F419148

General Info

Members Datasets Scaffolds Average Seq Length
352 236 704 266

Family's Representative Sequence

Representative Sequence 3300046679|Ga0495623_0011426|Ga0495623_0011426_276_1403
Length 303
Sequence VDTTENADFVDRGPEAANGTAPNAPRATPSDGEQDGAETSPESALRRPYGVPRTAAFFDLDKTIIAKSSALAFSRPFYQGGLINRRAVLKSAYAQFVFLIGGADHDQMEKMRQYLSALTRGWNVQQVREIVSETLHELIDPIIYDEAASLIEQHGSEVVEPIGRLLGADHVIATRLEVAEGRYTGEIEYYAYAENKAAAIRDLAAVEGYNLADCYAYSDSSTDLPLLEAVGHPSAVNPDRALRKEAAAREWPVLVFSRPVELRRRLPEFSTPSRSVLLAVALGTAAVTAGLLWYTARRRRPAS

Samples

Sample ID Description Type Environment
1 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
38 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
42 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
60 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
91 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
94 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
95 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
96 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
97 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
98 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
99 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
100 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
101 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
102 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
103 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
104 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
105 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
106 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
107 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
108 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
109 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
110 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
111 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
112 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
113 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
114 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
115 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
116 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
117 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
118 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
119 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
120 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
121 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
122 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
123 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
124 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
125 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
126 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
127 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
128 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
129 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
130 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
131 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
132 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
133 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
134 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
135 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
136 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
137 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
138 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
139 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
140 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
141 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
142 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
143 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
144 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
145 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
146 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
147 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
148 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
149 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
150 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
151 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
152 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
153 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
154 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
155 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
156 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
157 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
158 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
159 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
160 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
161 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
162 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
163 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
164 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
165 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
166 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
167 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
168 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
169 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
170 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
171 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
172 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
173 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
174 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
175 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
184 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
185 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
186 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
187 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
188 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
189 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
190 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
191 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
192 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
193 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
194 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
195 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
196 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
197 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
198 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
199 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
200 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
201 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
202 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
203 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
204 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
205 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
206 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
207 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
208 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
209 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
210 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
211 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
212 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
213 2643221561 Nocardioides sp. Root151 Isolate Unclassified
214 2643221576 Nocardioides sp. Root614 Isolate Unclassified
215 2643221590 Nocardioides sp. Root682 Isolate Unclassified
216 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
217 2643221604 Nocardioides sp. Root190 Isolate Unclassified
218 2643221615 Nocardioides sp. Root224 Isolate Unclassified
219 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
220 2643221641 Nocardioides sp. Root122 Isolate Unclassified
221 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
222 2643221696 Nocardioides sp. Root140 Isolate Unclassified
223 2738541305 Nocardioides sp. CF167 Isolate Unclassified
224 2739367898 Nocardioides sp. CF479 Isolate Unclassified
225 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
226 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
227 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
228 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
229 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
230 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
231 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
232 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
233 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
234 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
235 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
236 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.61
Metatranscriptomes 0.57
Isolates 6.82

