F419029

General Info

Members Datasets Scaffolds Average Seq Length
352 182 704 223

Family's Representative Sequence

Representative Sequence 3300014497|Ga0182008_10010586|Ga0182008_100105865
Length 264
Sequence MVSASVAPSARQSGNSREPIRRKVRGSVGCSSTDTFARMELTWLGHATFRLDAGGKRIYIDPFLNGNPKTPENEXXXERVDIIAITHAHGDHLGDTVELSKQHGCTVIAPVELADWLQMKHKLENVRDPNKGGTVDVDGVRFTLTNAHHSSSNNDLEYMGEPCGIVVRADGKSVYFAGDTCVFGDMQLIGRLYSPDLAVLPIGDHYTMGPDEAALAVELLGVKRVVPCHWGTFPALTGTPDALAEKVGGGVTVERVGPGDTVTI

Samples

Sample ID Description Type Environment
1 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
17 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
18 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
22 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
23 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
24 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
25 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
26 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
27 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
31 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
32 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
35 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
36 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
37 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
38 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
39 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
40 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
41 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
68 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
69 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
70 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
71 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
72 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
73 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
74 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
75 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
76 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
77 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
78 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
79 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
80 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
81 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
82 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
83 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
84 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
85 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
86 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
87 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
88 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
89 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
90 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
91 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
92 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
93 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
94 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
95 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
96 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
97 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
98 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
99 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
100 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
101 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
102 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
103 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
104 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
105 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
106 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
107 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
108 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
109 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
110 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
111 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
112 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
113 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
114 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
115 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
116 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
117 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
118 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
119 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
120 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
121 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
122 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
