F419151

General Info

Members Datasets Scaffolds Average Seq Length
352 239 704 300

Family's Representative Sequence

Representative Sequence 3300047320|Ga0495672_0000711|Ga0495672_0000711_11775_12842
Length 355
Sequence MKTPSALTAGTTALKRQTSITSILALFSATVRQDLLVSVADPASNALTQRSTGGRRFLMSHPVISTEEISYRKYVEVLGAKMAYVDVGVGDPIVFLHGNPTPSYLWRNIIPHLVPFGRCLAPDYIGMGNSGLAPDGGYRFVDHQRFLDAWFKALGIDRNVILVVHDWGSALGFSWAERHRDCMRAIVYMEGIVRPFQSWEEWPDATRAFFQAQRSPAGEDLILEKNLFIEYLLPLRNIAPEAMEVYRRHYRTPGLSRMPMLAWTRDLPIAGEPADVVEIVGSYARWLSASPIPKLFIDAEPAGFLIGAQREFCRAWPNQQVVTVPGSHFVQEDAPEAVGEPTARFVAKVLAGQIA

Samples

Sample ID Description Type Environment
1 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
55 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
95 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
96 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
97 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
100 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
143 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
144 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
145 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
146 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
147 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
148 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
149 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
150 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
151 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
152 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
153 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
154 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
155 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
156 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
157 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
158 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
159 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
160 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
161 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
162 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
163 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
164 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
165 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
166 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
167 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
168 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
169 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
170 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
171 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
172 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
173 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
174 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
175 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
176 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
177 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
178 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
179 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
180 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
181 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
182 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
183 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
184 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
185 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
186 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
187 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
188 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
189 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
190 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
191 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
192 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
193 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
194 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
195 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
196 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
197 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
198 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
199 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
200 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
201 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
202 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
205 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