Biome Distribution

Category Percentage (%)
Aerial Root 0.57
Bulb 0
Endosphere 9.38
Nodule 0.28
Rhizoplane 5.97
Rhizosphere 76.42
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495623_0011426 3300046679 Bacteria 5746
2 JGI24739J22299_10008443 3300001989 Bacteria 3847
3 JGI24743J22301_10001721 3300001991 Bacteria 3129
4 JGI24738J21930_10003461 3300002075 Bacteria 3976
5 JGI24034J26672_10028518 3300002239 Bacteria 901
6 Ga0006562J51391_1069685 3300003578 Bacteria 2045
7 Ga0070683_100115838 3300005329 Bacteria 2530
8 Ga0070683_100232008 3300005329 Bacteria 1755
9 Ga0070683_100257374 3300005329 Bacteria 1660
10 Ga0068869_100336253 3300005334 Bacteria 1228
11 Ga0070682_100011982 3300005337 Bacteria 4961
12 Ga0068868_100107407 3300005338 Bacteria 2265
13 Ga0068868_100240905 3300005338 Bacteria 1519
14 Ga0070660_100005155 3300005339 Bacteria 9034
15 Ga0070687_100007759 3300005343 Bacteria 4500
16 Ga0070692_10004012 3300005345 Bacteria 6083
17 Ga0070675_100119253 3300005354 Bacteria 2241
18 Ga0070674_100007449 3300005356 Bacteria 6457
19 Ga0070673_100043171 3300005364 Bacteria 3482
20 Ga0070688_100237622 3300005365 Bacteria 1292
21 Ga0070659_100015401 3300005366 Bacteria 5726
22 Ga0070659_100031671 3300005366 Bacteria 4097
23 Ga0070714_100002663 3300005435 Bacteria 13159
24 Ga0070701_10010768 3300005438 Bacteria 4058
25 Ga0070663_100048599 3300005455 Bacteria 3009
26 Ga0070663_100115615 3300005455 Bacteria 2021
27 Ga0068867_100001838 3300005459 Bacteria 14779
28 Ga0070684_100012895 3300005535 Bacteria 6718
29 Ga0070684_100156852 3300005535 Bacteria 2064
30 Ga0070684_100208145 3300005535 Bacteria 1783
31 Ga0070672_100039403 3300005543 Bacteria 3619
32 Ga0070686_100003505 3300005544 Bacteria 8605
33 Ga0070693_100285667 3300005547 Bacteria 1107
34 Ga0068855_100039056 3300005563 Bacteria 5636
35 Ga0070664_100017541 3300005564 Bacteria 5879
36 Ga0070664_100210610 3300005564 Bacteria 1737
37 Ga0070664_100578666 3300005564 Bacteria 1040
38 Ga0068857_100268352 3300005577 Bacteria 1568
39 Ga0068854_100005531 3300005578 Bacteria 7983
40 Ga0068854_100109510 3300005578 Bacteria 2081
41 Ga0068856_100095554 3300005614 Bacteria 2960
42 Ga0070702_100004252 3300005615 Bacteria 6526
43 Ga0068852_100010173 3300005616 Bacteria 7009
44 Ga0068866_10002831 3300005718 Bacteria 7150
45 Ga0068870_10000219 3300005840 Bacteria 20787
46 Ga0081539_10005077 3300005985 Bacteria 13797
47 Ga0081539_10077507 3300005985 Bacteria 1757
48 Ga0075365_10082972 3300006038 Bacteria 2174
49 Ga0075365_10154086 3300006038 Bacteria 1599
50 Ga0075365_10225421 3300006038 Bacteria 1315
51 Ga0075368_10006697 3300006042 Bacteria 4042
52 Ga0075364_10043706 3300006051 Bacteria 2913
53 Ga0075364_10197379 3300006051 Bacteria 1364
54 Ga0075364_10245276 3300006051 Bacteria 1217
55 Ga0075364_10311470 3300006051 Bacteria 1072
56 Ga0070712_100317951 3300006175 Bacteria 1265
57 Ga0075367_10033142 3300006178 Bacteria 2976
58 Ga0075370_10003129 3300006353 Bacteria 7814
59 Ga0075370_10073689 3300006353 Bacteria 1956
60 Ga0075370_10155129 3300006353 Bacteria 1342
61 Ga0075431_100135946 3300006847 Bacteria 2534
62 Ga0075429_100089012 3300006880 Bacteria 2691
63 Ga0075429_100384385 3300006880 Bacteria 1229
64 Ga0068865_100003129 3300006881 Bacteria 9900
65 Ga0111539_10020538 3300009094 Bacteria 8134
66 Ga0111539_10424516 3300009094 Bacteria 1548
67 Ga0105245_10011921 3300009098 Bacteria 7558
68 Ga0114129_10115120 3300009147 Bacteria 3707
69 Ga0114129_10823165 3300009147 Bacteria 1182
70 Ga0105243_10003325 3300009148 Bacteria 13051
71 Ga0105243_10616675 3300009148 Bacteria 1047
72 Ga0105242_10138919 3300009176 Bacteria 2106
73 Ga0105248_10020984 3300009177 Bacteria 7238
74 Ga0105237_10078109 3300009545 Bacteria 3300
75 Ga0105249_10061436 3300009553 Bacteria 3448
76 Ga0105239_10033867 3300010375 Bacteria 5607
77 Ga0105239_10061481 3300010375 Bacteria 4122
78 Ga0105239_10120420 3300010375 Bacteria 2914
79 Ga0105239_10523764 3300010375 Bacteria 1349
80 Ga0105239_10560096 3300010375 Bacteria 1302
81 Ga0105246_10175175 3300011119 Bacteria 1646
82 Ga0157375_10075952 3300013308 Bacteria 3385
83 Ga0157375_10081187 3300013308 Bacteria 3282
