F419027

General Info

Members Datasets Scaffolds Average Seq Length
352 225 704 101

Family's Representative Sequence

Representative Sequence 3300014325|Ga0163163_11296053|Ga0163163_112960532
Length 120
Sequence MVGLTVAAPAPVVPTHIERIVMINVALLARLEAKPGKEAAVADLLRSALPLANAEPATAVWFALRIGPSTFGIFDAFADDAGRQAHLAGQIAAALMAKAPELLAQPPVIEQVDVLAAKLT

Samples

Sample ID Description Type Environment
1 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
77 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
78 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
79 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
80 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
111 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
115 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
116 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
117 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
118 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
119 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
120 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
121 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
122 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
123 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
124 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
125 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
126 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
127 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
128 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
129 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
130 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
131 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
132 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
135 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
136 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
137 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
138 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
139 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
140 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
141 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
142 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
143 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
144 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
145 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
146 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
147 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
148 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
149 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
150 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
151 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
152 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
153 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
154 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
155 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
156 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
157 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
158 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
159 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
160 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
161 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
162 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
163 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
164 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
165 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
166 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
167 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
168 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
169 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
170 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
171 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
172 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
173 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
174 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
175 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
176 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
177 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
178 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
194 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
195 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
196 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
197 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
198 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
199 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
200 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
201 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
202 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
203 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
204 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
205 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
206 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
207 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
210 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
211 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
212 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
213 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
214 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
215 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
216 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
217 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
218 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
219 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
220 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
221 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
222 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
223 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
224 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
225 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.84
Nodule 0
Rhizoplane 6.53
Rhizosphere 87.5
Stem 0
Stem Tuber 0
Unclassified 14.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163163_11296053 3300014325 Bacteria 790
2 JGI25406J46586_10010588 3300003203 Bacteria 4088
3 JGI25153J46596_10004020 3300003215 Bacteria 8022
4 rootH2_10104970 3300003320 Bacteria 10781
5 rootH2_10127790 3300003320 Bacteria 2002
6 rootH1_10051731 3300003323 Bacteria 10002
7 Ga0065704_10073259 3300005289 Bacteria 7371
8 Ga0070683_100376280 3300005329 Unclassified 1353
9 Ga0070670_100364445 3300005331 Bacteria 1271
10 Ga0068869_100083948 3300005334 Bacteria 2383
11 Ga0070680_100434714 3300005336 Bacteria 1120
12 Ga0070682_100279986 3300005337 Bacteria 1215
13 Ga0068868_100072388 3300005338 Bacteria 2750
14 Ga0068868_102355907 3300005338 Bacteria 508
15 Ga0068868_102439314 3300005338 Unclassified 500
16 Ga0070660_101556901 3300005339 Bacteria 562
17 Ga0070661_100529686 3300005344 Bacteria 946
18 Ga0070675_101693410 3300005354 Unclassified 583
19 Ga0070671_100017706 3300005355 Bacteria 5774
20 Ga0070674_100368420 3300005356 Bacteria 1165
21 Ga0070659_100070683 3300005366 Bacteria 2774
22 Ga0070667_100055970 3300005367 Bacteria 3331
23 Ga0070709_11262499 3300005434 Unclassified 595
24 Ga0070713_100069756 3300005436 Bacteria 2965
25 Ga0070713_102450865 3300005436 Bacteria 504
26 Ga0070701_10461545 3300005438 Bacteria 817
27 Ga0070711_100011764 3300005439 Bacteria 5443
28 Ga0070700_101066377 3300005441 Bacteria 668
29 Ga0070700_101112351 3300005441 Bacteria 655
30 Ga0070700_101534441 3300005441 Bacteria 567
31 Ga0070694_100988840 3300005444 Bacteria 698
32 Ga0070694_101730827 3300005444 Unclassified 532
33 Ga0070708_100699339 3300005445 Unclassified 954
34 Ga0070678_100100330 3300005456 Bacteria 2242
35 Ga0070678_101121155 3300005456 Bacteria 727
36 Ga0070681_10069384 3300005458 Bacteria 3491
37 Ga0070685_10808623 3300005466 Bacteria 691
38 Ga0070706_100378909 3300005467 Bacteria 1318
39 Ga0070706_100452987 3300005467 Bacteria 1194
40 Ga0070706_101318334 3300005467 Bacteria 662
41 Ga0070707_100597536 3300005468 Bacteria 1066
42 Ga0070698_101065593 3300005471 Bacteria 756