206 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
207 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
208 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
209 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
210 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
211 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
212 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
213 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
214 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
215 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
216 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
217 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
218 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
219 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
220 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
221 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
222 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
223 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
224 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
225 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
226 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
227 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
228 2791355199
229 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
230 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
231 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
232 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
233 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
234 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
235 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
236 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
237 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
238 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
239 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.73
Metatranscriptomes 0.57
Isolates 3.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.11
Nodule 3.12
Rhizoplane 1.7
Rhizosphere 86.36
Stem 0
Stem Tuber 0
Unclassified 5.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495672_0000711 3300047320 Bacteria 36613
2 JGI24739J22299_10034625 3300001989 Bacteria 1719
3 JGI25153J46596_10007692 3300003215 Bacteria 5253
4 JGI25153J46596_10037497 3300003215 Bacteria 1540
5 rootH2_10004729 3300003320 Bacteria 5775
6 Ga0065712_10002464 3300005290 Bacteria 5762
7 Ga0065715_10166715 3300005293 Bacteria 1575
8 Ga0065707_10096137 3300005295 Bacteria 3301
9 Ga0070676_10023633 3300005328 Bacteria 3456
10 Ga0070683_100449658 3300005329 Bacteria 1229
11 Ga0070690_100215365 3300005330 Bacteria 1343
12 Ga0070677_10036567 3300005333 Bacteria 1911
13 Ga0068869_100057100 3300005334 Unclassified 2849
14 Ga0070666_10051730 3300005335 Bacteria 2767
15 Ga0070680_100106324 3300005336 Bacteria 2333
16 Ga0070680_100268307 3300005336 Unclassified 1445
17 Ga0070682_100239378 3300005337 Bacteria 1302
18 Ga0070689_100213620 3300005340 Bacteria 1580
19 Ga0070692_10023431 3300005345 Bacteria 3025
20 Ga0070668_100099107 3300005347 Bacteria 2307
21 Ga0070669_100058831 3300005353 Bacteria 2821
22 Ga0070675_100124446 3300005354 Bacteria 2193
23 Ga0070671_100006429 3300005355 Bacteria 9389
24 Ga0070671_100036659 3300005355 Bacteria 4067
25 Ga0070688_100069720 3300005365 Bacteria 2246
26 Ga0070667_100019528 3300005367 Bacteria 5624
27 Ga0070667_100028435 3300005367 Bacteria 4654
28 Ga0070709_10106032 3300005434 Bacteria 1881
29 Ga0070713_100048052 3300005436 Bacteria 3511
30 Ga0070710_10036895 3300005437 Bacteria 2674
31 Ga0070710_10320325 3300005437 Bacteria 1018
32 Ga0070705_100020788 3300005440 Unclassified 3481
33 Ga0070708_100033913 3300005445 Bacteria 4436
34 Ga0070663_100220494 3300005455 Bacteria 1489
35 Ga0070678_100183235 3300005456 Bacteria 1716
36 Ga0070662_100009294 3300005457 Bacteria 6425
37 Ga0070662_100046615 3300005457 Bacteria 3115
38 Ga0070681_10275764 3300005458 Unclassified 1593
39 Ga0068867_100001342 3300005459 Bacteria 17027
40 Ga0068867_100135239 3300005459 Unclassified 1921
41 Ga0070706_100031238 3300005467 Bacteria 4911
42 Ga0070706_100165381 3300005467 Bacteria 2066
43 Ga0070707_100087402 3300005468 Bacteria 3015
44 Ga0070707_100118550 3300005468 Bacteria 2569
45 Ga0070699_100062777 3300005518 Bacteria 3220
46 Ga0070699_100120263 3300005518 Bacteria 2309
47 Ga0070684_100103537 3300005535 Bacteria 2546
48 Ga0070697_100110138 3300005536 Bacteria 2294
49 Ga0070672_100081354 3300005543 Bacteria 2597