84 Ga0163163_10059610 3300014325 Bacteria 3776
85 Ga0157380_10001064 3300014326 Bacteria 17602
86 Ga0157377_10057149 3300014745 Bacteria 2218
87 Ga0206353_11859848 3300020082 Bacteria 1770
88 Ga0207642_10005544 3300025899 Bacteria 4125
89 Ga0207688_10024441 3300025901 Bacteria 3313
90 Ga0207643_10000396 3300025908 Bacteria 29067
91 Ga0207671_10082510 3300025914 Bacteria 2412
92 Ga0207662_10125315 3300025918 Bacteria 1615
93 Ga0207657_10014474 3300025919 Bacteria 7699
94 Ga0207659_10095893 3300025926 Bacteria 2226
95 Ga0207687_10128853 3300025927 Bacteria 1904
96 Ga0207664_10019982 3300025929 Bacteria 4958
97 Ga0207690_10010916 3300025932 Bacteria 5415
98 Ga0207690_10042199 3300025932 Bacteria 2994
99 Ga0207690_10058005 3300025932 Bacteria 2617
100 Ga0207690_10504679 3300025932 Bacteria 979
101 Ga0207686_10045956 3300025934 Bacteria 2690
102 Ga0207709_10005448 3300025935 Bacteria 7231
103 Ga0207669_10003452 3300025937 Bacteria 6832
104 Ga0207704_10033392 3300025938 Bacteria 2925
105 Ga0207691_10002503 3300025940 Bacteria 17973
106 Ga0207711_10018255 3300025941 Bacteria 5830
107 Ga0207689_10112955 3300025942 Bacteria 2233
108 Ga0207661_10005020 3300025944 Bacteria 9278
109 Ga0207661_10099595 3300025944 Bacteria 2438
110 Ga0207661_10123654 3300025944 Bacteria 2207
111 Ga0207679_10082496 3300025945 Bacteria 2461
112 Ga0207679_10141466 3300025945 Bacteria 1945
113 Ga0207667_10120150 3300025949 Bacteria 2708
114 Ga0207677_10064591 3300026023 Bacteria 2550
115 Ga0207639_10022113 3300026041 Bacteria 4578
116 Ga0207678_10059992 3300026067 Bacteria 3272
117 Ga0207708_10000152 3300026075 Bacteria 55641
118 Ga0207702_10076139 3300026078 Bacteria 2900
119 Ga0207648_10050048 3300026089 Bacteria 3654
120 Ga0207675_100007904 3300026118 Bacteria 10027
121 Ga0207675_100068597 3300026118 Bacteria 3314
122 Ga0207683_10046216 3300026121 Bacteria 3809
123 Ga0207683_10201363 3300026121 Bacteria 1810
124 Ga0207698_10006704 3300026142 Bacteria 7195
125 Ga0209813_10022174 3300027866 Bacteria 1793
126 Ga0209813_10070251 3300027866 Bacteria 1137
127 Ga0268265_10051333 3300028380 Bacteria 3113
128 Ga0268264_10172686 3300028381 Bacteria 1956
129 Ga0307513_10119301 3300031456 Bacteria 2610
130 Ga0307408_100104315 3300031548 Bacteria 2166
131 Ga0307408_100305734 3300031548 Bacteria 1334
132 Ga0316576_10131905 3300031727 Bacteria 1880
133 Ga0316578_10004161 3300031728 Bacteria 6777
134 Ga0307413_10164391 3300031824 Bacteria 1563
135 Ga0307410_10180403 3300031852 Bacteria 1598
136 Ga0307410_10231106 3300031852 Bacteria 1428
137 Ga0307410_10248271 3300031852 Bacteria 1382
138 Ga0307407_10167411 3300031903 Bacteria 1444
139 Ga0307412_10097798 3300031911 Bacteria 2069
140 Ga0307409_100013531 3300031995 Bacteria 5257
141 Ga0307409_100024086 3300031995 Bacteria 4237
142 Ga0307409_100069579 3300031995 Bacteria 2789
143 Ga0307409_100162219 3300031995 Bacteria 1956
144 Ga0307409_100192638 3300031995 Bacteria 1816
145 Ga0307409_100264724 3300031995 Bacteria 1580
146 Ga0307416_100011595 3300032002 Bacteria 5889
147 Ga0307416_100112287 3300032002 Bacteria 2405
148 Ga0307416_100620049 3300032002 Bacteria 1163
149 Ga0307416_100666663 3300032002 Bacteria 1126
150 Ga0307414_10392522 3300032004 Bacteria 1203
151 Ga0307414_10432764 3300032004 Bacteria 1150
152 Ga0307411_10022910 3300032005 Bacteria 3688
153 Ga0307411_10062161 3300032005 Bacteria 2490
154 Ga0307411_10069159 3300032005 Bacteria 2383
155 Ga0307411_10315330 3300032005 Bacteria 1260
156 Ga0307415_100071544 3300032126 Bacteria 2439
157 Ga0307415_100236232 3300032126 Bacteria 1475
158 Ga0307415_100303058 3300032126 Bacteria 1324
159 Ga0373931_0106123 3300035691 Bacteria 1587
160 Ga0395899_0091490 3300037312 Bacteria 2204
161 Ga0395900_0088255 3300037418 Bacteria 3188
162 Ga0395900_0188951 3300037418 Bacteria 2090
163 Ga0395900_0397354 3300037418 Bacteria 1343
164 Ga0395898_0103034 3300037466 Bacteria 2739
165 Ga0395898_0240542 3300037466 Bacteria 1726
166 Ga0395905_0111641 3300037471 Bacteria 2567
167 Ga0436364_1206354 3300037853 Bacteria 2937
168 Ga0395901_0109063 3300038443 Bacteria 2906
169 Ga0395901_0144673 3300038443 Bacteria 2499