43 Ga0070679_101163876 3300005530 Bacteria 716
44 Ga0070684_100001468 3300005535 Bacteria 17003
45 Ga0070684_100288517 3300005535 Unclassified 1504
46 Ga0068853_101057051 3300005539 Bacteria 782
47 Ga0070672_100137044 3300005543 Bacteria 2016
48 Ga0070672_100497708 3300005543 Bacteria 1054
49 Ga0070686_100242698 3300005544 Bacteria 1312
50 Ga0070695_100183038 3300005545 Bacteria 1486
51 Ga0070693_100243400 3300005547 Bacteria 1189
52 Ga0070665_100364434 3300005548 Bacteria 1451
53 Ga0070665_100799833 3300005548 Bacteria 956
54 Ga0070664_101440338 3300005564 Bacteria 651
55 Ga0068852_100431565 3300005616 Bacteria 1301
56 Ga0068859_100482352 3300005617 Bacteria 1335
57 Ga0068859_101204267 3300005617 Unclassified 834
58 Ga0068864_100113171 3300005618 Bacteria 2419
59 Ga0068864_100880790 3300005618 Bacteria 883
60 Ga0068863_100079606 3300005841 Bacteria 3103
61 Ga0068858_102568415 3300005842 Bacteria 503
62 Ga0068860_100008475 3300005843 Bacteria 10246
63 Ga0068860_100802756 3300005843 Unclassified 954
64 Ga0068862_100473521 3300005844 Bacteria 1184
65 Ga0081539_10001628 3300005985 Bacteria 36740
66 Ga0081539_10060953 3300005985 Unclassified 2069
67 Ga0070717_10117488 3300006028 Bacteria 2275
68 Ga0070717_10599933 3300006028 Bacteria 999
69 Ga0070717_11185045 3300006028 Bacteria 695
70 Ga0070712_100359136 3300006175 Unclassified 1194
71 Ga0075367_10066055 3300006178 Unclassified 2167
72 Ga0075428_100020323 3300006844 Bacteria 7353
73 Ga0075428_101399889 3300006844 Bacteria 734
74 Ga0075430_100004507 3300006846 Bacteria 11742
75 Ga0075431_100017080 3300006847 Bacteria 7372
76 Ga0075431_100255814 3300006847 Bacteria 1778
77 Ga0075431_101414729 3300006847 Bacteria 655
78 Ga0075433_10714395 3300006852 Unclassified 877
79 Ga0075434_100122574 3300006871 Bacteria 2615
80 Ga0075429_100270353 3300006880 Bacteria 1489
81 Ga0075429_100773272 3300006880 Bacteria 841
82 Ga0068865_100398885 3300006881 Bacteria 1126
83 Ga0097620_100482323 3300006931 Bacteria 1335
84 Ga0097620_101203997 3300006931 Unclassified 834
85 Ga0099795_10051866 3300007788 Bacteria 1497
86 Ga0105240_11993385 3300009093 Unclassified 603
87 Ga0111539_10001735 3300009094 Bacteria 28968
88 Ga0111539_12156603 3300009094 Unclassified 646
89 Ga0105245_11955151 3300009098 Bacteria 640
90 Ga0105245_12427478 3300009098 Bacteria 578
91 Ga0105247_10015695 3300009101 Bacteria 4535
92 Ga0114129_10085739 3300009147 Bacteria 4369
93 Ga0114129_10100999 3300009147 Bacteria 3991
94 Ga0114129_10155496 3300009147 Bacteria 3127
95 Ga0114129_11284475 3300009147 Bacteria 908
96 Ga0105248_10029569 3300009177 Bacteria 6113
97 Ga0105248_10062547 3300009177 Bacteria 4179
98 Ga0105249_12955555 3300009553 Bacteria 546
99 Ga0105246_11000437 3300011119 Bacteria 757
100 Ga0163162_11376608 3300013306 Bacteria 802
101 Ga0157375_10050483 3300013308 Unclassified 4080
102 Ga0157375_12939903 3300013308 Bacteria 569
103 Ga0163163_11177185 3300014325 Bacteria 829
104 Ga0157380_11971434 3300014326 Bacteria 645
105 Ga0157377_10232140 3300014745 Bacteria 1187
106 Ga0157379_10235126 3300014968 Bacteria 1662
107 Ga0157379_10276757 3300014968 Bacteria 1527
108 Ga0157376_10574469 3300014969 Bacteria 1119
109 Ga0213872_10001283 3300021361 Bacteria 16809
110 Ga0213876_10123841 3300021384 Bacteria 1373
111 Ga0209129_1020970 3300025258 Bacteria 1206
112 Ga0209758_1000232 3300025297 Bacteria 117382
113 Ga0207710_10012027 3300025900 Bacteria 3638
114 Ga0207699_11467865 3300025906 Unclassified 504
115 Ga0207645_10639848 3300025907 Bacteria 722
116 Ga0207643_10086351 3300025908 Bacteria 1823
117 Ga0207684_10235680 3300025910 Unclassified 1579
118 Ga0207684_10717318 3300025910 Bacteria 849
119 Ga0207684_11154562 3300025910 Bacteria 643
120 Ga0207707_10276775 3300025912 Bacteria 1454
121 Ga0207693_11197823 3300025915 Unclassified 573
122 Ga0207663_10040949 3300025916 Bacteria 2819
123 Ga0207660_10162260 3300025917 Bacteria 1725
124 Ga0207649_10427513 3300025920 Bacteria 996
125 Ga0207649_10476662 3300025920 Bacteria 946
126 Ga0207646_10552005 3300025922 Unclassified 1036
127 Ga0207650_10007799 3300025925 Bacteria 7298