50 Ga0070672_100096929 3300005543 Bacteria 2387
51 Ga0070696_100118537 3300005546 Bacteria 1914
52 Ga0070665_100018185 3300005548 Bacteria 7051
53 Ga0070665_100020573 3300005548 Bacteria 6630
54 Ga0070665_100053271 3300005548 Bacteria 4058
55 Ga0070665_100101465 3300005548 Bacteria 2881
56 Ga0070665_100281021 3300005548 Unclassified 1666
57 Ga0068855_100009739 3300005563 Bacteria 11592
58 Ga0068855_100075379 3300005563 Bacteria 3917
59 Ga0068855_100416042 3300005563 Unclassified 1471
60 Ga0068857_100092797 3300005577 Bacteria 2703
61 Ga0068859_100005621 3300005617 Bacteria 12779
62 Ga0068859_100220719 3300005617 Bacteria 1983
63 Ga0068859_100488317 3300005617 Bacteria 1327
64 Ga0068861_100010745 3300005719 Bacteria 6361
65 Ga0068861_100139036 3300005719 Bacteria 1980
66 Ga0068870_10015988 3300005840 Bacteria 3575
67 Ga0068863_100023966 3300005841 Bacteria 5824
68 Ga0068863_100029480 3300005841 Bacteria 5237
69 Ga0068863_100054418 3300005841 Bacteria 3792
70 Ga0068858_100000418 3300005842 Bacteria 44177
71 Ga0068858_100050987 3300005842 Bacteria 3829
72 Ga0068858_100225128 3300005842 Bacteria 1777
73 Ga0068860_100010846 3300005843 Bacteria 8993
74 Ga0068860_100083196 3300005843 Bacteria 3044
75 Ga0068862_100004116 3300005844 Bacteria 12322
76 Ga0068862_100526214 3300005844 Unclassified 1126
77 Ga0081455_10000434 3300005937 Bacteria 54939
78 Ga0081455_10002295 3300005937 Bacteria 22789
79 Ga0081455_10004999 3300005937 Bacteria 14665
80 Ga0081455_10127524 3300005937 Bacteria 1994
81 Ga0081540_1005918 3300005983 Bacteria 9024
82 Ga0081539_10017911 3300005985 Bacteria 4943
83 Ga0081539_10056043 3300005985 Bacteria 2189
84 Ga0075363_100013281 3300006048 Bacteria 3987
85 Ga0070715_10077287 3300006163 Bacteria 1502
86 Ga0070716_100289079 3300006173 Bacteria 1135
87 Ga0070712_100079020 3300006175 Bacteria 2376
88 Ga0075367_10004414 3300006178 Bacteria 6869
89 Ga0075369_10013006 3300006186 Unclassified 3294
90 Ga0075369_10021041 3300006186 Bacteria 2676
91 Ga0097621_100060797 3300006237 Bacteria 3098
92 Ga0097621_100287133 3300006237 Bacteria 1449
93 Ga0075370_10043835 3300006353 Bacteria 2529
94 Ga0075370_10170746 3300006353 Bacteria 1278
95 Ga0068871_100217433 3300006358 Bacteria 1654
96 Ga0075428_100127965 3300006844 Bacteria 2763
97 Ga0075428_100131364 3300006844 Bacteria 2723
98 Ga0075430_100320126 3300006846 Bacteria 1282
99 Ga0075431_100003256 3300006847 Bacteria 15724
100 Ga0075431_100199995 3300006847 Bacteria 2044
101 Ga0075433_10055526 3300006852 Bacteria 3457
102 Ga0075434_100042866 3300006871 Bacteria 4487
103 Ga0075429_100004996 3300006880 Bacteria 11420
104 Ga0075429_100183471 3300006880 Bacteria 1834
105 Ga0068865_100012595 3300006881 Bacteria 5328
106 Ga0097620_100005621 3300006931 Bacteria 12779
107 Ga0097620_100220735 3300006931 Bacteria 1983
108 Ga0097620_100488268 3300006931 Bacteria 1327
109 Ga0075435_100056312 3300007076 Bacteria 3178
110 Ga0075435_100236796 3300007076 Unclassified 1552
111 Ga0105250_10022957 3300009092 Bacteria 2514
112 Ga0105240_10000791 3300009093 Bacteria 57291
113 Ga0105240_10014121 3300009093 Bacteria 10914
114 Ga0105240_10024268 3300009093 Bacteria 8001
115 Ga0105240_10060978 3300009093 Bacteria 4701
116 Ga0105240_10101960 3300009093 Bacteria 3489
117 Ga0105240_10424973 3300009093 Bacteria 1492
118 Ga0111539_10089054 3300009094 Bacteria 3626
119 Ga0105245_10532100 3300009098 Bacteria 1195
120 Ga0105247_10000267 3300009101 Bacteria 48481
121 Ga0105247_10035756 3300009101 Bacteria 3029
122 Ga0105247_10047407 3300009101 Bacteria 2638
123 Ga0114129_10035953 3300009147 Bacteria 6995
124 Ga0114129_10149339 3300009147 Bacteria 3198
125 Ga0105243_10174409 3300009148 Bacteria 1865
126 Ga0105241_10072889 3300009174 Bacteria 2670
127 Ga0105242_10035920 3300009176 Bacteria 3973
128 Ga0105248_10004759 3300009177 Bacteria 15027
129 Ga0105248_10127849 3300009177 Bacteria 2867
130 Ga0105248_10550026 3300009177 Bacteria 1302
131 Ga0105237_10010871 3300009545 Bacteria 9657
132 Ga0105237_10018638 3300009545 Bacteria 7176
133 Ga0105237_10032131 3300009545 Bacteria 5315
134 Ga0105237_10173134 3300009545 Bacteria 2159
135 Ga0105238_10145163 3300009551 Bacteria 2349
136 Ga0105238_10191968 3300009551 Bacteria 2018
137 Ga0105238_10194036 3300009551 Bacteria 2006
138 Ga0105249_10013334 3300009553 Bacteria 7258
139 Ga0105249_10034605 3300009553 Bacteria 4579
140 Ga0105249_10088647 3300009553 Bacteria 2890
141 Ga0105249_10105435 3300009553 Bacteria 2658
142 Ga0105249_10220334 3300009553 Bacteria 1867
143 Ga0105239_10009616 3300010375 Bacteria 10877