170 Ga0395901_0194224 3300038443 Bacteria 2128
171 Ga0395901_0574011 3300038443 Bacteria 1140
172 Ga0439438_021842 3300041405 Bacteria 1781
173 Ga0439461_0007296 3300041410 Bacteria 1953
174 Ga0439465_0022568 3300041413 Bacteria 1978
175 Ga0451833_0342194 3300041491 Bacteria 9391
176 Ga0451851_0076853 3300041507 Bacteria 1054
177 Ga0451853_1897932 3300041512 Bacteria 1395
178 Ga0439448_0048027 3300042005 Bacteria 1393
179 Ga0450907_002633 3300042146 Bacteria 3357
180 Ga0439446_0055977 3300042156 Bacteria 1184
181 Ga0439434_0008134 3300042435 Bacteria 3075
182 Ga0466969_0010172 3300044656 Bacteria 4989
183 Ga0466969_0064971 3300044656 Bacteria 1765
184 Ga0466972_0091395 3300044658 Bacteria 1443
185 Ga0466972_0117274 3300044658 Bacteria 1256
186 Ga0466965_0003961 3300044683 Bacteria 6561
187 Ga0466965_0015462 3300044683 Bacteria 3626
188 Ga0466966_0109511 3300044684 Bacteria 1703
189 Ga0466966_0278188 3300044684 Bacteria 1007
190 Ga0466961_0010525 3300044693 Bacteria 5899
191 Ga0466961_0088787 3300044693 Bacteria 1953
192 Ga0466961_0125252 3300044693 Bacteria 1612
193 Ga0466963_0135665 3300044694 Bacteria 1702
194 Ga0466964_0007593 3300044706 Bacteria 4057
195 Ga0466964_0095918 3300044706 Bacteria 1299
196 Ga0466971_0030210 3300044719 Bacteria 2425
197 Ga0466971_0051857 3300044719 Bacteria 1847
198 Ga0466971_0078116 3300044719 Bacteria 1508
199 Ga0466971_0090828 3300044719 Bacteria 1398
200 Ga0466970_0009408 3300044765 Bacteria 4939
201 Ga0466970_0179311 3300044765 Bacteria 1175
202 Ga0466970_0192474 3300044765 Bacteria 1133
203 Ga0466970_0251968 3300044765 Bacteria 989
204 Ga0466957_0045753 3300044842 Bacteria 2654
205 Ga0466957_0147822 3300044842 Bacteria 1518
206 Ga0466960_0009135 3300044901 Bacteria 4080
207 Ga0466960_0018576 3300044901 Bacteria 3050
208 Ga0466960_0073572 3300044901 Bacteria 1706
209 Ga0466960_0114473 3300044901 Bacteria 1405
210 Ga0466960_0129451 3300044901 Bacteria 1330
211 Ga0466959_0003826 3300045049 Bacteria 9982
212 Ga0466959_0094685 3300045049 Bacteria 2142
213 Ga0466958_0089678 3300045836 Bacteria 1901
214 Ga0466967_0046364 3300045976 Bacteria 3784
215 Ga0466967_0074150 3300045976 Bacteria 3055
216 Ga0466967_0086724 3300045976 Bacteria 2837
217 Ga0466967_0105587 3300045976 Bacteria 2580
218 Ga0466967_0110426 3300045976 Bacteria 2526
219 Ga0466967_0198248 3300045976 Bacteria 1900
220 Ga0466967_0237691 3300045976 Bacteria 1736
221 Ga0495592_0012734 3300046454 Bacteria 6394
222 Ga0495651_0000759 3300046462 Bacteria 24956
223 Ga0495653_0015571 3300046463 Bacteria 6198
224 Ga0495662_0002730 3300046476 Bacteria 8922
225 Ga0495664_0050034 3300046477 Bacteria 2480
226 Ga0495608_0000457 3300046511 Bacteria 28465
227 Ga0495608_0127161 3300046511 Bacteria 1632
228 Ga0495630_0033673 3300046517 Bacteria 3821
229 Ga0495652_0005775 3300046529 Bacteria 11585
230 Ga0495665_0004085 3300046531 Bacteria 7869
231 Ga0495640_0029843 3300046533 Bacteria 3908
232 Ga0495586_0028547 3300046535 Bacteria 2985
233 Ga0495587_0000690 3300046536 Bacteria 22646
234 Ga0495645_0027811 3300046543 Bacteria 4108
235 Ga0495667_0000576 3300046559 Bacteria 23444
236 Ga0495634_0026342 3300046642 Bacteria 4058
237 Ga0495588_0118849 3300046674 Bacteria 1393
238 Ga0495657_0000753 3300046675 Bacteria 28805
239 Ga0495623_0000839 3300046679 Bacteria 20792
240 Ga0495646_0001826 3300046680 Bacteria 12794
241 Ga0495613_0003486 3300046689 Bacteria 11771
242 Ga0495600_0000470 3300046809 Bacteria 20967
243 Ga0495581_0073668 3300047315 Bacteria 1976
244 Ga0495604_0000885 3300047317 Bacteria 24895
245 Ga0495604_0000889 3300047317 Bacteria 24869
246 Ga0495675_0003048 3300047444 Bacteria 10077
247 Ga0495675_0011957 3300047444 Bacteria 5455
248 Ga0495684_0012671 3300047471 Bacteria 6506
249 Ga0495602_0001475 3300048088 Bacteria 23381
250 Ga0496101_0045629 3300048904 Bacteria 3140
251 Ga0496101_0273108 3300048904 Bacteria 1320
252 Ga0496102_0014832 3300048905 Bacteria 6778
253 Ga0496102_0140896 3300048905 Bacteria 2261
254 Ga0496102_0443451 3300048905 Bacteria 1218
255 Ga0496104_0423559 3300048907 Bacteria 1243
256 Ga0496106_0080828 3300048909 Bacteria 2496
