F418958
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 352 | 207 | 352 | 258 |
Family's Representative Sequence
| Representative Sequence | 3300005981|Ga0081538_10000963|Ga0081538_100009637 |
| Length | 242 |
| Sequence | VLPEINIGPLDLQTFGICFALAFLASGLIISRRLHELGKPVEWAYEMVFAALVGGLVGARVNYLIQNWDEVSDDLLGNIFSGSGLVFFGGLVGGALGVLLWAQMADAAAVPIAIGYAVGRVGCQLSGDGDYGIESDLPWAMAYPEGTVPTTEEVHPTPVYETVTIGIGALILWHLRDRFAPGVLFGLYLILTGGERFLVEFIRRNDSVVAGLTEPQLISLVVLALGAAIVTVRRAAPRAVTA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 3 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 24 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 28 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 29 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 30 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 31 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 32 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 33 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 34 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 35 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 36 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 37 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 38 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 41 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 42 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 43 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 44 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 46 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 106 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 109 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 110 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 111 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 112 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 113 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 114 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 115 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 116 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 117 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 118 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 119 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 120 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 121 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 122 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 123 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 124 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 125 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 126 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 127 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 128 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 129 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 130 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 131 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 153 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 154 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 155 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 156 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 157 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 158 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 159 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 160 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 161 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 162 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 163 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 164 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 165 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 166 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 167 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 168 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 169 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 170 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 171 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 172 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 173 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 174 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 175 