128 Ga0207650_10253130 3300025925 Bacteria 1426
129 Ga0207650_10418627 3300025925 Bacteria 1111
130 Ga0207659_11380460 3300025926 Bacteria 604
131 Ga0207687_11813415 3300025927 Bacteria 522
132 Ga0207644_10180351 3300025931 Bacteria 1654
133 Ga0207690_10015894 3300025932 Bacteria 4570
134 Ga0207669_11415063 3300025937 Bacteria 592
135 Ga0207691_10169115 3300025940 Bacteria 1915
136 Ga0207711_10073625 3300025941 Unclassified 2969
137 Ga0207711_10132239 3300025941 Bacteria 2238
138 Ga0207689_10097857 3300025942 Bacteria 2410
139 Ga0207661_10022354 3300025944 Bacteria 4761
140 Ga0207661_10363105 3300025944 Unclassified 1308
141 Ga0207679_11320555 3300025945 Bacteria 662
142 Ga0207658_10570821 3300025986 Bacteria 1014
143 Ga0207677_10051934 3300026023 Bacteria 2782
144 Ga0207677_10138287 3300026023 Bacteria 1861
145 Ga0207677_11285200 3300026023 Bacteria 672
146 Ga0207703_12053226 3300026035 Bacteria 548
147 Ga0207639_10243845 3300026041 Bacteria 1564
148 Ga0207641_12390142 3300026088 Bacteria 527
149 Ga0207676_10012367 3300026095 Bacteria 6114
150 Ga0207676_10544312 3300026095 Bacteria 1108
151 Ga0207676_11022221 3300026095 Bacteria 815
152 Ga0207676_11028896 3300026095 Bacteria 812
153 Ga0207683_10593281 3300026121 Bacteria 1025
154 Ga0207698_11254308 3300026142 Bacteria 756
155 Ga0207428_10013625 3300027907 Bacteria 7093
156 Ga0268266_11706563 3300028379 Unclassified 605
157 Ga0268266_11862198 3300028379 Bacteria 576
158 Ga0268265_10428937 3300028380 Bacteria 1229
159 Ga0268265_12660359 3300028380 Bacteria 506
160 Ga0268264_10010657 3300028381 Bacteria 7597
161 Ga0268264_10587450 3300028381 Bacteria 1096
162 Ga0307515_10000283 3300028794 Bacteria 124822
163 Ga0265331_10090637 3300031250 Unclassified 1413
164 Ga0307408_100436788 3300031548 Unclassified 1132
165 Ga0265313_10116085 3300031595 Unclassified 1172
166 Ga0316575_10118931 3300031665 Bacteria 1080
167 Ga0307405_10091349 3300031731 Bacteria 2017
168 Ga0307410_10445252 3300031852 Bacteria 1055
169 Ga0307406_10545835 3300031901 Unclassified 947
170 Ga0307407_10312337 3300031903 Unclassified 1100
171 Ga0307412_10650335 3300031911 Bacteria 899
172 Ga0307416_100050018 3300032002 Bacteria 3328
173 Ga0307416_100669238 3300032002 Unclassified 1124
174 Ga0307416_103744391 3300032002 Bacteria 509
175 Ga0307411_10390089 3300032005 Bacteria 1148
176 Ga0307411_12291097 3300032005 Unclassified 507
177 Ga0307415_100056354 3300032126 Bacteria 2694
178 Ga0307415_100084672 3300032126 Bacteria 2275
179 Ga0373935_0684606 3300035692 Bacteria 754
180 Ga0373927_0215417 3300035695 Bacteria 1261
181 Ga0373937_0785116 3300036401 Bacteria 900
182 Ga0395900_0061760 3300037418 Bacteria 3852
183 Ga0395900_1677833 3300037418 Bacteria 546
184 Ga0395898_0098731 3300037466 Bacteria 2804
185 Ga0395898_0182567 3300037466 Bacteria 2005
186 Ga0395898_0334379 3300037466 Unclassified 1444
187 Ga0395905_0001316 3300037471 Bacteria 30508
188 Ga0395905_0031787 3300037471 Bacteria 4967
189 Ga0395905_0314115 3300037471 Unclassified 1456
190 Ga0395901_0018048 3300038443 Bacteria 7202
191 Ga0436365_0939820 3300039437 Bacteria 2418
192 Ga0436365_0968814 3300039437 Bacteria 1475
193 Ga0436360_0361262 3300039438 Unclassified 1459
194 Ga0436361_0353883 3300039447 Unclassified 2926
195 Ga0436361_1079117 3300039447 Bacteria 6729
196 Ga0451807_1061050 3300041486 Bacteria 772
197 Ga0451849_0871312 3300041505 Unclassified 616
198 Ga0451853_2302712 3300041512 Bacteria 933
199 Ga0439443_017239 3300042003 Bacteria 1110
200 Ga0439443_018171 3300042003 Bacteria 1087
201 Ga0439448_0009023 3300042005 Bacteria 2932
202 Ga0439448_0019013 3300042005 Bacteria 2111
203 Ga0439448_0026857 3300042005 Bacteria 1812
204 Ga0439448_0032790 3300042005 Unclassified 1654
205 Ga0439448_0067258 3300042005 Bacteria 1190
206 Ga0439450_063235 3300042008 Bacteria 898
207 Ga0439450_174502 3300042008 Bacteria 569
208 Ga0439451_079986 3300042009 Bacteria 656
209 Ga0439454_000174 3300042011 Bacteria 4441
210 Ga0439455_0007168 3300042012 Bacteria 2349
211 Ga0439456_120854 3300042013 Unclassified 600
212 Ga0439463_001605 3300042016 Bacteria 5956