123 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
124 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
125 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
126 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
127 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
128 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
129 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
130 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
131 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
132 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
133 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
134 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
135 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
136 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
137 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
138 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
139 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
140 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
141 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
142 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
143 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
144 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
145 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
146 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
147 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
148 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
149 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
150 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
151 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
152 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
153 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
154 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
155 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
156 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
157 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
158 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
159 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
160 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
161 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
162 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
163 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
164 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
165 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
166 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
168 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
169 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
170 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
171 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
172 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
173 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
174 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
175 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
176 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
177 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
178 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
179 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
180 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
181 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
182 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.73
Metatranscriptomes 1.99
Isolates 0.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.14
Nodule 0
Rhizoplane 9.66
Rhizosphere 86.93
Stem 0
Stem Tuber 0
Unclassified 7.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0182008_10010586 3300014497 Bacteria 4932
2 Ga0070658_10011370 3300005327 Bacteria 7137
3 Ga0070658_10018470 3300005327 Bacteria 5583
4 Ga0070680_100095638 3300005336 Bacteria 2463
5 Ga0070680_100198938 3300005336 Bacteria 1689
6 Ga0070682_100340192 3300005337 Bacteria 1115
7 Ga0070660_100114922 3300005339 Bacteria 2145
8 Ga0070671_100107271 3300005355 Bacteria 2345
9 Ga0070671_100393780 3300005355 Bacteria 1185
10 Ga0070709_10003375 3300005434 Bacteria 8579
11 Ga0070714_100047100 3300005435 Bacteria 3661
12 Ga0070714_100047309 3300005435 Bacteria 3654
13 Ga0070714_100069085 3300005435 Bacteria 3050
14 Ga0070714_100111424 3300005435 Bacteria 2423
15 Ga0070714_100291530 3300005435 Bacteria 1519
16 Ga0070714_100566550 3300005435 Unclassified 1089
17 Ga0070714_100571554 3300005435 Archaea 1084
18 Ga0070714_100596313 3300005435 Archaea 1061
19 Ga0070713_100000665 3300005436 Bacteria 21987
20 Ga0070713_100181384 3300005436 Unclassified 1892
21 Ga0070713_100346431 3300005436 Bacteria 1377
22 Ga0070710_10052366 3300005437 Bacteria 2295