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 176 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 177 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 178 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 179 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 180 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 181 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 182 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 183 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 184 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 185 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 186 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 187 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 188 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 189 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 190 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 191 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 192 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 193 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 194 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 195 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 196 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 197 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 198 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 199 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 200 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 204 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 205 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 206 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 207 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.85 |
| Nodule | 0 |
| Rhizoplane | 11.36 |
| Rhizosphere | 87.5 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.28 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1002401 | 3300000549 | Bacteria | 2608 |
| 2 | JGI24034J26672_10000738 | 3300002239 | Bacteria | 4216 |
| 3 | JGI25407J50210_10008326 | 3300003373 | Bacteria | 2614 |
| 4 | JGI25407J50210_10020834 | 3300003373 | Bacteria | 1705 |
| 5 | JGI25407J50210_10033982 | 3300003373 | Bacteria | 1316 |
| 6 | Ga0070683_100000331 | 3300005329 | Bacteria | 32634 |
| 7 | Ga0070683_100047183 | 3300005329 | Bacteria | 3980 |
| 8 | Ga0070670_100070481 | 3300005331 | Bacteria | 3001 |
| 9 | Ga0070677_10000030 | 3300005333 | Bacteria | 41834 |
| 10 | Ga0070666_10013945 | 3300005335 | Bacteria | 5108 |
| 11 | Ga0070680_100021103 | 3300005336 | Bacteria | 5173 |
| 12 | Ga0068868_100592866 | 3300005338 | Bacteria | 981 |
| 13 | Ga0070660_100031735 | 3300005339 | Bacteria | 3969 |
| 14 | Ga0070660_100285185 | 3300005339 | Bacteria | 1352 |
| 15 | Ga0070661_100003073 | 3300005344 | Bacteria | 11482 |
| 16 | Ga0070661_100376169 | 3300005344 | Bacteria | 1119 |
| 17 | Ga0070668_100438346 | 3300005347 | Bacteria | 1121 |
| 18 | Ga0070675_100000073 | 3300005354 | Bacteria | 57652 |
| 19 | Ga0070674_100001851 | 3300005356 | Bacteria | 11478 |
| 20 | Ga0070674_100017707 | 3300005356 | Bacteria | 4488 |
| 21 | Ga0070659_100030555 | 3300005366 | Bacteria | 4169 |
| 22 | Ga0070667_100603147 | 3300005367 | Bacteria | 1012 |
| 23 | Ga0070711_100006965 | 3300005439 | Bacteria | 6856 |
| 24 | Ga0070662_100004047 | 3300005457 | Bacteria | 9205 |
| 25 | Ga0070681_10032484 | 3300005458 | Bacteria | 5238 |
| 26 | Ga0070679_100114092 | 3300005530 | Bacteria | 2687 |
| 27 | Ga0070684_100008356 | 3300005535 | Bacteria | 8085 |
| 28 | Ga0070684_100018501 | 3300005535 | Bacteria | 5741 |
| 29 | Ga0070684_100150972 | 3300005535 | Bacteria | 2105 |
| 30 | Ga0070697_100275825 | 3300005536 | Unclassified | 1442 |
| 31 | Ga0068853_100080220 | 3300005539 | Bacteria | 2854 |
| 32 | Ga0068853_100216272 | 3300005539 | Bacteria | 1748 |
| 33 | Ga0070672_100000023 | 3300005543 | Bacteria | 68631 |
| 34 | Ga0070665_100005655 | 3300005548 | Bacteria | 12855 |
| 35 | Ga0070664_100104936 | 3300005564 | Bacteria | 2461 |
| 36 | Ga0070664_100107162 | 3300005564 | Bacteria | 2436 |
| 37 | Ga0070664_100430395 | 3300005564 | Bacteria | 1209 |
| 38 | Ga0068857_100111149 | 3300005577 | Bacteria | 2463 |
| 39 | Ga0068854_100151524 | 3300005578 | Bacteria | 1789 |