213 Ga0439463_012440 3300042016 Bacteria 2092
214 Ga0450912_020275 3300042116 Unclassified 639
215 Ga0450888_023520 3300042126 Bacteria 796
216 Ga0450888_041211 3300042126 Bacteria 642
217 Ga0450905_021703 3300042142 Bacteria 951
218 Ga0439458_0024119 3300042157 Bacteria 1421
219 Ga0439435_0016026 3300042436 Unclassified 1874
220 Ga0439444_0045498 3300042437 Bacteria 876
221 Ga0439460_0020908 3300042461 Bacteria 1783
222 Ga0439460_0049381 3300042461 Unclassified 1258
223 Ga0439460_0162700 3300042461 Bacteria 749
224 Ga0450916_003053 3300042530 Bacteria 1817
225 Ga0451577_0000193 3300042876 Bacteria 128594
226 Ga0439440_0004022 3300042993 Bacteria 2874
227 Ga0439440_0025359 3300042993 Unclassified 1365
228 Ga0453683_0036239 3300044673 Unclassified 3104
229 Ga0453684_0001333 3300044712 Bacteria 72470
230 Ga0466967_2097556 3300045976 Bacteria 562
231 Ga0495632_0002601 3300046519 Bacteria 13612
232 Ga0495656_0815874 3300046615 Bacteria 504
233 Ga0496101_0030085 3300048904 Bacteria 3804
234 Ga0496102_0696684 3300048905 Bacteria 939
235 Ga0496102_1519851 3300048905 Bacteria 588
236 Ga0496104_0167961 3300048907 Bacteria 2104
237 Ga0496104_0266717 3300048907 Bacteria 1625
238 Ga0496104_0683790 3300048907 Bacteria 934
239 Ga0496105_0058511 3300048908 Bacteria 3181
240 Ga0496105_0302357 3300048908 Bacteria 1286
241 Ga0496106_0249597 3300048909 Bacteria 1419
242 Ga0496107_0088986 3300048910 Bacteria 2254
243 Ga0496108_0080238 3300048911 Bacteria 2764
244 Ga0496109_0176086 3300048912 Bacteria 2008
245 Ga0496109_1431029 3300048912 Bacteria 627
246 Ga0496110_0195530 3300048913 Bacteria 1837
247 Ga0496110_1303024 3300048913 Bacteria 636
248 Ga0496111_0112924 3300048914 Bacteria 2002
249 Ga0496112_0296391 3300048915 Bacteria 1563
250 Ga0496112_0315525 3300048915 Bacteria 1508
251 Ga0496113_0172456 3300048916 Bacteria 1713
252 Ga0496114_0001455 3300048917 Bacteria 17977
253 Ga0496114_0997211 3300048917 Unclassified 721
254 Ga0496115_0022024 3300048918 Bacteria 4930
255 Ga0496126_0142955 3300048929 Bacteria 2058
256 Ga0496126_0935668 3300048929 Bacteria 655
257 Ga0501031_0000148 3300049568 Bacteria 39557
258 Ga0501031_0139815 3300049568 Unclassified 1582
259 Ga0501032_0044262 3300049569 Bacteria 3014
260 Ga0501033_0013936 3300049570 Bacteria 6118
261 Ga0501033_0129456 3300049570 Bacteria 1829
262 Ga0501034_0164878 3300049571 Bacteria 2185
263 Ga0501036_0000865 3300049572 Bacteria 22536
264 Ga0501036_0328718 3300049572 Unclassified 1277
265 Ga0501037_0016803 3300049573 Bacteria 5383
266 Ga0501037_0207071 3300049573 Bacteria 1384
267 Ga0501038_0011508 3300049574 Bacteria 8073
268 Ga0501038_0050629 3300049574 Bacteria 3588
269 Ga0501039_0000215 3300049575 Bacteria 42445
270 Ga0501039_0072049 3300049575 Unclassified 2685
271 Ga0501040_0000445 3300049576 Bacteria 24584
272 Ga0501040_0003726 3300049576 Bacteria 9880
273 Ga0501041_0000399 3300049577 Bacteria 21882
274 Ga0501041_0003048 3300049577 Bacteria 9615
275 Ga0501041_0105054 3300049577 Bacteria 1750
276 Ga0501042_0000307 3300049578 Bacteria 24420
277 Ga0501042_0003591 3300049578 Bacteria 9781
278 Ga0501043_0047636 3300049579 Bacteria 3370
279 Ga0501043_0203178 3300049579 Bacteria 1537
280 Ga0501046_0000358 3300049580 Bacteria 46105
281 Ga0501046_0007713 3300049580 Bacteria 9435
282 Ga0501046_1156881 3300049580 Bacteria 533
283 Ga0501047_0608329 3300049581 Bacteria 914
284 Ga0501048_0001720 3300049582 Bacteria 16680
285 Ga0501048_0005137 3300049582 Bacteria 9969
286 Ga0501067_0007923 3300049583 Bacteria 5901
287 Ga0501068_0019412 3300049584 Bacteria 3947
288 Ga0501068_1106608 3300049584 Bacteria 524
289 Ga0501070_0255119 3300049586 Bacteria 1434
290 Ga0501070_0377306 3300049586 Bacteria 1149
291 Ga0501071_0000697 3300049587 Bacteria 17599
292 Ga0501071_0047982 3300049587 Unclassified 3069
293 Ga0501071_0732705 3300049587 Bacteria 761
294 Ga0501072_0002201 3300049588 Bacteria 14560
295 Ga0501072_0004762 3300049588 Bacteria 10334
296 Ga0501073_0006151 3300049589 Bacteria 8957
297 Ga0501073_0128028 3300049589 Bacteria 1760
298 Ga0501073_0402287 3300049589 Bacteria 946
299 Ga0501074_0009407 3300049590 Bacteria 7103
