c1 3300050509 Bacteria 8689
319 nmdc:mga06r32_188071_c1 3300050510 Bacteria 2052
320 nmdc:mga06r32_21165_c1 3300050510 Bacteria 6002
321 nmdc:mga06r32_257599_c1 3300050510 Bacteria 1732
322 nmdc:mga06r32_26415_c1 3300050510 Bacteria 5413
323 nmdc:mga06r32_35417_c1 3300050510 Bacteria 4710
324 nmdc:mga06r32_421581_c1 3300050510 Unclassified 1316
325 nmdc:mga06r32_663010_c1 3300050510 Bacteria 1011
326 nmdc:mga06r32_783977_c1 3300050510 Bacteria 915
327 nmdc:mga08y16_62242_c1 3300050511 Bacteria 3897
328 nmdc:mga08y16_71983_c1 3300050511 Bacteria 3602
329 nmdc:mga0n895_145328_c1 3300050512 Bacteria 2401
330 nmdc:mga0n895_179407_c1 3300050512 Bacteria 2149
331 nmdc:mga0n895_19511_c1 3300050512 Bacteria 6303
332 nmdc:mga0n895_642070_c1 3300050512 Bacteria 1061
333 nmdc:mga0n895_78429_c1 3300050512 Bacteria 3287
334 nmdc:mga0n895_864812_c1 3300050512 Bacteria 891
335 nmdc:mga0rr50_239149_c1 3300050513 Bacteria 1505
336 nmdc:mga0rr50_259400_c1 3300050513 Bacteria 1446
337 nmdc:mga0a205_15955_c1 3300050515 Bacteria 7027
338 nmdc:mga0a205_338223_c1 3300050515 Bacteria 1374
339 nmdc:mga0a205_57475_c1 3300050515 Bacteria 3756
340 nmdc:mga0a205_61372_c1 3300050515 Bacteria 3631
341 Ga0495601_0056839 3300053077 Bacteria 2478
342 Ga0495601_0206513 3300053077 Bacteria 1283
343 Ga0495619_0050104 3300053085 Bacteria 2755
344 Ga0501084_0191538 3300054114 Bacteria 1725
345 Ga0501084_0346198 3300054114 Bacteria 1255
346 Ga0501084_0415891 3300054114 Bacteria 1136
347 Ga0501082_0239638 3300060353 Bacteria 1578
348 Ga0501082_0328057 3300060353 Bacteria 1333
349 Ga0501082_0340202 3300060353 Bacteria 1307
350 Ga0501082_0374027 3300060353 Bacteria 1243
351 Ga0530510_0058329 3300061734 Bacteria 2791
352 Ga0530510_0101846 3300061734 Bacteria 2100
353 nmdc:mga09592_116729_c1
354 Ga0058863_10028837
355 Ga0065707_10177374
356 Ga0070683_100165357
357 Ga0070690_100178137
358 Ga0068869_100925340
359 Ga0070666_10081248
360 Ga0068868_100672698
361 Ga0070689_100425956
362 Ga0070689_100594617
363 Ga0070687_100443335
364 Ga0070668_100385234
365 Ga0070675_100590524
366 Ga0070675_100634442
367 Ga0070674_100034038
368 Ga0070688_100079504
369 Ga0070688_100833256
370 Ga0070667_100291503
371 Ga0070701_10473815
372 Ga0070694_100862484
373 Ga0070708_100362012
374 Ga0070662_100474666
375 Ga0068867_100278239
376 Ga0070684_100241704
377 Ga0070697_100175416
378 Ga0068853_100598644
379 Ga0070672_100004038
380 Ga0070672_100435573
381 Ga0070695_100267151
382 Ga0068852_100011754
383 Ga0068859_100054840
384 Ga0068851_10364205
385 Ga0068870_10064018
386 Ga0068863_100252568
387 Ga0068863_100787241
388 Ga0068863_100840202
389 Ga0068858_100099065
390 Ga0075368_10079813
391 Ga0075367_10037756
392 Ga0075366_10007866
393 Ga0075366_10274929
394 Ga0075370_10094455
395 Ga0068871_100016445
396 Ga0075428_100072881
397 Ga0075428_100105364
398 Ga0075428_100119989
399 Ga0075430_100010485
400 Ga0075430_100054080
401 Ga0075430_100182976
402 Ga0075430_100214374
403 Ga0075430_100224935
404 Ga0075430_100360516
405 Ga0075431_100041342
406 Ga0075431_100093026
407 Ga0075431_100122205
408 Ga0075431_100134485
409 Ga0075431_100402200
410 Ga0075431_100716379
411 Ga0075433_10199161
412 Ga0075433_10201036
413 Ga0075433_10205348
414 Ga0075433_10524026
415 Ga0075434_100049229
416 Ga0075434_100050884
417 Ga0075434_100100328
418 Ga0075434_100126397