257 Ga0496108_0394651 3300048911 Bacteria 1208
258 Ga0496109_0049557 3300048912 Bacteria 3823
259 Ga0496109_0145980 3300048912 Bacteria 2213
260 Ga0496110_0051020 3300048913 Bacteria 3635
261 Ga0496110_0612283 3300048913 Bacteria 987
262 Ga0496111_0216341 3300048914 Bacteria 1423
263 Ga0496111_0243900 3300048914 Bacteria 1334
264 Ga0496112_0223803 3300048915 Bacteria 1837
265 Ga0496113_0396877 3300048916 Bacteria 1107
266 Ga0496114_0084959 3300048917 Bacteria 2680
267 Ga0496114_0150413 3300048917 Bacteria 2019
268 Ga0496114_0324455 3300048917 Bacteria 1361
269 Ga0496114_0471913 3300048917 Bacteria 1110
270 Ga0496115_0133659 3300048918 Bacteria 2045
271 Ga0496124_0340292 3300048927 Bacteria 1066
272 Ga0501033_0000584 3300049570 Bacteria 33796
273 Ga0501034_0644362 3300049571 Bacteria 962
274 Ga0501036_0127811 3300049572 Bacteria 2146
275 Ga0501039_0210246 3300049575 Bacteria 1530
276 Ga0501042_0022765 3300049578 Bacteria 4379
277 Ga0501043_0038180 3300049579 Bacteria 3776
278 Ga0501046_0000356 3300049580 Bacteria 46124
279 Ga0501047_0258293 3300049581 Bacteria 1590
280 Ga0501067_0086764 3300049583 Bacteria 1736
281 Ga0501067_0086772 3300049583 Bacteria 1736
282 Ga0501069_0006307 3300049585 Bacteria 6199
283 Ga0501069_0059903 3300049585 Bacteria 2125
284 Ga0501069_0081254 3300049585 Bacteria 1826
285 Ga0501069_0283856 3300049585 Bacteria 969
286 Ga0501071_0109719 3300049587 Bacteria 2039
287 Ga0501072_0052913 3300049588 Bacteria 3197
288 Ga0501072_0582953 3300049588 Bacteria 882
289 Ga0501073_0158514 3300049589 Bacteria 1568
290 Ga0501074_0131839 3300049590 Bacteria 1788
291 Ga0501075_0047375 3300049591 Bacteria 3231
292 Ga0501076_0171680 3300049592 Bacteria 1767
293 Ga0501079_0385979 3300049741 Bacteria 1098
294 Ga0501080_0202676 3300049742 Bacteria 1821
295 Ga0501080_0479320 3300049742 Bacteria 1113
296 Ga0501081_0083915 3300049743 Bacteria 2234
297 Ga0501081_0183963 3300049743 Bacteria 1512
298 Ga0501045_0025474 3300049824 Bacteria 4253
299 Ga0501045_0077103 3300049824 Bacteria 2456
300 Ga0501045_0146655 3300049824 Bacteria 1755
301 nmdc:mga03n38_146648_c1 3300050490 Bacteria 1184
302 nmdc:mga00v17_13649_c1 3300050491 Bacteria 4515
303 nmdc:mga00v17_14860_c1 3300050491 Bacteria 4355
304 nmdc:mga00v17_24599_c1 3300050491 Bacteria 3494
305 nmdc:mga00v17_285298_c1 3300050491 Bacteria 1072
306 nmdc:mga0yw44_199540_c1 3300050492 Bacteria 1321
307 nmdc:mga0yw44_266460_c1 3300050492 Bacteria 1143
308 nmdc:mga0yw44_6423_c1 3300050492 Bacteria 5679
309 nmdc:mga0yw44_9672_c1 3300050492 Bacteria 4893
310 nmdc:mga06z11_87363_c1 3300050494 Bacteria 1686
311 nmdc:mga04h51_9300_c1 3300050495 Bacteria 2658
312 nmdc:mga07m45_104378_c1 3300050496 Bacteria 1629
313 nmdc:mga07m45_5532_c1 3300050496 Bacteria 6300
314 nmdc:mga06r32_224856_c1 3300050510 Bacteria 1865
315 nmdc:mga08y16_227896_c1 3300050511 Bacteria 1928
316 nmdc:mga0sz30_25588_c1 3300050516 Bacteria 2413
317 Ga0500644_0000181 3300053088 Bacteria 40245
318 Ga0500556_0002354 3300053104 Bacteria 6142
319 Ga0500593_003079 3300053117 Bacteria 6237
320 Ga0500573_0002003 3300053140 Bacteria 9984
321 Ga0500616_0001905 3300053153 Bacteria 18682
322 Ga0501084_0170043 3300054114 Bacteria 1840
323 Ga0501084_0196320 3300054114 Bacteria 1703
324 Ga0590075_011206 3300059424 Bacteria 2165
325 Ga0466962_0013357 3300061719 Bacteria 3953
326 Ga0466962_0030290 3300061719 Bacteria 2591
327 Ga0466962_0086600 3300061719 Bacteria 1500
328 Ga0530510_0143158 3300061734 Bacteria 1762
329 2643824848 2643221561 Bacteria 4984412
330 2643892595 2643221576 Bacteria 5214352
331 2643962044 2643221590 Bacteria 5214697
332 2644014886 2643221601 Bacteria 7493239
333 2644034789 2643221604 Bacteria 5014917
334 2644093280 2643221615 Bacteria 5487866
335 2644176321 2643221631 Bacteria 8168043
336 2644232145 2643221641 Bacteria 4490190
337 2644322891 2643221657 Bacteria 5490246
338 2644532601 2643221696 Bacteria 5431823
339 2738871984 2738541305 Bacteria 4910150
340 2740168494 2739367898 Bacteria 4367674
341 2812329973 2811994874 Bacteria 5367947
342 2816422805 2816332119 Bacteria 8120218
343 2855390089 2855386786 Bacteria 4752232
344 2862710645 2862705112 Bacteria 6563286