23 Ga0070711_100018221 3300005439 Bacteria 4480
24 Ga0070708_100519533 3300005445 Bacteria 1123
25 Ga0070708_100558073 3300005445 Bacteria 1080
26 Ga0070678_100087119 3300005456 Bacteria 2384
27 Ga0070678_100330595 3300005456 Bacteria 1304
28 Ga0070698_100006514 3300005471 Bacteria 12660
29 Ga0070679_100083880 3300005530 Bacteria 3175
30 Ga0070679_100240390 3300005530 Bacteria 1768
31 Ga0070695_100000273 3300005545 Bacteria 26034
32 Ga0070696_100200602 3300005546 Bacteria 1489
33 Ga0070704_100079087 3300005549 Bacteria 2414
34 Ga0068855_100054310 3300005563 Bacteria 4708
35 Ga0068855_100195109 3300005563 Bacteria 2281
36 Ga0068856_100225248 3300005614 Bacteria 1891
37 Ga0070717_10035191 3300006028 Bacteria 4052
38 Ga0070717_10872413 3300006028 Bacteria 819
39 Ga0075365_10086337 3300006038 Bacteria 2132
40 Ga0075364_10196099 3300006051 Unclassified 1368
41 Ga0070715_10006216 3300006163 Bacteria 4045
42 Ga0070716_100004644 3300006173 Bacteria 6581
43 Ga0070712_100655626 3300006175 Bacteria 892
44 Ga0097621_100379079 3300006237 Bacteria 1263
45 Ga0105240_10057696 3300009093 Bacteria 4848
46 Ga0105240_10066651 3300009093 Bacteria 4465
47 Ga0105240_10120621 3300009093 Bacteria 3158
48 Ga0111539_11358595 3300009094 Unclassified 824
49 Ga0105247_10373254 3300009101 Unclassified 1009
50 Ga0105248_10203386 3300009177 Bacteria 2231
51 Ga0105248_10703704 3300009177 Bacteria 1140
52 Ga0105237_10130192 3300009545 Bacteria 2511
53 Ga0105238_10340356 3300009551 Bacteria 1488
54 Ga0157373_10096717 3300013100 Bacteria 2079
55 Ga0157373_10261990 3300013100 Bacteria 1223
56 Ga0157370_10002642 3300013104 Bacteria 21525
57 Ga0157370_10102677 3300013104 Bacteria 2677
58 Ga0157370_10669061 3300013104 Bacteria 948
59 Ga0157370_10669145 3300013104 Bacteria 948
60 Ga0157369_10010509 3300013105 Bacteria 10536
61 Ga0157369_10174690 3300013105 Bacteria 2262
62 Ga0157374_10089816 3300013296 Bacteria 2928
63 Ga0157372_10012471 3300013307 Bacteria 9059
64 Ga0157372_10231776 3300013307 Bacteria 2141
65 Ga0157372_10388621 3300013307 Bacteria 1626
66 Ga0157372_10428407 3300013307 Unclassified 1542
67 Ga0182008_10065484 3300014497 Unclassified 1788
68 Ga0157377_10363999 3300014745 Unclassified 974
69 Ga0197907_10551524 3300020069 Bacteria 3564
70 Ga0197907_11436815 3300020069 Bacteria 1100
71 Ga0206356_10432734 3300020070 Bacteria 2160
72 Ga0206356_11656821 3300020070 Bacteria 4724
73 Ga0206356_11884116 3300020070 Archaea 773
74 Ga0206354_10221712 3300020081 Bacteria 2487
75 Ga0206353_10137641 3300020082 Bacteria 4725
76 Ga0207692_10270064 3300025898 Bacteria 1025
77 Ga0207710_10072371 3300025900 Bacteria 1583
78 Ga0207685_10012639 3300025905 Bacteria 2583
79 Ga0207699_10019938 3300025906 Bacteria 3585
80 Ga0207705_10027410 3300025909 Bacteria 4063
81 Ga0207684_10216905 3300025910 Bacteria 1651
82 Ga0207695_10057781 3300025913 Bacteria 4029
83 Ga0207695_10091670 3300025913 Bacteria 3052
84 Ga0207671_10032452 3300025914 Bacteria 3887
85 Ga0207693_10002222 3300025915 Bacteria 16897
86 Ga0207663_10015497 3300025916 Bacteria 4206
87 Ga0207663_10764560 3300025916 Archaea 768
88 Ga0207660_10056505 3300025917 Bacteria 2808
89 Ga0207657_10032486 3300025919 Bacteria 4715
90 Ga0207657_10047289 3300025919 Bacteria 3763
91 Ga0207652_10092196 3300025921 Bacteria 2664
92 Ga0207694_10176059 3300025924 Bacteria 1733
93 Ga0207700_10018468 3300025928 Bacteria 4686
94 Ga0207664_10005597 3300025929 Bacteria 8600
95 Ga0207664_10021374 3300025929 Bacteria 4810
96 Ga0207664_10030159 3300025929 Bacteria 4140
97 Ga0207664_10030433 3300025929 Bacteria 4122
98 Ga0207664_10080718 3300025929 Bacteria 2645
99 Ga0207664_10131511 3300025929 Bacteria 2107
100 Ga0207664_10144232 3300025929 Bacteria 2018
101 Ga0207664_10499120 3300025929 Archaea 1089
102 Ga0207644_10121053 3300025931 Bacteria 1992
103 Ga0207644_10623913 3300025931 Bacteria 896
104 Ga0207665_10000562 3300025939 Bacteria 25011
105 Ga0207661_10535566 3300025944 Unclassified 1072
106 Ga0207679_10612834 3300025945 Bacteria 982
107 Ga0207667_10109854 3300025949 Bacteria 2844
108 Ga0207667_10120371 3300025949 Bacteria 2705
109 Ga0207639_10163091 3300026041 Bacteria 1880
110 Ga0207702_10174415 3300026078 Bacteria 1974
111 Ga0265337_1071788 3300028556 Bacteria 951
112 Ga0265334_10051433 3300028573 Bacteria 1579
113 Ga0265336_10003005 3300028666 Bacteria 6720
114 Ga0265338_10008512 3300028800 Bacteria 12437
115 Ga0265338_10011885 3300028800 Bacteria 9997
116 Ga0265338_10030952 3300028800 Bacteria 5256
117 Ga0265338_10080999 3300028800 Bacteria 2724
118 Ga0265338_10145646 3300028800 Bacteria 1848
119 Ga0265338_10179981 3300028800 Bacteria 1613
120 Ga0265338_10336484 3300028800 Bacteria 1089
121 Ga0265325_10071294 3300031241 Bacteria 1744