419 Ga0075434_100792519
420 Ga0075429_100074820
421 Ga0075429_100165682
422 Ga0068865_100083096
423 Ga0097620_100054842
424 Ga0075435_100050686
425 Ga0075435_100125186
426 Ga0075435_100156777
427 Ga0111539_10097818
428 Ga0111539_10499360
429 Ga0111539_10735382
430 Ga0105245_10250856
431 Ga0105245_11210482
432 Ga0114129_10003061
433 Ga0114129_10003419
434 Ga0114129_10053973
435 Ga0114129_10084548
436 Ga0114129_10107844
437 Ga0114129_10276154
438 Ga0114129_10311822
439 Ga0114129_10757089
440 Ga0114129_10795886
441 Ga0114129_11646747
442 Ga0105243_10088970
443 Ga0105242_10216574
444 Ga0105248_10651883
445 Ga0105249_10751863
446 Ga0157374_10222999
447 Ga0157374_10487603
448 Ga0157378_10191524
449 Ga0163162_10607648
450 Ga0157375_10118795
451 Ga0157375_10505551
452 Ga0163163_10151677
453 Ga0157380_10769855
454 Ga0157379_10337562
455 Ga0157376_10315631
456 Ga0163161_10036682
457 Ga0207697_10005231
458 Ga0207697_10137383
459 Ga0207656_10245921
460 Ga0207688_10093298
461 Ga0207688_10100806
462 Ga0207680_10156707
463 Ga0207643_10334973
464 Ga0207649_10006692
465 Ga0207646_10027640
466 Ga0207650_10071199
467 Ga0207650_10191412
468 Ga0207687_10317028
469 Ga0207686_10051320
470 Ga0207669_10069377
471 Ga0207691_10006942
472 Ga0207691_10206081
473 Ga0207691_10359319
474 Ga0207711_10289645
475 Ga0207689_10159233
476 Ga0207661_10124466
477 Ga0207651_10521435
478 Ga0207658_10001060
479 Ga0207658_10074721
480 Ga0207677_10306457
481 Ga0207677_10476959
482 Ga0207648_10557860
483 Ga0207676_10304255
484 Ga0207676_10312882
485 Ga0207675_100482137
486 Ga0207683_10339552
487 Ga0209813_10043254
488 Ga0207428_10048989
489 Ga0265330_10001550
490 Ga0265316_10016978
491 Ga0307408_100010079
492 Ga0307408_100051179
493 Ga0307408_100078832
494 Ga0307408_100483079
495 Ga0316579_10102114
496 Ga0316579_10287533
497 Ga0265342_10120452
498 Ga0316576_10002836
499 Ga0316576_10002865
500 Ga0316576_10048945
501 Ga0316576_10074499
502 Ga0307405_10015136
503 Ga0307405_10295678
504 Ga0307405_10505865
505 Ga0307413_10160945
506 Ga0307410_10225881
507 Ga0307410_10442876
508 Ga0307406_10082603
509 Ga0307406_10115443
510 Ga0307406_10199495
511 Ga0307412_10198418
512 Ga0307412_10681080
513 Ga0307409_100591680
514 Ga0307416_100103879
515 Ga0307414_10127509
516 Ga0307411_10022570
517 Ga0307411_10070377
518 Ga0307411_10593417
519 Ga0307411_10768306
520 Ga0307415_100012803
521 Ga0373953_0235970
522 Ga0373957_0123403
523 Ga0316574_0377470
524 Ga0373933_0455989
525 Ga0373947_0256147
526 Ga0373937_0165911
527 Ga0373937_0184871
528 Ga0436362_1201015
529 Ga0451807_2318577
530 Ga0439450_008724
531 Ga0439435_0051548
532 Ga0439464_0033360
533 Ga0439460_0091726
534 Ga0451577_0062491
535 Ga0451577_0253234
536 Ga0451577_0317317
537 Ga0453683_0053445
538 Ga0453684_0025507
539 Ga0453684_0062702
540 Ga0453684_0307866
541 Ga0453684_0320972
542 Ga0451576_0279573
543 Ga0466967_0057920
544 Ga0495603_0121766
545 Ga0495629_0067049
546 Ga0495639_0064146
547 Ga0495608_0150078
548 Ga0495630_0165673
549 Ga0495667_0005206
550 Ga0495657_0245872
551 Ga0495599_0040155
552 Ga0495658_0067609
553 Ga0495658_0107006
554 Ga0495658_0333483
555 Ga0495600_0078578
556 Ga0495636_0016275
557 Ga0495684_0186193
558 Ga0496102_0095046
559 Ga0496102_0242603
560 Ga0496105_0047912
561 Ga0496106_0076733
562 Ga0496106_0135058
563 Ga0496108_0289779