144 Ga0105239_10048675 3300010375 Bacteria 4648
145 Ga0157370_10431036 3300013104 Bacteria 1213
146 Ga0157370_10435575 3300013104 Bacteria 1206
147 Ga0157369_10003899 3300013105 Bacteria 17702
148 Ga0157369_10004157 3300013105 Bacteria 17144
149 Ga0157369_10012431 3300013105 Bacteria 9662
150 Ga0157369_10189910 3300013105 Bacteria 2159
151 Ga0157378_10093373 3300013297 Bacteria 2739
152 Ga0157378_10552597 3300013297 Bacteria 1157
153 Ga0163162_10104450 3300013306 Bacteria 2928
154 Ga0163162_10214576 3300013306 Bacteria 2055
155 Ga0157375_10852712 3300013308 Bacteria 1057
156 Ga0163163_10362245 3300014325 Unclassified 1506
157 Ga0157376_10513858 3300014969 Bacteria 1179
158 Ga0157376_10554860 3300014969 Unclassified 1137
159 Ga0157376_10610663 3300014969 Bacteria 1087
160 Ga0163161_10034361 3300017792 Bacteria 3627
161 Ga0213874_10022504 3300021377 Bacteria 1750
162 Ga0213875_10012444 3300021388 Unclassified 4204
163 Ga0213871_10000086 3300021441 Bacteria 8177
164 Ga0224712_10029546 3300022467 Bacteria 1970
165 Ga0224712_10042267 3300022467 Bacteria 1726
166 Ga0207666_1004930 3300025271 Bacteria 1690
167 Ga0209758_1004237 3300025297 Bacteria 12139
168 Ga0209758_1005401 3300025297 Bacteria 9875
169 Ga0207692_10019951 3300025898 Bacteria 3040
170 Ga0207710_10001263 3300025900 Bacteria 12791
171 Ga0207710_10066483 3300025900 Bacteria 1645
172 Ga0207680_10024282 3300025903 Bacteria 3325
173 Ga0207680_10096192 3300025903 Bacteria 1894
174 Ga0207685_10046728 3300025905 Bacteria 1649
175 Ga0207699_10075086 3300025906 Bacteria 2078
176 Ga0207699_10215667 3300025906 Bacteria 1307
177 Ga0207645_10093114 3300025907 Bacteria 1939
178 Ga0207645_10276801 3300025907 Unclassified 1114
179 Ga0207643_10011308 3300025908 Bacteria 4820
180 Ga0207643_10039683 3300025908 Unclassified 2649
181 Ga0207684_10017580 3300025910 Bacteria 6132
182 Ga0207684_10433301 3300025910 Bacteria 1129
183 Ga0207654_10060918 3300025911 Unclassified 2206
184 Ga0207654_10108137 3300025911 Bacteria 1725
185 Ga0207707_10233617 3300025912 Unclassified 1600
186 Ga0207695_10062564 3300025913 Bacteria 3841
187 Ga0207695_10333939 3300025913 Bacteria 1404
188 Ga0207695_10370963 3300025913 Bacteria 1317
189 Ga0207671_10032087 3300025914 Bacteria 3910
190 Ga0207671_10115449 3300025914 Bacteria 2047
191 Ga0207671_10178906 3300025914 Bacteria 1650
192 Ga0207693_10043858 3300025915 Bacteria 3516
193 Ga0207693_10109290 3300025915 Bacteria 2169
194 Ga0207663_10145606 3300025916 Bacteria 1656
195 Ga0207660_10095586 3300025917 Bacteria 2211
196 Ga0207652_10143254 3300025921 Unclassified 2138
197 Ga0207646_10019153 3300025922 Bacteria 6364
198 Ga0207681_10019125 3300025923 Bacteria 4325
199 Ga0207694_10170943 3300025924 Bacteria 1759
200 Ga0207659_10285326 3300025926 Bacteria 1351
201 Ga0207644_10012632 3300025931 Bacteria 5613
202 Ga0207706_10009570 3300025933 Bacteria 8897
203 Ga0207706_10057819 3300025933 Bacteria 3416
204 Ga0207686_10012428 3300025934 Bacteria 4683
205 Ga0207709_10223721 3300025935 Bacteria 1359
206 Ga0207704_10075430 3300025938 Bacteria 2156
207 Ga0207665_10093124 3300025939 Bacteria 2092
208 Ga0207691_10050463 3300025940 Bacteria 3809
209 Ga0207691_10122252 3300025940 Bacteria 2306
210 Ga0207711_10002066 3300025941 Bacteria 18157
211 Ga0207711_10200052 3300025941 Bacteria 1823
212 Ga0207689_10089173 3300025942 Unclassified 2533
213 Ga0207689_10243961 3300025942 Bacteria 1485
214 Ga0207667_10020968 3300025949 Bacteria 7247
215 Ga0207667_10071838 3300025949 Bacteria 3597
216 Ga0207667_10352974 3300025949 Unclassified 1500
217 Ga0207712_10056552 3300025961 Bacteria 2764
218 Ga0207712_10163357 3300025961 Bacteria 1733
219 Ga0207668_10044363 3300025972 Bacteria 3024
220 Ga0207658_10017254 3300025986 Bacteria 4974
221 Ga0207703_10000655 3300026035 Bacteria 34701
222 Ga0207703_10008627 3300026035 Bacteria 8042
223 Ga0207703_10012308 3300026035 Bacteria 6669
224 Ga0207703_10133843 3300026035 Bacteria 2144
225 Ga0207639_10047569 3300026041 Bacteria 3243
226 Ga0207639_10327940 3300026041 Bacteria 1361
227 Ga0207708_10323276 3300026075 Bacteria 1259
228 Ga0207641_10000211 3300026088 Bacteria 75479
229 Ga0207641_10131650 3300026088 Bacteria 2246
230 Ga0207648_10003292 3300026089 Bacteria 16984
231 Ga0207674_10109043 3300026116 Bacteria 2745
232 Ga0207674_10195983 3300026116 Bacteria 1969
233 Ga0207675_100000676 3300026118 Bacteria 33601
234 Ga0207675_100169728 3300026118 Bacteria 2085
235 Ga0268266_10010346 3300028379 Bacteria 8160
236 Ga0268266_10043545 3300028379 Bacteria 3837