122 Ga0265339_10001655 3300031249 Bacteria 16435
123 Ga0265327_10118447 3300031251 Unclassified 1258
124 Ga0265316_10096553 3300031344 Bacteria 2250
125 Ga0265313_10034611 3300031595 Bacteria 2552
126 Ga0265313_10035317 3300031595 Bacteria 2519
127 Ga0265314_10023223 3300031711 Bacteria 4734
128 Ga0307406_10393774 3300031901 Bacteria 1096
129 Ga0373926_0060681 3300035083 Bacteria 1378
130 Ga0373944_0075648 3300035089 Bacteria 1104
131 Ga0373944_0092080 3300035089 Bacteria 1014
132 Ga0373943_0003902 3300035170 Bacteria 6788
133 Ga0373946_0003837 3300035171 Bacteria 5339
134 Ga0373935_0241048 3300035692 Bacteria 1262
135 Ga0373927_0065458 3300035695 Bacteria 2351
136 Ga0373947_0005654 3300035725 Bacteria 7297
137 Ga0373947_0016097 3300035725 Bacteria 4297
138 Ga0373925_0027522 3300037068 Bacteria 4160
139 Ga0373925_0057974 3300037068 Bacteria 2902
140 Ga0395899_0067673 3300037312 Bacteria 2620
141 Ga0395900_0026000 3300037418 Bacteria 5994
142 Ga0395898_0007203 3300037466 Bacteria 11807
143 Ga0395898_0046330 3300037466 Bacteria 4271
144 Ga0395905_0155303 3300037471 Bacteria 2152
145 Ga0395905_0256858 3300037471 Bacteria 1632
146 Ga0395901_0299584 3300038443 Bacteria 1667
147 Ga0395901_0385383 3300038443 Bacteria 1442
148 Ga0395901_0841476 3300038443 Bacteria 904
149 Ga0436363_0352440 3300039450 Bacteria 935
150 Ga0466969_0016775 3300044656 Bacteria 3829
151 Ga0466969_0055034 3300044656 Bacteria 1948
152 Ga0466972_0184945 3300044658 Bacteria 977
153 Ga0466965_0283138 3300044683 Bacteria 896
154 Ga0466966_0013356 3300044684 Bacteria 5435
155 Ga0466966_0099712 3300044684 Bacteria 1797
156 Ga0466961_0013646 3300044693 Bacteria 5206
157 Ga0466961_0026900 3300044693 Bacteria 3699
158 Ga0466963_0001904 3300044694 Bacteria 11411
159 Ga0466963_0002755 3300044694 Bacteria 9916
160 Ga0466963_0002787 3300044694 Bacteria 9850
161 Ga0466963_0003927 3300044694 Bacteria 8596
162 Ga0466963_0004193 3300044694 Bacteria 8351
163 Ga0466963_0006226 3300044694 Bacteria 7047
164 Ga0466963_0008202 3300044694 Bacteria 6259
165 Ga0466963_0011691 3300044694 Bacteria 5349
166 Ga0466963_0023873 3300044694 Bacteria 3888
167 Ga0466963_0038994 3300044694 Bacteria 3109
168 Ga0466963_0043702 3300044694 Bacteria 2948
169 Ga0466963_0065960 3300044694 Unclassified 2427
170 Ga0466963_0081119 3300044694 Unclassified 2197
171 Ga0466964_0001950 3300044706 Bacteria 7233
172 Ga0466964_0004166 3300044706 Bacteria 5318
173 Ga0466964_0073250 3300044706 Bacteria 1453
174 Ga0466964_0087255 3300044706 Bacteria 1351
175 Ga0466964_0165629 3300044706 Bacteria 1037
176 Ga0466964_0251718 3300044706 Bacteria 871
177 Ga0466971_0005764 3300044719 Bacteria 5386
178 Ga0466971_0056912 3300044719 Bacteria 1763
179 Ga0466968_0001331 3300044735 Bacteria 8821
180 Ga0466968_0042405 3300044735 Bacteria 1924
181 Ga0466968_0107017 3300044735 Bacteria 1254
182 Ga0466970_0278499 3300044765 Bacteria 940
183 Ga0466957_0005989 3300044842 Bacteria 6861
184 Ga0466957_0014904 3300044842 Bacteria 4534
185 Ga0466957_0021081 3300044842 Bacteria 3838
186 Ga0466957_0023613 3300044842 Bacteria 3635
187 Ga0466957_0085856 3300044842 Bacteria 1966
188 Ga0466957_0116830 3300044842 Bacteria 1697
189 Ga0466957_0241173 3300044842 Bacteria 1199
190 Ga0466957_0245076 3300044842 Bacteria 1190
191 Ga0466957_0361542 3300044842 Bacteria 986
192 Ga0466960_0003873 3300044901 Bacteria 5802
193 Ga0466960_0006023 3300044901 Bacteria 4842
194 Ga0466960_0047837 3300044901 Unclassified 2053
195 Ga0466959_0053264 3300045049 Bacteria 2958
196 Ga0466959_0229298 3300045049 Bacteria 1286
197 Ga0466959_0231678 3300045049 Bacteria 1278
198 Ga0466959_0298071 3300045049 Bacteria 1104
199 Ga0466958_0000555 3300045836 Bacteria 15880
200 Ga0466958_0005218 3300045836 Bacteria 6959
201 Ga0466958_0005234 3300045836 Bacteria 6950
202 Ga0466958_0006315 3300045836 Bacteria 6441
203 Ga0466958_0060435 3300045836 Bacteria 2307
204 Ga0466958_0078843 3300045836 Bacteria 2024
205 Ga0466958_0081491 3300045836 Bacteria 1991
206 Ga0466958_0110617 3300045836 Bacteria 1715
207 Ga0466958_0112026 3300045836 Bacteria 1704
208 Ga0466958_0245904 3300045836 Bacteria 1143
209 Ga0466958_0249864 3300045836 Bacteria 1134
210 Ga0466967_0000267 3300045976 Bacteria 23000
211 Ga0466967_0004542 3300045976 Bacteria 9392
212 Ga0466967_0010728 3300045976 Bacteria 6888
213 Ga0466967_0015306 3300045976 Bacteria 6009
214 Ga0466967_0016390 3300045976 Bacteria 5843
215 Ga0466967_0021663 3300045976 Bacteria 5227
216 Ga0466967_0031996 3300045976 Bacteria 4437
217 Ga0466967_0035059 3300045976 Bacteria 4266
218 Ga0466967_0042312 3300045976 Bacteria 3935
219 Ga0466967_0045584 3300045976 Bacteria 3810
220 Ga0466967_0048132 3300045976 Bacteria 3721
221 Ga0466967_0049497 3300045976 Bacteria 3675