564 Ga0496109_0287695
565 Ga0496110_0138491
566 Ga0496114_0072770
567 Ga0496114_0435634
568 Ga0496115_0753932
569 Ga0501031_0202963
570 Ga0501032_0029495
571 Ga0501032_0044742
572 Ga0501032_0223000
573 Ga0501033_0079542
574 Ga0501034_0238169
575 Ga0501034_0425945
576 Ga0501036_0033541
577 Ga0501036_0092819
578 Ga0501036_0185917
579 Ga0501036_0255126
580 Ga0501036_0780230
581 Ga0501037_0151605
582 Ga0501038_0189724
583 Ga0501038_0333861
584 Ga0501038_0340280
585 Ga0501038_0663631
586 Ga0501039_0127505
587 Ga0501039_0184354
588 Ga0501040_0052192
589 Ga0501040_0142187
590 Ga0501041_0039049
591 Ga0501041_0432929
592 Ga0501042_0014364
593 Ga0501042_0020339
594 Ga0501043_0151080
595 Ga0501046_0176634
596 Ga0501046_0188675
597 Ga0501046_0372581
598 Ga0501047_0049792
599 Ga0501047_0102676
600 Ga0501047_0388828
601 Ga0501048_0031213
602 Ga0501048_0034967
603 Ga0501048_0220620
604 Ga0501048_0529193
605 Ga0501069_0110578
606 Ga0501069_0251403
607 Ga0501071_0004203
608 Ga0501072_0022227
609 Ga0501072_0088345
610 Ga0501072_0190964
611 Ga0501072_0212041
612 Ga0501072_0255208
613 Ga0501072_0265679
614 Ga0501073_0036691
615 Ga0501073_0056367
616 Ga0501073_0128363
617 Ga0501073_0140942
618 Ga0501074_0081910
619 Ga0501074_0198460
620 Ga0501075_0071151
621 Ga0501075_0126440
622 Ga0501075_0130247
623 Ga0501076_0008777
624 Ga0501076_0023954
625 Ga0501076_0473864
626 Ga0501077_0160991
627 Ga0501077_0190710
628 Ga0501077_0287590
629 Ga0501249_083203
630 Ga0501079_0147016
631 Ga0501079_0223204
632 Ga0501079_0294477
633 Ga0501079_0739651
634 Ga0501080_0118581
635 Ga0501080_0160040
636 Ga0501080_0173140
637 Ga0501080_0197875
638 Ga0501080_0402322
639 Ga0501080_0755637
640 Ga0501081_0303599
641 Ga0501081_0317724
642 Ga0501083_0014118
643 Ga0501083_0018057
644 Ga0501083_0236485
645 Ga0501035_0133944
646 Ga0501035_0337709
647 Ga0501044_0434457
648 Ga0501045_0023487
649 Ga0501045_0149693
650 Ga0501045_0312554
651 nmdc:mga0k408_67588_c1
652 nmdc:mga07m45_226735_c1
653 nmdc:mga05p37_442_c1
654 nmdc:mga05p37_504501_c1
655 nmdc:mga05p37_531590_c1
656 nmdc:mga05p37_613213_c1
657 nmdc:mga05p37_63739_c1
658 nmdc:mga05p37_65_c1
659 nmdc:mga05p37_667590_c1
660 nmdc:mga05p37_712577_c1
661 nmdc:mga05p37_9234_c1
662 nmdc:mga09592_20919_c1
663 nmdc:mga09592_419271_c1
664 nmdc:mga09592_557825_c1
665 nmdc:mga09592_559001_c1
666 nmdc:mga0qj67_111016_c1
667 nmdc:mga0qj67_153873_c1
668 nmdc:mga0qj67_37408_c1
669 nmdc:mga0qj67_60584_c1
670 nmdc:mga0qj67_6337_c1
671 nmdc:mga06r32_188071_c1
672 nmdc:mga06r32_21165_c1
673 nmdc:mga06r32_257599_c1
674 nmdc:mga06r32_26415_c1
675 nmdc:mga06r32_35417_c1
676 nmdc:mga06r32_421581_c1
677 nmdc:mga06r32_663010_c1
678 nmdc:mga06r32_783977_c1
679 nmdc:mga08y16_62242_c1
680 nmdc:mga08y16_71983_c1
681 nmdc:mga0n895_145328_c1
682 nmdc:mga0n895_179407_c1
683 nmdc:mga0n895_19511_c1
684 nmdc:mga0n895_642070_c1
685 nmdc:mga0n895_78429_c1
686 nmdc:mga0n895_864812_c1
687 nmdc:mga0rr50_239149_c1
688 nmdc:mga0rr50_259400_c1
689 nmdc:mga0a205_15955_c1
690 nmdc:mga0a205_338223_c1
691 nmdc:mga0a205_57475_c1
692 nmdc:mga0a205_61372_c1
693 Ga0495601_0056839
694 Ga0495601_0206513
695 Ga0495619_0050104
696 Ga0501084_0191538
697 Ga0501084_0346198
698 Ga0501084_0415891
699 Ga0501082_0239638
700 Ga0501082_0328057
701 Ga0501082_0340202
702 Ga0501082_0374027
703 Ga0530510_0058329
704 Ga0530510_0101846