345 2984578685 2984576629 Bacteria 4248407
346 2990045503 2990044586 Bacteria 6603797
347 2990260705 2990256926 Bacteria 4252839
348 2995471400 2995463766 Bacteria 8577691
349 8008485758 8008485437 Bacteria 7198341
350 8025524842 8025524527 Bacteria 7197316
351 8033689676 8033684223 Bacteria 6906479
352 8054614144 8054609563 Bacteria 5170090
353 Ga0495623_0011426
354 JGI24739J22299_10008443
355 JGI24743J22301_10001721
356 JGI24738J21930_10003461
357 JGI24034J26672_10028518
358 Ga0006562J51391_1069685
359 Ga0070683_100115838
360 Ga0070683_100232008
361 Ga0070683_100257374
362 Ga0068869_100336253
363 Ga0070682_100011982
364 Ga0068868_100107407
365 Ga0068868_100240905
366 Ga0070660_100005155
367 Ga0070687_100007759
368 Ga0070692_10004012
369 Ga0070675_100119253
370 Ga0070674_100007449
371 Ga0070673_100043171
372 Ga0070688_100237622
373 Ga0070659_100015401
374 Ga0070659_100031671
375 Ga0070714_100002663
376 Ga0070701_10010768
377 Ga0070663_100048599
378 Ga0070663_100115615
379 Ga0068867_100001838
380 Ga0070684_100012895
381 Ga0070684_100156852
382 Ga0070684_100208145
383 Ga0070672_100039403
384 Ga0070686_100003505
385 Ga0070693_100285667
386 Ga0068855_100039056
387 Ga0070664_100017541
388 Ga0070664_100210610
389 Ga0070664_100578666
390 Ga0068857_100268352
391 Ga0068854_100005531
392 Ga0068854_100109510
393 Ga0068856_100095554
394 Ga0070702_100004252
395 Ga0068852_100010173
396 Ga0068866_10002831
397 Ga0068870_10000219
398 Ga0081539_10005077
399 Ga0081539_10077507
400 Ga0075365_10082972
401 Ga0075365_10154086
402 Ga0075365_10225421
403 Ga0075368_10006697
404 Ga0075364_10043706
405 Ga0075364_10197379
406 Ga0075364_10245276
407 Ga0075364_10311470
408 Ga0070712_100317951
409 Ga0075367_10033142
410 Ga0075370_10003129
411 Ga0075370_10073689
412 Ga0075370_10155129
413 Ga0075431_100135946
414 Ga0075429_100089012
415 Ga0075429_100384385
416 Ga0068865_100003129
417 Ga0111539_10020538
418 Ga0111539_10424516
419 Ga0105245_10011921
420 Ga0114129_10115120
421 Ga0114129_10823165
422 Ga0105243_10003325
423 Ga0105243_10616675
424 Ga0105242_10138919
425 Ga0105248_10020984
426 Ga0105237_10078109
427 Ga0105249_10061436
428 Ga0105239_10033867
429 Ga0105239_10061481
430 Ga0105239_10120420
431 Ga0105239_10523764
432 Ga0105239_10560096
433 Ga0105246_10175175
434 Ga0157375_10075952
435 Ga0157375_10081187
436 Ga0163163_10059610
437 Ga0157380_10001064
438 Ga0157377_10057149
439 Ga0206353_11859848
440 Ga0207642_10005544
441 Ga0207688_10024441
442 Ga0207643_10000396
443 Ga0207671_10082510
444 Ga0207662_10125315
445 Ga0207657_10014474
446 Ga0207659_10095893
447 Ga0207687_10128853
448 Ga0207664_10019982
449 Ga0207690_10010916
450 Ga0207690_10042199
451 Ga0207690_10058005
452 Ga0207690_10504679
453 Ga0207686_10045956
454 Ga0207709_10005448
455 Ga0207669_10003452
456 Ga0207704_10033392
457 Ga0207691_10002503
458 Ga0207711_10018255
459 Ga0207689_10112955
460 Ga0207661_10005020
461 Ga0207661_10099595
462 Ga0207661_10123654
463 Ga0207679_10082496
464 Ga0207679_10141466
465 Ga0207667_10120150
466 Ga0207677_10064591
467 Ga0207639_10022113
468 Ga0207678_10059992
469 Ga0207708_10000152
470 Ga0207702_10076139
471 Ga0207648_10050048
472 Ga0207675_100007904
473 Ga0207675_100068597
474 Ga0207683_10046216
475 Ga0207683_10201363
476 Ga0207698_10006704
477 Ga0209813_10022174
478 Ga0209813_10070251
479 Ga0268265_10051333
480 Ga0268264_10172686
481 Ga0307513_10119301
482 Ga0307408_100104315
483 Ga0307408_100305734
484 Ga0316576_10131905
485 Ga0316578_10004161
486 Ga0307413_10164391
487 Ga0307410_10180403
488 Ga0307410_10231106
489 Ga0307410_10248271
490 Ga0307407_10167411
491 Ga0307412_10097798
492 Ga0307409_100013531
493 Ga0307409_100024086
494 Ga0307409_100069579
495 Ga0307409_100162219
496 Ga0307409_100192638
497 Ga0307409_100264724
498 Ga0307416_100011595
499 Ga0307416_100112287
500 Ga0307416_100620049
501 Ga0307416_100666663
502 Ga0307414_10392522
503 Ga0307414_10432764
504 Ga0307411_10022910
505 Ga0307411_10062161
506 Ga0307411_10069159
507 Ga0307411_10315330
508 Ga0307415_100071544
509 Ga0307415_100236232
510 Ga0307415_100303058
511 Ga0373931_0106123
512 Ga0395899_0091490