300 Ga0501074_0148164 3300049590 Bacteria 1678
301 Ga0501075_0000503 3300049591 Bacteria 23484
302 Ga0501076_0000662 3300049592 Bacteria 22063
303 Ga0501076_0000924 3300049592 Bacteria 19165
304 Ga0501076_1319462 3300049592 Bacteria 593
305 Ga0501077_0003345 3300049593 Bacteria 9636
306 Ga0501077_0006158 3300049593 Bacteria 7327
307 Ga0501079_0004659 3300049741 Bacteria 10158
308 Ga0501079_0010608 3300049741 Bacteria 7011
309 Ga0501080_0110139 3300049742 Bacteria 2552
310 Ga0501080_0186859 3300049742 Bacteria 1905
311 Ga0501081_0003252 3300049743 Bacteria 10342
312 Ga0501081_0009365 3300049743 Bacteria 6382
313 Ga0501081_0012163 3300049743 Bacteria 5645
314 Ga0501083_0228048 3300049744 Bacteria 1213
315 Ga0501035_0007971 3300049822 Bacteria 9878
316 Ga0501035_0042508 3300049822 Bacteria 4099
317 Ga0501035_1565860 3300049822 Bacteria 501
318 Ga0501044_0384997 3300049823 Bacteria 1317
319 Ga0501044_1435936 3300049823 Bacteria 555
320 Ga0501045_0000287 3300049824 Bacteria 29593
321 Ga0501045_0030592 3300049824 Bacteria 3897
322 Ga0501045_0518418 3300049824 Bacteria 885
323 nmdc:mga06z11_652305_c1 3300050494 Unclassified 641
324 nmdc:mga05p37_1043616_c1 3300050507 Bacteria 863
325 nmdc:mga05p37_253893_c1 3300050507 Bacteria 2108
326 nmdc:mga05p37_287660_c1 3300050507 Bacteria 1957
327 nmdc:mga05p37_412955_c1 3300050507 Bacteria 1573
328 nmdc:mga09592_1112701_c1 3300050508 Bacteria 656
329 nmdc:mga09592_210940_c1 3300050508 Bacteria 1682
330 nmdc:mga0qj67_121532_c1 3300050509 Bacteria 2113
331 nmdc:mga0qj67_8729_c1 3300050509 Bacteria 7525
332 nmdc:mga06r32_1013925_c1 3300050510 Bacteria 782
333 nmdc:mga06r32_219219_c1 3300050510 Bacteria 1891
334 nmdc:mga06r32_296342_c1 3300050510 Unclassified 1604
335 nmdc:mga06r32_36907_c1 3300050510 Bacteria 4622
336 nmdc:mga0a205_41601_c1 3300050515 Bacteria 4426
337 nmdc:mga0a205_946146_c1 3300050515 Unclassified 708
338 Ga0495612_0081026 3300053078 Bacteria 1364
339 Ga0500578_0562556 3300053086 Bacteria 632
340 Ga0500562_016433 3300053108 Bacteria 1903
341 Ga0500568_0078374 3300053139 Unclassified 1256
342 Ga0500588_0007584 3300053146 Bacteria 2506
343 Ga0500622_0068127 3300053156 Bacteria 1804
344 Ga0501084_0000846 3300054114 Bacteria 23651
345 Ga0501084_0021052 3300054114 Bacteria 5440
346 Ga0501084_0523966 3300054114 Bacteria 1002
347 Ga0590075_013754 3300059424 Bacteria 1975
348 Ga0501082_0008827 3300060353 Bacteria 8692
349 Ga0501082_0026150 3300060353 Bacteria 5030
350 Ga0501082_0126331 3300060353 Bacteria 2218
351 Ga0530510_0004072 3300061734 Bacteria 10091
352 Ga0530510_0006150 3300061734 Bacteria 8338
353 Ga0163163_11296053
354 JGI25406J46586_10010588
355 JGI25153J46596_10004020
356 rootH2_10104970
357 rootH2_10127790
358 rootH1_10051731
359 Ga0065704_10073259
360 Ga0070683_100376280
361 Ga0070670_100364445
362 Ga0068869_100083948
363 Ga0070680_100434714
364 Ga0070682_100279986
365 Ga0068868_100072388
366 Ga0068868_102355907
367 Ga0068868_102439314
368 Ga0070660_101556901
369 Ga0070661_100529686
370 Ga0070675_101693410
371 Ga0070671_100017706
372 Ga0070674_100368420
373 Ga0070659_100070683
374 Ga0070667_100055970
375 Ga0070709_11262499
376 Ga0070713_100069756
377 Ga0070713_102450865
378 Ga0070701_10461545
379 Ga0070711_100011764
380 Ga0070700_101066377
381 Ga0070700_101112351
382 Ga0070700_101534441
383 Ga0070694_100988840
384 Ga0070694_101730827
385 Ga0070708_100699339
386 Ga0070678_100100330
387 Ga0070678_101121155
388 Ga0070681_10069384
389 Ga0070685_10808623
390 Ga0070706_100378909
391 Ga0070706_100452987
392 Ga0070706_101318334
393 Ga0070707_100597536
394 Ga0070698_101065593
395 Ga0070679_101163876
396 Ga0070684_100001468
397 Ga0070684_100288517
398 Ga0068853_101057051
399 Ga0070672_100137044
400 Ga0070672_100497708
401 Ga0070686_100242698
402 Ga0070695_100183038
403 Ga0070693_100243400
404 Ga0070665_100364434
405 Ga0070665_100799833
406 Ga0070664_101440338
407 Ga0068852_100431565
408 Ga0068859_100482352
409 Ga0068859_101204267
410 Ga0068864_100113171
411 Ga0068864_100880790
412 Ga0068863_100079606
413 Ga0068858_102568415
414 Ga0068860_100008475
415 Ga0068860_100802756