222 Ga0466967_0104056 3300045976 Bacteria 2598
223 Ga0466967_0108155 3300045976 Bacteria 2551
224 Ga0466967_0128326 3300045976 Bacteria 2351
225 Ga0466967_0148701 3300045976 Bacteria 2187
226 Ga0466967_0177951 3300045976 Unclassified 2004
227 Ga0466967_0196003 3300045976 Bacteria 1911
228 Ga0466967_0218620 3300045976 Bacteria 1809
229 Ga0466967_0296917 3300045976 Bacteria 1553
230 Ga0466967_0444492 3300045976 Unclassified 1266
231 Ga0466967_0561378 3300045976 Unclassified 1124
232 Ga0466967_0578315 3300045976 Bacteria 1107
233 Ga0466967_0639057 3300045976 Bacteria 1052
234 Ga0466967_0649200 3300045976 Unclassified 1043
235 Ga0466967_1282995 3300045976 Bacteria 729
236 Ga0495603_0280754 3300046455 Bacteria 957
237 Ga0495629_0126298 3300046459 Bacteria 1782
238 Ga0495641_0008427 3300046461 Bacteria 6287
239 Ga0495653_0032822 3300046463 Bacteria 4118
240 Ga0495653_0370322 3300046463 Bacteria 917
241 Ga0495580_0012441 3300046472 Bacteria 6524
242 Ga0495582_0016438 3300046473 Bacteria 4054
243 Ga0495639_0003222 3300046475 Bacteria 7090
244 Ga0495662_0022521 3300046476 Bacteria 3041
245 Ga0495664_0015514 3300046477 Bacteria 4331
246 Ga0495664_0417334 3300046477 Bacteria 805
247 Ga0495584_0350427 3300046491 Bacteria 750
248 Ga0495594_0086507 3300046499 Bacteria 1754
249 Ga0495594_0248741 3300046499 Bacteria 1013
250 Ga0495618_0015776 3300046514 Bacteria 4611
251 Ga0495618_0191364 3300046514 Bacteria 1297
252 Ga0495628_0006313 3300046516 Bacteria 10355
253 Ga0495630_0011181 3300046517 Bacteria 6495
254 Ga0495630_0076549 3300046517 Bacteria 2521
255 Ga0495666_0005564 3300046526 Bacteria 6348
256 Ga0495652_0017225 3300046529 Bacteria 6451
257 Ga0495652_0057214 3300046529 Bacteria 3308
258 Ga0495665_0010838 3300046531 Bacteria 4932
259 Ga0495640_0028311 3300046533 Bacteria 4035
260 Ga0495586_0007058 3300046535 Bacteria 5986
261 Ga0495645_0250173 3300046543 Bacteria 1178
262 Ga0495645_0313561 3300046543 Bacteria 1021
263 Ga0495667_0061546 3300046559 Bacteria 2461
264 Ga0495656_0105311 3300046615 Bacteria 1311
265 Ga0495634_0020745 3300046642 Bacteria 4655
266 Ga0495635_0031238 3300046663 Bacteria 3698
267 Ga0495646_0081490 3300046680 Bacteria 1885
268 Ga0495647_0001425 3300046681 Bacteria 7392
269 Ga0495658_0043626 3300046683 Bacteria 2509
270 Ga0495613_0011388 3300046689 Bacteria 6609
271 Ga0495613_0096263 3300046689 Bacteria 2140
272 Ga0495624_0014274 3300046690 Bacteria 5393
273 Ga0495624_0038778 3300046690 Bacteria 3059
274 Ga0495600_0345884 3300046809 Bacteria 932
275 Ga0495581_0005688 3300047315 Bacteria 7230
276 Ga0495674_0060778 3300047319 Bacteria 3295
277 Ga0495674_0121802 3300047319 Bacteria 2203
278 Ga0495676_0044336 3300047321 Bacteria 3630
279 Ga0495676_0179381 3300047321 Bacteria 1485
280 Ga0495680_0006872 3300047322 Bacteria 10507
281 Ga0495675_0392714 3300047444 Unclassified 810
282 Ga0495684_0064924 3300047471 Bacteria 2774
283 Ga0495593_0004273 3300047673 Bacteria 8495
284 Ga0495614_0035519 3300048089 Bacteria 2141
285 Ga0496100_0020270 3300048903 Bacteria 3983
286 Ga0496100_0034096 3300048903 Unclassified 3191
287 Ga0496101_0015470 3300048904 Bacteria 5144
288 Ga0496101_0059473 3300048904 Bacteria 2769
289 Ga0496102_0015415 3300048905 Bacteria 6657
290 Ga0496102_0036705 3300048905 Bacteria 4416
291 Ga0496102_0165751 3300048905 Archaea 2079
292 Ga0496103_0007924 3300048906 Bacteria 6317
293 Ga0496103_0022848 3300048906 Bacteria 3769
294 Ga0496104_0205559 3300048907 Bacteria 1881
295 Ga0496104_0348124 3300048907 Bacteria 1394
296 Ga0496105_0039095 3300048908 Bacteria 3909
297 Ga0496106_0026577 3300048909 Bacteria 4310
298 Ga0496107_0001749 3300048910 Bacteria 13668
299 Ga0496107_0036787 3300048910 Bacteria 3512
300 Ga0496107_0114219 3300048910 Bacteria 1987
301 Ga0496109_0007998 3300048912 Bacteria 8965
302 Ga0496109_0095073 3300048912 Bacteria 2758
303 Ga0496109_0130658 3300048912 Unclassified 2344
304 Ga0496110_0059137 3300048913 Bacteria 3377
305 Ga0496111_0005406 3300048914 Bacteria 8180
306 Ga0496111_0094376 3300048914 Bacteria 2194
307 Ga0496112_0040404 3300048915 Bacteria 4561
308 Ga0496112_0270913 3300048915 Bacteria 1646
309 Ga0496112_0276894 3300048915 Bacteria 1625
310 Ga0496113_0020857 3300048916 Bacteria 4614
311 Ga0496113_0168364 3300048916 Bacteria 1735
312 Ga0496114_0050214 3300048917 Bacteria 3472
313 Ga0496114_0061075 3300048917 Bacteria 3152
314 Ga0496114_0307313 3300048917 Unclassified 1400
315 Ga0496115_0001304 3300048918 Bacteria 17770
316 Ga0496115_0068445 3300048918 Bacteria 2874
317 Ga0496115_0250500 3300048918 Unclassified 1458
318 Ga0496115_0451208 3300048918 Unclassified 1038
319 Ga0496116_0006842 3300048919 Bacteria 10245
320 Ga0496119_0076780 3300048922 Bacteria 1937