513 Ga0395900_0088255
514 Ga0395900_0188951
515 Ga0395900_0397354
516 Ga0395898_0103034
517 Ga0395898_0240542
518 Ga0395905_0111641
519 Ga0436364_1206354
520 Ga0395901_0109063
521 Ga0395901_0144673
522 Ga0395901_0194224
523 Ga0395901_0574011
524 Ga0439438_021842
525 Ga0439461_0007296
526 Ga0439465_0022568
527 Ga0451833_0342194
528 Ga0451851_0076853
529 Ga0451853_1897932
530 Ga0439448_0048027
531 Ga0450907_002633
532 Ga0439446_0055977
533 Ga0439434_0008134
534 Ga0466969_0010172
535 Ga0466969_0064971
536 Ga0466972_0091395
537 Ga0466972_0117274
538 Ga0466965_0003961
539 Ga0466965_0015462
540 Ga0466966_0109511
541 Ga0466966_0278188
542 Ga0466961_0010525
543 Ga0466961_0088787
544 Ga0466961_0125252
545 Ga0466963_0135665
546 Ga0466964_0007593
547 Ga0466964_0095918
548 Ga0466971_0030210
549 Ga0466971_0051857
550 Ga0466971_0078116
551 Ga0466971_0090828
552 Ga0466970_0009408
553 Ga0466970_0179311
554 Ga0466970_0192474
555 Ga0466970_0251968
556 Ga0466957_0045753
557 Ga0466957_0147822
558 Ga0466960_0009135
559 Ga0466960_0018576
560 Ga0466960_0073572
561 Ga0466960_0114473
562 Ga0466960_0129451
563 Ga0466959_0003826
564 Ga0466959_0094685
565 Ga0466958_0089678
566 Ga0466967_0046364
567 Ga0466967_0074150
568 Ga0466967_0086724
569 Ga0466967_0105587
570 Ga0466967_0110426
571 Ga0466967_0198248
572 Ga0466967_0237691
573 Ga0495592_0012734
574 Ga0495651_0000759
575 Ga0495653_0015571
576 Ga0495662_0002730
577 Ga0495664_0050034
578 Ga0495608_0000457
579 Ga0495608_0127161
580 Ga0495630_0033673
581 Ga0495652_0005775
582 Ga0495665_0004085
583 Ga0495640_0029843
584 Ga0495586_0028547
585 Ga0495587_0000690
586 Ga0495645_0027811
587 Ga0495667_0000576
588 Ga0495634_0026342
589 Ga0495588_0118849
590 Ga0495657_0000753
591 Ga0495623_0000839
592 Ga0495646_0001826
593 Ga0495613_0003486
594 Ga0495600_0000470
595 Ga0495581_0073668
596 Ga0495604_0000885
597 Ga0495604_0000889
598 Ga0495675_0003048
599 Ga0495675_0011957
600 Ga0495684_0012671
601 Ga0495602_0001475
602 Ga0496101_0045629
603 Ga0496101_0273108
604 Ga0496102_0014832
605 Ga0496102_0140896
606 Ga0496102_0443451
607 Ga0496104_0423559
608 Ga0496106_0080828
609 Ga0496108_0394651
610 Ga0496109_0049557
611 Ga0496109_0145980
612 Ga0496110_0051020
613 Ga0496110_0612283
614 Ga0496111_0216341
615 Ga0496111_0243900
616 Ga0496112_0223803
617 Ga0496113_0396877
618 Ga0496114_0084959
619 Ga0496114_0150413
620 Ga0496114_0324455
621 Ga0496114_0471913
622 Ga0496115_0133659
623 Ga0496124_0340292
624 Ga0501033_0000584
625 Ga0501034_0644362
626 Ga0501036_0127811
627 Ga0501039_0210246
628 Ga0501042_0022765
629 Ga0501043_0038180
630 Ga0501046_0000356
631 Ga0501047_0258293
632 Ga0501067_0086764
633 Ga0501067_0086772
634 Ga0501069_0006307
635 Ga0501069_0059903
636 Ga0501069_0081254
637 Ga0501069_0283856
638 Ga0501071_0109719
639 Ga0501072_0052913
640 Ga0501072_0582953
641 Ga0501073_0158514
642 Ga0501074_0131839
643 Ga0501075_0047375
644 Ga0501076_0171680
645 Ga0501079_0385979
646 Ga0501080_0202676
647 Ga0501080_0479320
648 Ga0501081_0083915
649 Ga0501081_0183963
650 Ga0501045_0025474
651 Ga0501045_0077103
652 Ga0501045_0146655
653 nmdc:mga03n38_146648_c1
654 nmdc:mga00v17_13649_c1
655 nmdc:mga00v17_14860_c1
656 nmdc:mga00v17_24599_c1
657 nmdc:mga00v17_285298_c1
658 nmdc:mga0yw44_199540_c1
659 nmdc:mga0yw44_266460_c1
660 nmdc:mga0yw44_6423_c1
661 nmdc:mga0yw44_9672_c1
662 nmdc:mga06z11_87363_c1
663 nmdc:mga04h51_9300_c1
664 nmdc:mga07m45_104378_c1
665 nmdc:mga07m45_5532_c1
666 nmdc:mga06r32_224856_c1
667 nmdc:mga08y16_227896_c1
668 nmdc:mga0sz30_25588_c1
669 Ga0500644_0000181
670 Ga0500556_0002354
671 Ga0500593_003079
672 Ga0500573_0002003
673 Ga0500616_0001905
674 Ga0501084_0170043
675 Ga0501084_0196320
676 Ga0590075_011206
677 Ga0466962_0013357
678 Ga0466962_0030290
679 Ga0466962_0086600
680 Ga0530510_0143158
681 2643824848
682 2643892595
683 2643962044
684 2644014886
685 2644034789
686 2644093280
687 2644176321
688 2644232145
689 2644322891
690 2644532601
691 2738871984
692 2740168494
693 2812329973
694 2816422805
695 2855390089
696 2862710645
697 2984578685
698 2990045503
699 2990260705
700 2995471400
701 8008485758
702 8025524842
703 8033689676
704 8054614144