416 Ga0068862_100473521
417 Ga0081539_10001628
418 Ga0081539_10060953
419 Ga0070717_10117488
420 Ga0070717_10599933
421 Ga0070717_11185045
422 Ga0070712_100359136
423 Ga0075367_10066055
424 Ga0075428_100020323
425 Ga0075428_101399889
426 Ga0075430_100004507
427 Ga0075431_100017080
428 Ga0075431_100255814
429 Ga0075431_101414729
430 Ga0075433_10714395
431 Ga0075434_100122574
432 Ga0075429_100270353
433 Ga0075429_100773272
434 Ga0068865_100398885
435 Ga0097620_100482323
436 Ga0097620_101203997
437 Ga0099795_10051866
438 Ga0105240_11993385
439 Ga0111539_10001735
440 Ga0111539_12156603
441 Ga0105245_11955151
442 Ga0105245_12427478
443 Ga0105247_10015695
444 Ga0114129_10085739
445 Ga0114129_10100999
446 Ga0114129_10155496
447 Ga0114129_11284475
448 Ga0105248_10029569
449 Ga0105248_10062547
450 Ga0105249_12955555
451 Ga0105246_11000437
452 Ga0163162_11376608
453 Ga0157375_10050483
454 Ga0157375_12939903
455 Ga0163163_11177185
456 Ga0157380_11971434
457 Ga0157377_10232140
458 Ga0157379_10235126
459 Ga0157379_10276757
460 Ga0157376_10574469
461 Ga0213872_10001283
462 Ga0213876_10123841
463 Ga0209129_1020970
464 Ga0209758_1000232
465 Ga0207710_10012027
466 Ga0207699_11467865
467 Ga0207645_10639848
468 Ga0207643_10086351
469 Ga0207684_10235680
470 Ga0207684_10717318
471 Ga0207684_11154562
472 Ga0207707_10276775
473 Ga0207693_11197823
474 Ga0207663_10040949
475 Ga0207660_10162260
476 Ga0207649_10427513
477 Ga0207649_10476662
478 Ga0207646_10552005
479 Ga0207650_10007799
480 Ga0207650_10253130
481 Ga0207650_10418627
482 Ga0207659_11380460
483 Ga0207687_11813415
484 Ga0207644_10180351
485 Ga0207690_10015894
486 Ga0207669_11415063
487 Ga0207691_10169115
488 Ga0207711_10073625
489 Ga0207711_10132239
490 Ga0207689_10097857
491 Ga0207661_10022354
492 Ga0207661_10363105
493 Ga0207679_11320555
494 Ga0207658_10570821
495 Ga0207677_10051934
496 Ga0207677_10138287
497 Ga0207677_11285200
498 Ga0207703_12053226
499 Ga0207639_10243845
500 Ga0207641_12390142
501 Ga0207676_10012367
502 Ga0207676_10544312
503 Ga0207676_11022221
504 Ga0207676_11028896
505 Ga0207683_10593281
506 Ga0207698_11254308
507 Ga0207428_10013625
508 Ga0268266_11706563
509 Ga0268266_11862198
510 Ga0268265_10428937
511 Ga0268265_12660359
512 Ga0268264_10010657
513 Ga0268264_10587450
514 Ga0307515_10000283
515 Ga0265331_10090637
516 Ga0307408_100436788
517 Ga0265313_10116085
518 Ga0316575_10118931
519 Ga0307405_10091349
520 Ga0307410_10445252
521 Ga0307406_10545835
522 Ga0307407_10312337
523 Ga0307412_10650335
524 Ga0307416_100050018
525 Ga0307416_100669238
526 Ga0307416_103744391
527 Ga0307411_10390089
528 Ga0307411_12291097
529 Ga0307415_100056354
530 Ga0307415_100084672
531 Ga0373935_0684606
532 Ga0373927_0215417
533 Ga0373937_0785116
534 Ga0395900_0061760
535 Ga0395900_1677833
536 Ga0395898_0098731
537 Ga0395898_0182567
538 Ga0395898_0334379
539 Ga0395905_0001316
540 Ga0395905_0031787
541 Ga0395905_0314115
542 Ga0395901_0018048
543 Ga0436365_0939820
544 Ga0436365_0968814
545 Ga0436360_0361262
546 Ga0436361_0353883
547 Ga0436361_1079117
548 Ga0451807_1061050
549 Ga0451849_0871312
550 Ga0451853_2302712
551 Ga0439443_017239
552 Ga0439443_018171
553 Ga0439448_0009023
554 Ga0439448_0019013
555 Ga0439448_0026857
556 Ga0439448_0032790
557 Ga0439448_0067258
558 Ga0439450_063235
559 Ga0439450_174502
560 Ga0439451_079986
561 Ga0439454_000174
562 Ga0439455_0007168
563 Ga0439456_120854
564 Ga0439463_001605
565 Ga0439463_012440
566 Ga0450912_020275
567 Ga0450888_023520
568 Ga0450888_041211
569 Ga0450905_021703
570 Ga0439458_0024119
571 Ga0439435_0016026
572 Ga0439444_0045498
573 Ga0439460_0020908
574 Ga0439460_0049381
575 Ga0439460_0162700
576 Ga0450916_003053
577 Ga0451577_0000193
578 Ga0439440_0004022
579 Ga0439440_0025359
580 Ga0453683_0036239
581 Ga0453684_0001333
582 Ga0466967_2097556
583 Ga0495632_0002601
584 Ga0495656_0815874
585 Ga0496101_0030085
586 Ga0496102_0696684
587 Ga0496102_1519851
588 Ga0496104_0167961
589 Ga0496104_0266717
590 Ga0496104_0683790
591 Ga0496105_0058511
592 Ga0496105_0302357
593 Ga0496106_0249597
594 Ga0496107_0088986
595 Ga0496108_0080238
596 Ga0496109_0176086