237 Ga0268266_10089889 3300028379 Bacteria 2690
238 Ga0268264_10000047 3300028381 Bacteria 349944
239 Ga0268264_10231992 3300028381 Bacteria 1705
240 Ga0307509_10000021 3300031507 Bacteria 250589
241 Ga0307408_100021980 3300031548 Bacteria 4327
242 Ga0316579_10058842 3300031691 Bacteria 1806
243 Ga0265314_10000036 3300031711 Bacteria 234928
244 Ga0316576_10013726 3300031727 Bacteria 5395
245 Ga0316578_10055482 3300031728 Bacteria 2325
246 Ga0373943_0098115 3300035170 Bacteria 1528
247 Ga0373955_0020317 3300035172 Bacteria 3337
248 Ga0316574_0038462 3300035398 Bacteria 2937
249 Ga0373924_0028486 3300035410 Bacteria 2227
250 Ga0373935_0149742 3300035692 Bacteria 1583
251 Ga0373937_0000312 3300036401 Bacteria 45975
252 Ga0316584_0011259 3300036712 Bacteria 6279
253 Ga0395900_0117033 3300037418 Bacteria 2735
254 Ga0395898_0006673 3300037466 Bacteria 12309
255 Ga0395905_0000103 3300037471 Bacteria 143491
256 Ga0436364_1027785 3300037853 Bacteria 5208
257 Ga0395901_0140907 3300038443 Bacteria 2534
258 Ga0242420_003292 3300038996 Bacteria 2380
259 Ga0436365_0700631 3300039437 Bacteria 7928
260 Ga0436360_0838913 3300039438 Bacteria 8815
261 Ga0436361_1022077 3300039447 Bacteria 11117
262 Ga0436363_1641448 3300039450 Bacteria 2875
263 Ga0466968_0142798 3300044735 Bacteria 1096
264 Ga0466959_0011153 3300045049 Bacteria 6450
265 Ga0495627_035159 3300046453 Bacteria 1562
266 Ga0495651_0305121 3300046462 Bacteria 1066
267 Ga0495664_0003052 3300046477 Bacteria 9069
268 Ga0495583_0140147 3300046506 Bacteria 1007
269 Ga0495606_0048684 3300046507 Bacteria 2785
270 Ga0495608_0008959 3300046511 Bacteria 6994
271 Ga0495631_0003882 3300046518 Bacteria 8082
272 Ga0495643_0003607 3300046522 Bacteria 11252
273 Ga0495648_0051536 3300046524 Bacteria 2507
274 Ga0495587_0053289 3300046536 Bacteria 2385
275 Ga0495645_0001100 3300046543 Bacteria 18313
276 Ga0495633_0000298 3300046558 Bacteria 56626
277 Ga0495667_0017860 3300046559 Bacteria 4793
278 Ga0495611_0173635 3300046648 Bacteria 1007
279 Ga0495625_0084681 3300046660 Bacteria 2202
280 Ga0495625_0146077 3300046660 Bacteria 1592
281 Ga0495635_0011116 3300046663 Bacteria 6310
282 Ga0495599_0097709 3300046678 Bacteria 1831
283 Ga0495623_0034250 3300046679 Bacteria 3258
284 Ga0495646_0012732 3300046680 Bacteria 5346
285 Ga0495670_0005523 3300046691 Bacteria 6205
286 Ga0495649_0065248 3300046694 Bacteria 1954
287 Ga0495674_0014832 3300047319 Bacteria 7291
288 Ga0495674_0084474 3300047319 Bacteria 2721
289 Ga0495687_000424 3300047443 Bacteria 52211
290 Ga0495675_0032773 3300047444 Bacteria 3314
291 Ga0495675_0261837 3300047444 Bacteria 1036
292 Ga0495681_0014060 3300047470 Bacteria 4612
293 Ga0495684_0123116 3300047471 Bacteria 1952
294 Ga0495602_0000195 3300048088 Bacteria 57149
295 Ga0496102_0313973 3300048905 Bacteria 1477
296 Ga0496104_0073060 3300048907 Bacteria 3263
297 Ga0496109_0030032 3300048912 Bacteria 4871
298 Ga0496110_0175727 3300048913 Bacteria 1943
299 Ga0496112_0174150 3300048915 Bacteria 2117
300 Ga0496112_0506051 3300048915 Bacteria 1143
301 Ga0496121_0016441 3300048924 Bacteria 7641
302 Ga0496121_0056860 3300048924 Bacteria 3246
303 Ga0496124_0178587 3300048927 Bacteria 1636
304 Ga0495682_0019643 3300049460 Bacteria 2540
305 Ga0501034_0395513 3300049571 Bacteria 1305
306 Ga0501047_0036881 3300049581 Bacteria 4725
307 Ga0501047_0473190 3300049581 Bacteria 1081
308 Ga0501067_0005388 3300049583 Bacteria 7104
309 Ga0501070_0023961 3300049586 Bacteria 5116
310 Ga0501073_0331699 3300049589 Bacteria 1050
311 Ga0501080_0058507 3300049742 Bacteria 3587
312 Ga0501044_0032010 3300049823 Bacteria 5529
313 Ga0501044_0262842 3300049823 Bacteria 1664
314 nmdc:mga03683_158398_c1 3300050489 Bacteria 1024
315 nmdc:mga07m45_118982_c1 3300050496 Bacteria 1525
316 nmdc:mga07m45_46291_c1 3300050496 Bacteria 2443
317 nmdc:mga05p37_196145_c1 3300050507 Bacteria 2448
318 nmdc:mga05p37_45907_c1 3300050507 Bacteria 5373
319 nmdc:mga09592_4368_c1 3300050508 Bacteria 11429
320 nmdc:mga0qj67_249712_c1 3300050509 Bacteria 1439
321 nmdc:mga06r32_108413_c1 3300050510 Bacteria 2730
322 nmdc:mga06r32_250813_c1 3300050510 Bacteria 1757
323 nmdc:mga06r32_758_c1 3300050510 Bacteria 28437
324 nmdc:mga08y16_234733_c1 3300050511 Bacteria 1897
325 nmdc:mga0n895_21098_c1 3300050512 Bacteria 6088
326 nmdc:mga0rr50_31597_c1 3300050513 Bacteria 3763
327 nmdc:mga0rr50_74501_c1 3300050513 Unclassified 2598
328 nmdc:mga0sz30_129_c1 3300050516 Bacteria 27866
329 nmdc:mga0sz30_37818_c1 3300050516 Bacteria 2021