321 Ga0496122_0008091 3300048925 Bacteria 11464
322 Ga0496123_0009023 3300048926 Bacteria 9043
323 Ga0496124_0001350 3300048927 Bacteria 36777
324 Ga0496125_0008995 3300048928 Bacteria 10354
325 Ga0501034_0096287 3300049571 Unclassified 2956
326 Ga0501067_0036456 3300049583 Bacteria 2730
327 Ga0501067_0118407 3300049583 Bacteria 1473
328 Ga0501069_0031827 3300049585 Bacteria 2903
329 Ga0501069_0077058 3300049585 Bacteria 1875
330 Ga0501069_0077877 3300049585 Bacteria 1864
331 Ga0501070_0009072 3300049586 Bacteria 8415
332 Ga0501070_0147971 3300049586 Bacteria 1938
333 Ga0501072_0015474 3300049588 Bacteria 5848
334 Ga0501073_0134113 3300049589 Bacteria 1716
335 Ga0501074_0038653 3300049590 Bacteria 3457
336 Ga0501074_0077635 3300049590 Bacteria 2383
337 Ga0501080_0015248 3300049742 Bacteria 7083
338 Ga0501080_0471714 3300049742 Bacteria 1123
339 Ga0501083_0001954 3300049744 Bacteria 14158
340 nmdc:mga00v17_90467_c1 3300050491 Unclassified 1921
341 Ga0495601_0019648 3300053077 Bacteria 4122
342 Ga0495601_0174561 3300053077 Bacteria 1405
343 Ga0495612_0007528 3300053078 Bacteria 4450
344 Ga0495619_0015995 3300053085 Bacteria 4747
345 Ga0495619_0070868 3300053085 Bacteria 2332
346 Ga0500566_0065801 3300053094 Bacteria 2043
347 Ga0501082_0007045 3300060353 Bacteria 9703
348 Ga0466962_0018338 3300061719 Bacteria 3366
349 Ga0466962_0023084 3300061719 Bacteria 2990
350 Ga0466962_0048428 3300061719 Bacteria 2031
351 Ga0466962_0169423 3300061719 Bacteria 1063
352 2793183914 2791355222 Bacteria 5898266
353 Ga0182008_10010586
354 Ga0070658_10011370
355 Ga0070658_10018470
356 Ga0070680_100095638
357 Ga0070680_100198938
358 Ga0070682_100340192
359 Ga0070660_100114922
360 Ga0070671_100107271
361 Ga0070671_100393780
362 Ga0070709_10003375
363 Ga0070714_100047100
364 Ga0070714_100047309
365 Ga0070714_100069085
366 Ga0070714_100111424
367 Ga0070714_100291530
368 Ga0070714_100566550
369 Ga0070714_100571554
370 Ga0070714_100596313
371 Ga0070713_100000665
372 Ga0070713_100181384
373 Ga0070713_100346431
374 Ga0070710_10052366
375 Ga0070711_100018221
376 Ga0070708_100519533
377 Ga0070708_100558073
378 Ga0070678_100087119
379 Ga0070678_100330595
380 Ga0070698_100006514
381 Ga0070679_100083880
382 Ga0070679_100240390
383 Ga0070695_100000273
384 Ga0070696_100200602
385 Ga0070704_100079087
386 Ga0068855_100054310
387 Ga0068855_100195109
388 Ga0068856_100225248
389 Ga0070717_10035191
390 Ga0070717_10872413
391 Ga0075365_10086337
392 Ga0075364_10196099
393 Ga0070715_10006216
394 Ga0070716_100004644
395 Ga0070712_100655626
396 Ga0097621_100379079
397 Ga0105240_10057696
398 Ga0105240_10066651
399 Ga0105240_10120621
400 Ga0111539_11358595
401 Ga0105247_10373254
402 Ga0105248_10203386
403 Ga0105248_10703704
404 Ga0105237_10130192
405 Ga0105238_10340356
406 Ga0157373_10096717
407 Ga0157373_10261990
408 Ga0157370_10002642
409 Ga0157370_10102677
410 Ga0157370_10669061
411 Ga0157370_10669145
412 Ga0157369_10010509
413 Ga0157369_10174690
414 Ga0157374_10089816
415 Ga0157372_10012471
416 Ga0157372_10231776
417 Ga0157372_10388621
418 Ga0157372_10428407
419 Ga0182008_10065484
420 Ga0157377_10363999
421 Ga0197907_10551524
422 Ga0197907_11436815
423 Ga0206356_10432734
424 Ga0206356_11656821
425 Ga0206356_11884116
426 Ga0206354_10221712
427 Ga0206353_10137641
428 Ga0207692_10270064
429 Ga0207710_10072371
430 Ga0207685_10012639
431 Ga0207699_10019938
432 Ga0207705_10027410
433 Ga0207684_10216905
434 Ga0207695_10057781
435 Ga0207695_10091670
436 Ga0207671_10032452
437 Ga0207693_10002222
438 Ga0207663_10015497
439 Ga0207663_10764560
440 Ga0207660_10056505
441 Ga0207657_10032486
442 Ga0207657_10047289
443 Ga0207652_10092196
444 Ga0207694_10176059
445 Ga0207700_10018468
446 Ga0207664_10005597
447 Ga0207664_10021374
448 Ga0207664_10030159
449 Ga0207664_10030433
450 Ga0207664_10080718
451 Ga0207664_10131511
452 Ga0207664_10144232
453 Ga0207664_10499120
454 Ga0207644_10121053
455 Ga0207644_10623913
456 Ga0207665_10000562
457 Ga0207661_10535566
458 Ga0207679_10612834
459 Ga0207667_10109854
460 Ga0207667_10120371
461 Ga0207639_10163091
462 Ga0207702_10174415
463 Ga0265337_1071788
464 Ga0265334_10051433
465 Ga0265336_10003005
466 Ga0265338_10008512
467 Ga0265338_10011885
468 Ga0265338_10030952
469 Ga0265338_10080999
470 Ga0265338_10145646
471 Ga0265338_10179981
472 Ga0265338_10336484
473 Ga0265325_10071294
474 Ga0265339_10001655
475 Ga0265327_10118447
476 Ga0265316_10096553
477 Ga0265313_10034611
478 Ga0265313_10035317
479 Ga0265314_10023223
480 Ga0307406_10393774
481 Ga0373926_0060681
482 Ga0373944_0075648
483 Ga0373944_0092080
484 Ga0373943_0003902
485 Ga0373946_0003837
486 Ga0373935_0241048
487 Ga0373927_0065458
488 Ga0373947_0005654
489 Ga0373947_0016097
490 Ga0373925_0027522