597 Ga0496109_1431029
598 Ga0496110_0195530
599 Ga0496110_1303024
600 Ga0496111_0112924
601 Ga0496112_0296391
602 Ga0496112_0315525
603 Ga0496113_0172456
604 Ga0496114_0001455
605 Ga0496114_0997211
606 Ga0496115_0022024
607 Ga0496126_0142955
608 Ga0496126_0935668
609 Ga0501031_0000148
610 Ga0501031_0139815
611 Ga0501032_0044262
612 Ga0501033_0013936
613 Ga0501033_0129456
614 Ga0501034_0164878
615 Ga0501036_0000865
616 Ga0501036_0328718
617 Ga0501037_0016803
618 Ga0501037_0207071
619 Ga0501038_0011508
620 Ga0501038_0050629
621 Ga0501039_0000215
622 Ga0501039_0072049
623 Ga0501040_0000445
624 Ga0501040_0003726
625 Ga0501041_0000399
626 Ga0501041_0003048
627 Ga0501041_0105054
628 Ga0501042_0000307
629 Ga0501042_0003591
630 Ga0501043_0047636
631 Ga0501043_0203178
632 Ga0501046_0000358
633 Ga0501046_0007713
634 Ga0501046_1156881
635 Ga0501047_0608329
636 Ga0501048_0001720
637 Ga0501048_0005137
638 Ga0501067_0007923
639 Ga0501068_0019412
640 Ga0501068_1106608
641 Ga0501070_0255119
642 Ga0501070_0377306
643 Ga0501071_0000697
644 Ga0501071_0047982
645 Ga0501071_0732705
646 Ga0501072_0002201
647 Ga0501072_0004762
648 Ga0501073_0006151
649 Ga0501073_0128028
650 Ga0501073_0402287
651 Ga0501074_0009407
652 Ga0501074_0148164
653 Ga0501075_0000503
654 Ga0501076_0000662
655 Ga0501076_0000924
656 Ga0501076_1319462
657 Ga0501077_0003345
658 Ga0501077_0006158
659 Ga0501079_0004659
660 Ga0501079_0010608
661 Ga0501080_0110139
662 Ga0501080_0186859
663 Ga0501081_0003252
664 Ga0501081_0009365
665 Ga0501081_0012163
666 Ga0501083_0228048
667 Ga0501035_0007971
668 Ga0501035_0042508
669 Ga0501035_1565860
670 Ga0501044_0384997
671 Ga0501044_1435936
672 Ga0501045_0000287
673 Ga0501045_0030592
674 Ga0501045_0518418
675 nmdc:mga06z11_652305_c1
676 nmdc:mga05p37_1043616_c1
677 nmdc:mga05p37_253893_c1
678 nmdc:mga05p37_287660_c1
679 nmdc:mga05p37_412955_c1
680 nmdc:mga09592_1112701_c1
681 nmdc:mga09592_210940_c1
682 nmdc:mga0qj67_121532_c1
683 nmdc:mga0qj67_8729_c1
684 nmdc:mga06r32_1013925_c1
685 nmdc:mga06r32_219219_c1
686 nmdc:mga06r32_296342_c1
687 nmdc:mga06r32_36907_c1
688 nmdc:mga0a205_41601_c1
689 nmdc:mga0a205_946146_c1
690 Ga0495612_0081026
691 Ga0500578_0562556
692 Ga0500562_016433
693 Ga0500568_0078374
694 Ga0500588_0007584
695 Ga0500622_0068127
696 Ga0501084_0000846
697 Ga0501084_0021052
698 Ga0501084_0523966
699 Ga0590075_013754
700 Ga0501082_0008827
701 Ga0501082_0026150
702 Ga0501082_0126331
703 Ga0530510_0004072
704 Ga0530510_0006150

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pd1-assembly1.cif.gz_A crystal structure of ne2512 protein of unknown function from nitrosomonas europaea 0.9739 8 108
2pd1-assembly1.cif.gz_A crystal structure of ne2512 protein of unknown function from nitrosomonas europaea 0.9463 8 108
2omo-assembly2.cif.gz_C putative antibiotic biosynthesis monooxygenase from nitrosomonas europaea 0.8781 11 102
2omo-assembly4.cif.gz_E putative antibiotic biosynthesis monooxygenase from nitrosomonas europaea 0.8763 12 103
4zos-assembly2.cif.gz_B 2.20 angstrom resolution crystal structure of protein ye0340 of unidentified function from yersinia enterocolitica subsp. enterocolitica 8081] 0.8755 9 103
ID Description Score Start End Superfamily
2pd1D01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.976 11 101 3.30.70.100
2pd1D01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9552 11 101 3.30.70.100
af_O33291_1_95_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8814 11 105 3.30.70.100
4zosB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8755 9 103 3.30.70.100
af_O33291_1_95_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8645 11 105 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A370FSH0-F1-model_v4 Quinol monooxygenase YgiN 0.9948 9 108 GO:0004497
AF-A0A4R0CYB2-F1-model_v4 Antibiotic biosynthesis monooxygenase 0.9942 15 105 GO:0004497
AF-A0A1Q3SGT5-F1-model_v4 Antibiotic biosynthesis monooxygenase 0.9941 9 108 GO:0004497
AF-A0A7I9ZDA1-F1-model_v4 Antibiotic biosynthesis monooxygenase 0.994 9 108
AF-A0A533BJI9-F1-model_v4 Antibiotic biosynthesis monooxygenase 0.9938 9 94 GO:0004497

Map