330 Ga0495601_0022677 3300053077 Bacteria 3857
331 Ga0495612_0007977 3300053078 Bacteria 4315
332 Ga0495595_0001056 3300053084 Bacteria 10645
333 Ga0495595_0039943 3300053084 Bacteria 2143
334 Ga0495619_0016300 3300053085 Bacteria 4703
335 Ga0495619_0179150 3300053085 Bacteria 1466
336 Ga0500643_005467 3300053087 Bacteria 5474
337 Ga0500555_019886 3300053103 Bacteria 1934
338 Ga0500573_0187662 3300053140 Bacteria 1106
339 2513642876 2513237094 Bacteria 8789602
340 2793071553 2791355197 Bacteria 8420563
341 2793078083
342 2874627981 2874620515 Bacteria 8290088
343 2904674401 2904666416 Bacteria 8226587
344 2922364608 2922361189 Bacteria 7436256
345 2922389250 2922386360 Bacteria 7017218
346 2932795250 2932794094 Bacteria 7915132
347 2932805781 2932801729 Bacteria 7987968
348 2935883849 2935883170 Bacteria 7964738
349 2935961313 2935959822 Bacteria 7869783
350 2941531104 2941531003 Bacteria 7653939
351 3005600199 3005594810 Bacteria 8716512
352 8019649246 8019648815 Bacteria 10014479
353 Ga0495672_0000711
354 JGI24739J22299_10034625
355 JGI25153J46596_10007692
356 JGI25153J46596_10037497
357 rootH2_10004729
358 Ga0065712_10002464
359 Ga0065715_10166715
360 Ga0065707_10096137
361 Ga0070676_10023633
362 Ga0070683_100449658
363 Ga0070690_100215365
364 Ga0070677_10036567
365 Ga0068869_100057100
366 Ga0070666_10051730
367 Ga0070680_100106324
368 Ga0070680_100268307
369 Ga0070682_100239378
370 Ga0070689_100213620
371 Ga0070692_10023431
372 Ga0070668_100099107
373 Ga0070669_100058831
374 Ga0070675_100124446
375 Ga0070671_100006429
376 Ga0070671_100036659
377 Ga0070688_100069720
378 Ga0070667_100019528
379 Ga0070667_100028435
380 Ga0070709_10106032
381 Ga0070713_100048052
382 Ga0070710_10036895
383 Ga0070710_10320325
384 Ga0070705_100020788
385 Ga0070708_100033913
386 Ga0070663_100220494
387 Ga0070678_100183235
388 Ga0070662_100009294
389 Ga0070662_100046615
390 Ga0070681_10275764
391 Ga0068867_100001342
392 Ga0068867_100135239
393 Ga0070706_100031238
394 Ga0070706_100165381
395 Ga0070707_100087402
396 Ga0070707_100118550
397 Ga0070699_100062777
398 Ga0070699_100120263
399 Ga0070684_100103537
400 Ga0070697_100110138
401 Ga0070672_100081354
402 Ga0070672_100096929
403 Ga0070696_100118537
404 Ga0070665_100018185
405 Ga0070665_100020573
406 Ga0070665_100053271
407 Ga0070665_100101465
408 Ga0070665_100281021
409 Ga0068855_100009739
410 Ga0068855_100075379
411 Ga0068855_100416042
412 Ga0068857_100092797
413 Ga0068859_100005621
414 Ga0068859_100220719
415 Ga0068859_100488317
416 Ga0068861_100010745
417 Ga0068861_100139036
418 Ga0068870_10015988
419 Ga0068863_100023966
420 Ga0068863_100029480
421 Ga0068863_100054418
422 Ga0068858_100000418
423 Ga0068858_100050987
424 Ga0068858_100225128
425 Ga0068860_100010846
426 Ga0068860_100083196
427 Ga0068862_100004116
428 Ga0068862_100526214
429 Ga0081455_10000434
430 Ga0081455_10002295
431 Ga0081455_10004999
432 Ga0081455_10127524
433 Ga0081540_1005918
434 Ga0081539_10017911
435 Ga0081539_10056043
436 Ga0075363_100013281
437 Ga0070715_10077287
438 Ga0070716_100289079
439 Ga0070712_100079020
440 Ga0075367_10004414
441 Ga0075369_10013006
442 Ga0075369_10021041
443 Ga0097621_100060797
444 Ga0097621_100287133
445 Ga0075370_10043835
446 Ga0075370_10170746
447 Ga0068871_100217433
448 Ga0075428_100127965
449 Ga0075428_100131364
450 Ga0075430_100320126
451 Ga0075431_100003256
452 Ga0075431_100199995
453 Ga0075433_10055526
454 Ga0075434_100042866
455 Ga0075429_100004996
456 Ga0075429_100183471
457 Ga0068865_100012595
458 Ga0097620_100005621
459 Ga0097620_100220735
460 Ga0097620_100488268
461 Ga0075435_100056312
462 Ga0075435_100236796
463 Ga0105250_10022957
464 Ga0105240_10000791
465 Ga0105240_10014121
466 Ga0105240_10024268
467 Ga0105240_10060978
468 Ga0105240_10101960
469 Ga0105240_10424973
470 Ga0111539_10089054
471 Ga0105245_10532100
472 Ga0105247_10000267
473 Ga0105247_10035756
474 Ga0105247_10047407
475 Ga0114129_10035953
476 Ga0114129_10149339
477 Ga0105243_10174409
478 Ga0105241_10072889
479 Ga0105242_10035920
480 Ga0105248_10004759
481 Ga0105248_10127849
482 Ga0105248_10550026
483 Ga0105237_10010871
484 Ga0105237_10018638
485 Ga0105237_10032131
486 Ga0105237_10173134
487 Ga0105238_10145163
488 Ga0105238_10191968
489 Ga0105238_10194036
490 Ga0105249_10013334
491 Ga0105249_10034605
492 Ga0105249_10088647
493 Ga0105249_10105435
494 Ga0105249_10220334
495 Ga0105239_10009616
496 Ga0105239_10048675
497 Ga0157370_10431036
498 Ga0157370_10435575
499 Ga0157369_10003899
500 Ga0157369_10004157
501 Ga0157369_10012431
502 Ga0157369_10189910