491 Ga0373925_0057974
492 Ga0395899_0067673
493 Ga0395900_0026000
494 Ga0395898_0007203
495 Ga0395898_0046330
496 Ga0395905_0155303
497 Ga0395905_0256858
498 Ga0395901_0299584
499 Ga0395901_0385383
500 Ga0395901_0841476
501 Ga0436363_0352440
502 Ga0466969_0016775
503 Ga0466969_0055034
504 Ga0466972_0184945
505 Ga0466965_0283138
506 Ga0466966_0013356
507 Ga0466966_0099712
508 Ga0466961_0013646
509 Ga0466961_0026900
510 Ga0466963_0001904
511 Ga0466963_0002755
512 Ga0466963_0002787
513 Ga0466963_0003927
514 Ga0466963_0004193
515 Ga0466963_0006226
516 Ga0466963_0008202
517 Ga0466963_0011691
518 Ga0466963_0023873
519 Ga0466963_0038994
520 Ga0466963_0043702
521 Ga0466963_0065960
522 Ga0466963_0081119
523 Ga0466964_0001950
524 Ga0466964_0004166
525 Ga0466964_0073250
526 Ga0466964_0087255
527 Ga0466964_0165629
528 Ga0466964_0251718
529 Ga0466971_0005764
530 Ga0466971_0056912
531 Ga0466968_0001331
532 Ga0466968_0042405
533 Ga0466968_0107017
534 Ga0466970_0278499
535 Ga0466957_0005989
536 Ga0466957_0014904
537 Ga0466957_0021081
538 Ga0466957_0023613
539 Ga0466957_0085856
540 Ga0466957_0116830
541 Ga0466957_0241173
542 Ga0466957_0245076
543 Ga0466957_0361542
544 Ga0466960_0003873
545 Ga0466960_0006023
546 Ga0466960_0047837
547 Ga0466959_0053264
548 Ga0466959_0229298
549 Ga0466959_0231678
550 Ga0466959_0298071
551 Ga0466958_0000555
552 Ga0466958_0005218
553 Ga0466958_0005234
554 Ga0466958_0006315
555 Ga0466958_0060435
556 Ga0466958_0078843
557 Ga0466958_0081491
558 Ga0466958_0110617
559 Ga0466958_0112026
560 Ga0466958_0245904
561 Ga0466958_0249864
562 Ga0466967_0000267
563 Ga0466967_0004542
564 Ga0466967_0010728
565 Ga0466967_0015306
566 Ga0466967_0016390
567 Ga0466967_0021663
568 Ga0466967_0031996
569 Ga0466967_0035059
570 Ga0466967_0042312
571 Ga0466967_0045584
572 Ga0466967_0048132
573 Ga0466967_0049497
574 Ga0466967_0104056
575 Ga0466967_0108155
576 Ga0466967_0128326
577 Ga0466967_0148701
578 Ga0466967_0177951
579 Ga0466967_0196003
580 Ga0466967_0218620
581 Ga0466967_0296917
582 Ga0466967_0444492
583 Ga0466967_0561378
584 Ga0466967_0578315
585 Ga0466967_0639057
586 Ga0466967_0649200
587 Ga0466967_1282995
588 Ga0495603_0280754
589 Ga0495629_0126298
590 Ga0495641_0008427
591 Ga0495653_0032822
592 Ga0495653_0370322
593 Ga0495580_0012441
594 Ga0495582_0016438
595 Ga0495639_0003222
596 Ga0495662_0022521
597 Ga0495664_0015514
598 Ga0495664_0417334
599 Ga0495584_0350427
600 Ga0495594_0086507
601 Ga0495594_0248741
602 Ga0495618_0015776
603 Ga0495618_0191364
604 Ga0495628_0006313
605 Ga0495630_0011181
606 Ga0495630_0076549
607 Ga0495666_0005564
608 Ga0495652_0017225
609 Ga0495652_0057214
610 Ga0495665_0010838
611 Ga0495640_0028311
612 Ga0495586_0007058
613 Ga0495645_0250173
614 Ga0495645_0313561
615 Ga0495667_0061546
616 Ga0495656_0105311
617 Ga0495634_0020745
618 Ga0495635_0031238
619 Ga0495646_0081490
620 Ga0495647_0001425
621 Ga0495658_0043626
622 Ga0495613_0011388
623 Ga0495613_0096263
624 Ga0495624_0014274
625 Ga0495624_0038778
626 Ga0495600_0345884
627 Ga0495581_0005688
628 Ga0495674_0060778
629 Ga0495674_0121802
630 Ga0495676_0044336
631 Ga0495676_0179381
632 Ga0495680_0006872
633 Ga0495675_0392714
634 Ga0495684_0064924
635 Ga0495593_0004273
636 Ga0495614_0035519
637 Ga0496100_0020270
638 Ga0496100_0034096
639 Ga0496101_0015470
640 Ga0496101_0059473
641 Ga0496102_0015415
642 Ga0496102_0036705
643 Ga0496102_0165751
644 Ga0496103_0007924
645 Ga0496103_0022848
646 Ga0496104_0205559
647 Ga0496104_0348124
648 Ga0496105_0039095
649 Ga0496106_0026577
650 Ga0496107_0001749
651 Ga0496107_0036787
652 Ga0496107_0114219
653 Ga0496109_0007998
654 Ga0496109_0095073
655 Ga0496109_0130658
656 Ga0496110_0059137
657 Ga0496111_0005406
658 Ga0496111_0094376
659 Ga0496112_0040404
660 Ga0496112_0270913
661 Ga0496112_0276894
662 Ga0496113_0020857
663 Ga0496113_0168364
664 Ga0496114_0050214
665 Ga0496114_0061075
666 Ga0496114_0307313
667 Ga0496115_0001304
668 Ga0496115_0068445
669 Ga0496115_0250500
670 Ga0496115_0451208
671 Ga0496116_0006842
672 Ga0496119_0076780
673 Ga0496122_0008091
674 Ga0496123_0009023
675 Ga0496124_0001350
676 Ga0496125_0008995
677 Ga0501034_0096287
678 Ga0501067_0036456
679 Ga0501067_0118407
680 Ga0501069_0031827
681 Ga0501069_0077058
682 Ga0501069_0077877
683 Ga0501070_0009072
684 Ga0501070_0147971
685 Ga0501072_0015474
686 Ga0501073_0134113
687 Ga0501074_0038653
688 Ga0501074_0077635
689 Ga0501080_0015248
690 Ga0501080_0471714
691 Ga0501083_0001954
692 nmdc:mga00v17_90467_c1
693 Ga0495601_0019648
694 Ga0495601_0174561
695 Ga0495612_0007528
696 Ga0495619_0015995
697 Ga0495619_0070868
698 Ga0500566_0065801
699 Ga0501082_0007045
700 Ga0466962_0018338
701 Ga0466962_0023084
702 Ga0466962_0048428
703 Ga0466962_0169423
704 2793183914