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00297

Ribosomal_L3

Ribosomal protein L3

95

203

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
8c97-assembly1.cif.gz_D cryo-em captures early ribosome assembly in action 0.9003 1 209
8c93-assembly1.cif.gz_D cryo-em captures early ribosome assembly in action 0.8928 1 209
8c97-assembly1.cif.gz_D cryo-em captures early ribosome assembly in action 0.8897 1 209
8c93-assembly1.cif.gz_D cryo-em captures early ribosome assembly in action 0.8876 1 209
6pvk-assembly1.cif.gz_D bacterial 45srbga ribosomal particle class a 0.8797 4 209
ID Description Score Start End Superfamily
1vw3C01 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors 0.9148 1 206 2.40.30.10
af_P60438_33_95_3.30.160.810 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.8477 35 96 3.30.160.810
af_Q9SKX4_88_148_3.30.160.810 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.8415 34 95 3.30.160.810
af_Q9LIT4_106_169_3.30.160.810 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.8343 34 98 3.30.160.810
af_Q9SKX4_88_148_3.30.160.810 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.8295 34 95 3.30.160.810
ID Description Score Start End GO Terms
AF-A0A3N5QK20-F1-model_v4 50S ribosomal protein L3 0.8754 1 83 GO:0003735
GO:0006412
GO:0022625
AF-A0A4S2N183-F1-model_v4 Translation protein 0.8726 2 104 GO:0003735
GO:0005762
GO:0006412
AF-A0A3N5QK20-F1-model_v4 50S ribosomal protein L3 0.8562 1 83 GO:0003735
GO:0006412
GO:0022625
AF-A0A5B0PPW2-F1-model_v4 54S ribosomal protein L9, mitochondrial 0.8492 1 96 GO:0003735
GO:0005762
GO:0006412
AF-A0A258IKC2-F1-model_v4 50S ribosomal protein L3 0.8451 1 131 GO:0003735
GO:0006412
GO:0019843
GO:0022625

Map