503 Ga0157378_10093373
504 Ga0157378_10552597
505 Ga0163162_10104450
506 Ga0163162_10214576
507 Ga0157375_10852712
508 Ga0163163_10362245
509 Ga0157376_10513858
510 Ga0157376_10554860
511 Ga0157376_10610663
512 Ga0163161_10034361
513 Ga0213874_10022504
514 Ga0213875_10012444
515 Ga0213871_10000086
516 Ga0224712_10029546
517 Ga0224712_10042267
518 Ga0207666_1004930
519 Ga0209758_1004237
520 Ga0209758_1005401
521 Ga0207692_10019951
522 Ga0207710_10001263
523 Ga0207710_10066483
524 Ga0207680_10024282
525 Ga0207680_10096192
526 Ga0207685_10046728
527 Ga0207699_10075086
528 Ga0207699_10215667
529 Ga0207645_10093114
530 Ga0207645_10276801
531 Ga0207643_10011308
532 Ga0207643_10039683
533 Ga0207684_10017580
534 Ga0207684_10433301
535 Ga0207654_10060918
536 Ga0207654_10108137
537 Ga0207707_10233617
538 Ga0207695_10062564
539 Ga0207695_10333939
540 Ga0207695_10370963
541 Ga0207671_10032087
542 Ga0207671_10115449
543 Ga0207671_10178906
544 Ga0207693_10043858
545 Ga0207693_10109290
546 Ga0207663_10145606
547 Ga0207660_10095586
548 Ga0207652_10143254
549 Ga0207646_10019153
550 Ga0207681_10019125
551 Ga0207694_10170943
552 Ga0207659_10285326
553 Ga0207644_10012632
554 Ga0207706_10009570
555 Ga0207706_10057819
556 Ga0207686_10012428
557 Ga0207709_10223721
558 Ga0207704_10075430
559 Ga0207665_10093124
560 Ga0207691_10050463
561 Ga0207691_10122252
562 Ga0207711_10002066
563 Ga0207711_10200052
564 Ga0207689_10089173
565 Ga0207689_10243961
566 Ga0207667_10020968
567 Ga0207667_10071838
568 Ga0207667_10352974
569 Ga0207712_10056552
570 Ga0207712_10163357
571 Ga0207668_10044363
572 Ga0207658_10017254
573 Ga0207703_10000655
574 Ga0207703_10008627
575 Ga0207703_10012308
576 Ga0207703_10133843
577 Ga0207639_10047569
578 Ga0207639_10327940
579 Ga0207708_10323276
580 Ga0207641_10000211
581 Ga0207641_10131650
582 Ga0207648_10003292
583 Ga0207674_10109043
584 Ga0207674_10195983
585 Ga0207675_100000676
586 Ga0207675_100169728
587 Ga0268266_10010346
588 Ga0268266_10043545
589 Ga0268266_10089889
590 Ga0268264_10000047
591 Ga0268264_10231992
592 Ga0307509_10000021
593 Ga0307408_100021980
594 Ga0316579_10058842
595 Ga0265314_10000036
596 Ga0316576_10013726
597 Ga0316578_10055482
598 Ga0373943_0098115
599 Ga0373955_0020317
600 Ga0316574_0038462
601 Ga0373924_0028486
602 Ga0373935_0149742
603 Ga0373937_0000312
604 Ga0316584_0011259
605 Ga0395900_0117033
606 Ga0395898_0006673
607 Ga0395905_0000103
608 Ga0436364_1027785
609 Ga0395901_0140907
610 Ga0242420_003292
611 Ga0436365_0700631
612 Ga0436360_0838913
613 Ga0436361_1022077
614 Ga0436363_1641448
615 Ga0466968_0142798
616 Ga0466959_0011153
617 Ga0495627_035159
618 Ga0495651_0305121
619 Ga0495664_0003052
620 Ga0495583_0140147
621 Ga0495606_0048684
622 Ga0495608_0008959
623 Ga0495631_0003882
624 Ga0495643_0003607
625 Ga0495648_0051536
626 Ga0495587_0053289
627 Ga0495645_0001100
628 Ga0495633_0000298
629 Ga0495667_0017860
630 Ga0495611_0173635
631 Ga0495625_0084681
632 Ga0495625_0146077
633 Ga0495635_0011116
634 Ga0495599_0097709
635 Ga0495623_0034250
636 Ga0495646_0012732
637 Ga0495670_0005523
638 Ga0495649_0065248
639 Ga0495674_0014832
640 Ga0495674_0084474
641 Ga0495687_000424
642 Ga0495675_0032773
643 Ga0495675_0261837
644 Ga0495681_0014060
645 Ga0495684_0123116
646 Ga0495602_0000195
647 Ga0496102_0313973
648 Ga0496104_0073060
649 Ga0496109_0030032
650 Ga0496110_0175727
651 Ga0496112_0174150
652 Ga0496112_0506051
653 Ga0496121_0016441
654 Ga0496121_0056860
655 Ga0496124_0178587
656 Ga0495682_0019643
657 Ga0501034_0395513
658 Ga0501047_0036881
659 Ga0501047_0473190
660 Ga0501067_0005388
661 Ga0501070_0023961
662 Ga0501073_0331699
663 Ga0501080_0058507
664 Ga0501044_0032010
665 Ga0501044_0262842
666 nmdc:mga03683_158398_c1
667 nmdc:mga07m45_118982_c1
668 nmdc:mga07m45_46291_c1
669 nmdc:mga05p37_196145_c1
670 nmdc:mga05p37_45907_c1
671 nmdc:mga09592_4368_c1
672 nmdc:mga0qj67_249712_c1
673 nmdc:mga06r32_108413_c1
674 nmdc:mga06r32_250813_c1
675 nmdc:mga06r32_758_c1
676 nmdc:mga08y16_234733_c1
677 nmdc:mga0n895_21098_c1
678 nmdc:mga0rr50_31597_c1
679 nmdc:mga0rr50_74501_c1
680 nmdc:mga0sz30_129_c1
681 nmdc:mga0sz30_37818_c1
682 Ga0495601_0022677
683 Ga0495612_0007977
684 Ga0495595_0001056
685 Ga0495595_0039943
686 Ga0495619_0016300
687 Ga0495619_0179150
688 Ga0500643_005467
689 Ga0500555_019886
690 Ga0500573_0187662
691 2513642876
692 2793071553
693 2793078083
694 2874627981
695 2904674401
696 2922364608
697 2922389250
698 2932795250
699 2932805781
700 2935883849
701 2935961313
702 2941531104
703 3005600199
704 8019649246