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12706

Lactamase_B_2

Beta-lactamase superfamily domain

56

230

0.89

PF13483

Lactamase_B_3

Beta-lactamase superfamily domain

40

229

0.86

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

41

229

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
3x2x-assembly1.cif.gz_C crystal structure of metallo-beta-lactamase h48a from thermotoga maritima 0.8237 1 184
7e3w-assembly1.cif.gz_C metallo beta-lactamase fold protein (camp bound) 0.8216 1 184
3x2x-assembly1.cif.gz_C crystal structure of metallo-beta-lactamase h48a from thermotoga maritima 0.8195 1 184
7e3w-assembly1.cif.gz_C metallo beta-lactamase fold protein (camp bound) 0.8175 1 184
3x30-assembly1.cif.gz_A crystal structure of metallo-beta-lactamase from thermotoga maritima 0.806 1 184
ID Description Score Start End Superfamily
af_Q2FXM0_1_229_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8281 1 184 3.60.15.10
af_Q2FXM0_1_229_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.824 1 184 3.60.15.10
af_Q58563_1_217_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.7842 3 184 3.60.15.10
af_Q58563_1_217_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.7724 3 184 3.60.15.10
af_Q965X7_61_355_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.7537 2 182 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A538GAP3-F1-model_v4 Metal-dependent hydrolase 0.9632 108 184
AF-A0A3N5WY48-F1-model_v4 Metal-dependent hydrolase 0.9284 116 184
AF-A0A538GAP3-F1-model_v4 Metal-dependent hydrolase 0.9283 108 184
AF-X1TY65-F1-model_v4 Metallo-beta-lactamase domain-containing protein 0.9249 86 176
AF-T0ZPF7-F1-model_v4 Beta-lactamase domain protein 0.9224 100 184

Map