| 40 | Ga0068856_100159115 | 3300005614 | Bacteria | 2269 |
| 41 | Ga0068852_100110743 | 3300005616 | Bacteria | 2495 |
| 42 | Ga0068866_10027900 | 3300005718 | Bacteria | 2685 |
| 43 | Ga0068861_100058795 | 3300005719 | Bacteria | 2941 |
| 44 | Ga0068861_100237925 | 3300005719 | Bacteria | 1547 |
| 45 | Ga0068858_100000043 | 3300005842 | Bacteria | 132444 |
| 46 | Ga0081455_10127203 | 3300005937 | Bacteria | 1997 |
| 47 | Ga0081538_10000149 | 3300005981 | Bacteria | 72945 |
| 48 | Ga0081538_10000517 | 3300005981 | Bacteria | 43195 |
| 49 | Ga0081538_10000945 | 3300005981 | Bacteria | 31307 |
| 50 | Ga0081538_10000963 | 3300005981 | Bacteria | 30702 |
| 51 | Ga0081538_10001326 | 3300005981 | Bacteria | 25535 |
| 52 | Ga0081538_10006574 | 3300005981 | Bacteria | 10205 |
| 53 | Ga0081538_10014692 | 3300005981 | Bacteria | 6113 |
| 54 | Ga0081538_10016515 | 3300005981 | Bacteria | 5655 |
| 55 | Ga0081538_10021572 | 3300005981 | Bacteria | 4691 |
| 56 | Ga0081538_10026136 | 3300005981 | Bacteria | 4092 |
| 57 | Ga0081538_10038476 | 3300005981 | Bacteria | 3085 |
| 58 | Ga0081538_10066482 | 3300005981 | Bacteria | 2021 |
| 59 | Ga0081538_10072321 | 3300005981 | Bacteria | 1891 |
| 60 | Ga0081538_10115699 | 3300005981 | Unclassified | 1303 |
| 61 | Ga0081538_10130614 | 3300005981 | Bacteria | 1181 |
| 62 | Ga0081538_10130919 | 3300005981 | Bacteria | 1179 |
| 63 | Ga0075365_10178896 | 3300006038 | Bacteria | 1482 |
| 64 | Ga0075432_10092053 | 3300006058 | Bacteria | 1111 |
| 65 | Ga0070715_10000012 | 3300006163 | Bacteria | 173731 |
| 66 | Ga0070712_100030112 | 3300006175 | Bacteria | 3644 |
| 67 | Ga0075428_100017187 | 3300006844 | Bacteria | 7992 |
| 68 | Ga0075428_100062783 | 3300006844 | Bacteria | 4066 |
| 69 | Ga0075430_100002745 | 3300006846 | Bacteria | 14695 |
| 70 | Ga0075430_100012413 | 3300006846 | Bacteria | 7248 |
| 71 | Ga0075430_100026848 | 3300006846 | Bacteria | 4897 |
| 72 | Ga0075430_100103988 | 3300006846 | Bacteria | 2371 |
| 73 | Ga0075430_100215304 | 3300006846 | Bacteria | 1594 |
| 74 | Ga0075430_100405686 | 3300006846 | Bacteria | 1125 |
| 75 | Ga0075431_100003853 | 3300006847 | Bacteria | 14591 |
| 76 | Ga0075431_100023665 | 3300006847 | Bacteria | 6288 |
| 77 | Ga0075431_100216708 | 3300006847 | Bacteria | 1953 |
| 78 | Ga0075429_100012152 | 3300006880 | Bacteria | 7463 |
| 79 | Ga0097620_100750323 | 3300006931 | Bacteria | 1065 |
| 80 | Ga0075435_100701378 | 3300007076 | Bacteria | 880 |
| 81 | Ga0105240_10051664 | 3300009093 | Bacteria | 5171 |
| 82 | Ga0111539_10007192 | 3300009094 | Bacteria | 14262 |
| 83 | Ga0111539_10352108 | 3300009094 | Bacteria | 1714 |
| 84 | Ga0105245_10252501 | 3300009098 | Bacteria | 1714 |
| 85 | Ga0105245_10347688 | 3300009098 | Bacteria | 1468 |
| 86 | Ga0105247_10002347 | 3300009101 | Bacteria | 12921 |
| 87 | Ga0105247_10052054 | 3300009101 | Bacteria | 2523 |
| 88 | Ga0114129_10051681 | 3300009147 | Bacteria | 5769 |
| 89 | Ga0114129_10288437 | 3300009147 | Bacteria | 2191 |
| 90 | Ga0114129_10321571 | 3300009147 | Unclassified | 2057 |
| 91 | Ga0105243_10045575 | 3300009148 | Bacteria | 3446 |
| 92 | Ga0105243_10208730 | 3300009148 | Bacteria | 1718 |
| 93 | Ga0105242_10018654 | 3300009176 | Bacteria | 5427 |
| 94 | Ga0105248_10000466 | 3300009177 | Bacteria | 46063 |
| 95 | Ga0105248_10500987 | 3300009177 | Bacteria | 1369 |
| 96 | Ga0105237_10210161 | 3300009545 | Unclassified | 1946 |
| 97 | Ga0105238_10146290 | 3300009551 | Bacteria | 2340 |
| 98 | Ga0105249_10000192 | 3300009553 | Bacteria | 69997 |
| 99 | Ga0105249_10005193 | 3300009553 | Bacteria | 11239 |
| 100 | Ga0105239_10059329 | 3300010375 | Bacteria | 4199 |
| 101 | Ga0105239_10425498 | 3300010375 | Bacteria | 1505 |
| 102 | Ga0157371_10007237 | 3300013102 | Bacteria | 9013 |
| 103 | Ga0157370_10062919 | 3300013104 | Bacteria | 3517 |
| 104 | Ga0157369_10220149 | 3300013105 | Bacteria | 1987 |
| 105 | Ga0157374_10010028 | 3300013296 | Bacteria | 8132 |
| 106 | Ga0157378_10017735 | 3300013297 | Bacteria | 6249 |
| 107 | Ga0157378_10018698 | 3300013297 | Bacteria | 6091 |
| 108 | Ga0157372_10031712 | 3300013307 | Bacteria | 5787 |
| 109 | Ga0157375_10000322 | 3300013308 | Bacteria | 42941 |
| 110 | Ga0157379_10014324 | 3300014968 | Bacteria | 6958 |