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12710

HAD

haloacid dehalogenase-like hydrolase

56

228

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hgr-assembly1.cif.gz_D crystal structure of e56a/k67a mutant of 2-keto-3-deoxy-d-glycero-d-galactonononate-9-phosphate phosphohydrolase from bacteroides thetaiotaomicron 0.8394 98 213
4bbj-assembly1.cif.gz_A copper-transporting pib-atpase in complex with beryllium fluoride representing the e2p state 0.8343 97 204
4hgq-assembly2.cif.gz_G crystal structure of e56a mutant of 2-keto-3-deoxy-d-glycero-d-galactonononate-9-phosphate phosphohydrolase from bacteroides thetaiotaomicron 0.8332 98 213
1rlo-assembly4.cif.gz_D phospho-aspartyl intermediate analogue of ybiv from e. coli k12 0.8315 164 224
4umf-assembly1.cif.gz_C crystal structure of 3-deoxy-d-manno-octulosonate 8-phosphate phosphatase from moraxella catarrhalis in complex with magnesium ion, phosphate ion and kdo molecule 0.8313 98 208
ID Description Score Start End Superfamily
3fvvB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9412 100 223 3.40.50.1000
af_A0A0N7KQR1_13_96_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9044 164 199 3.40.50.1000
af_A4I3L5_9_277_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8791 164 224 3.40.50.1000
af_Q86KT5_213_287_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8744 165 213 3.40.50.1000
3m1yC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8394 99 212 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A6J6DYS5-F1-model_v4 Unannotated protein 0.9702 74 225
AF-A0A832JDT6-F1-model_v4 HAD-IB family hydrolase 0.9644 79 225 GO:0016787
AF-A0A2D7DK54-F1-model_v4 deleted 0.9598 80 225
AF-A0A2S8L8V8-F1-model_v4 deleted 0.9553 113 227
AF-A0A832JDT6-F1-model_v4 HAD-IB family hydrolase 0.9518 79 225 GO:0016787

Map