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

91

215

0.95

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

93

340

0.6

Structural Annotation

Top 5 Hits

ID Description Score Start End
4h7e-assembly1.cif.gz_A crystal structure of haloalkane dehalogenase linb v112a mutant from sphingobium sp. mi1205 0.9679 14 293
4h7f-assembly1.cif.gz_A crystal structure of haloalkane dehalogenase linb v134i mutant from sphingobium sp. mi1205 0.9679 14 293
4h7i-assembly1.cif.gz_A crystal structure of haloalkane dehalogenase linb l138i mutant from sphingobium sp. mi1205 0.9676 14 293
7nfz-assembly1.cif.gz_A crystal structure of haloalkane dehalogenase linb57 mutant (h272f) from sphingobium japonicum ut26 0.9672 14 293
8b5o-assembly2.cif.gz_B structure of haloalkane dehalogenase dmmara from mycobacterium marinum at ph 5.5 0.9667 15 293
ID Description Score Start End Superfamily
4brzA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9663 12 291 3.40.50.1820
2psfB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9476 12 295 3.40.50.1820
3wibA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9376 14 290 3.40.50.1820
3a2nA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9362 15 294 3.40.50.1820
4brzA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9305 12 291 3.40.50.1820
ID Description Score Start End GO Terms
AF-M5EIG4-F1-model_v4 Haloalkane dehalogenase (EC 3.8.1.5) 0.9711 27 289 GO:0018786
AF-A0A7C7XV96-F1-model_v4 Haloalkane dehalogenase (EC 3.8.1.5) 0.9689 14 292 GO:0018786
AF-A0A0P1I5N0-F1-model_v4 Haloalkane dehalogenase (EC 3.8.1.5) 0.9673 14 292 GO:0018786
AF-X8F1Q6-F1-model_v4 deleted 0.9671 15 296
AF-A0A2D5N3Z1-F1-model_v4 deleted 0.9659 14 290

Map