| 111 | Ga0207682_10000003 | 3300025893 | Bacteria | 128548 |
| 112 | Ga0207642_10004304 | 3300025899 | Bacteria | 4588 |
| 113 | Ga0207710_10000422 | 3300025900 | Bacteria | 27760 |
| 114 | Ga0207688_10022707 | 3300025901 | Bacteria | 3435 |
| 115 | Ga0207680_10004531 | 3300025903 | Bacteria | 6593 |
| 116 | Ga0207685_10000001 | 3300025905 | Bacteria | 604473 |
| 117 | Ga0207705_10048398 | 3300025909 | Bacteria | 3058 |
| 118 | Ga0207707_10014354 | 3300025912 | Bacteria | 6899 |
| 119 | Ga0207695_10445753 | 3300025913 | Bacteria | 1178 |
| 120 | Ga0207693_10004469 | 3300025915 | Bacteria | 11824 |
| 121 | Ga0207663_10004537 | 3300025916 | Bacteria | 6914 |
| 122 | Ga0207660_10067054 | 3300025917 | Bacteria | 2598 |
| 123 | Ga0207657_10026111 | 3300025919 | Bacteria | 5373 |
| 124 | Ga0207657_10150926 | 3300025919 | Bacteria | 1893 |
| 125 | Ga0207649_10078909 | 3300025920 | Bacteria | 2125 |
| 126 | Ga0207652_10009003 | 3300025921 | Bacteria | 8045 |
| 127 | Ga0207681_10247815 | 3300025923 | Bacteria | 1390 |
| 128 | Ga0207694_10270640 | 3300025924 | Bacteria | 1393 |
| 129 | Ga0207650_10142591 | 3300025925 | Bacteria | 1885 |
| 130 | Ga0207659_10000082 | 3300025926 | Bacteria | 57573 |
| 131 | Ga0207687_10000012 | 3300025927 | Bacteria | 370729 |
| 132 | Ga0207690_10008712 | 3300025932 | Bacteria | 6019 |
| 133 | Ga0207690_10094235 | 3300025932 | Bacteria | 2124 |
| 134 | Ga0207690_10542030 | 3300025932 | Unclassified | 945 |
| 135 | Ga0207706_10021827 | 3300025933 | Bacteria | 5746 |
| 136 | Ga0207706_10112116 | 3300025933 | Bacteria | 2399 |
| 137 | Ga0207686_10041392 | 3300025934 | Bacteria | 2809 |
| 138 | Ga0207709_10015313 | 3300025935 | Bacteria | 4252 |
| 139 | Ga0207709_10084600 | 3300025935 | Bacteria | 2054 |
| 140 | Ga0207709_10138436 | 3300025935 | Bacteria | 1670 |
| 141 | Ga0207704_10343972 | 3300025938 | Bacteria | 1159 |
| 142 | Ga0207691_10000172 | 3300025940 | Bacteria | 60310 |
| 143 | Ga0207691_10438026 | 3300025940 | Bacteria | 1113 |
| 144 | Ga0207711_10000085 | 3300025941 | Bacteria | 99467 |
| 145 | Ga0207661_10000192 | 3300025944 | Bacteria | 39824 |
| 146 | Ga0207661_10007315 | 3300025944 | Bacteria | 7852 |
| 147 | Ga0207679_10081240 | 3300025945 | Bacteria | 2478 |
| 148 | Ga0207679_10101623 | 3300025945 | Bacteria | 2250 |
| 149 | Ga0207679_10113014 | 3300025945 | Bacteria | 2147 |
| 150 | Ga0207667_10408207 | 3300025949 | Bacteria | 1383 |
| 151 | Ga0207712_10000003 | 3300025961 | Bacteria | 615314 |
| 152 | Ga0207712_10055457 | 3300025961 | Bacteria | 2788 |
| 153 | Ga0207668_10001630 | 3300025972 | Bacteria | 13112 |
| 154 | Ga0207703_10000053 | 3300026035 | Bacteria | 143924 |
| 155 | Ga0207703_10321387 | 3300026035 | Bacteria | 1417 |
| 156 | Ga0207639_10180474 | 3300026041 | Bacteria | 1795 |
| 157 | Ga0207639_10346773 | 3300026041 | Bacteria | 1325 |
| 158 | Ga0207678_10128687 | 3300026067 | Bacteria | 2159 |
| 159 | Ga0207708_10007953 | 3300026075 | Bacteria | 7859 |
| 160 | Ga0207708_10045766 | 3300026075 | Bacteria | 3334 |
| 161 | Ga0207702_10642159 | 3300026078 | Bacteria | 1043 |
| 162 | Ga0207675_100007422 | 3300026118 | Bacteria | 10359 |
| 163 | Ga0207675_100015600 | 3300026118 | Bacteria | 7086 |
| 164 | Ga0207698_10087463 | 3300026142 | Bacteria | 2538 |
| 165 | Ga0207428_10077853 | 3300027907 | Bacteria | 2596 |
| 166 | Ga0268266_10000182 | 3300028379 | Bacteria | 111453 |
| 167 | Ga0268265_10418350 | 3300028380 | Bacteria | 1244 |
| 168 | Ga0268265_10536216 | 3300028380 | Bacteria | 1109 |
| 169 | Ga0265334_10094198 | 3300028573 | Bacteria | 1090 |
| 170 | Ga0265338_10319510 | 3300028800 | Bacteria | 1124 |
| 171 | Ga0307408_100067671 | 3300031548 | Bacteria | 2628 |
| 172 | Ga0307408_100070120 | 3300031548 | Bacteria | 2587 |
| 173 | Ga0316576_10481862 | 3300031727 | Bacteria | 914 |
| 174 | Ga0307405_10112811 | 3300031731 | Bacteria | 1845 |
| 175 | Ga0307405_10470546 | 3300031731 | Bacteria | 1001 |
| 176 | Ga0307413_10131032 | 3300031824 | Bacteria | 1716 |
| 177 | Ga0307413_10182704 | 3300031824 | Bacteria | 1497 |
| 178 | Ga0307410_10067489 | 3300031852 | Bacteria | 2468 |
| 179 | Ga0307410_10171912 | 3300031852 | Bacteria | 1633 |
| 180 | Ga0307410_10329106 | 3300031852 | Bacteria | 1214 |
| 181 | Ga0307406_10018107 | 3300031901 | Bacteria | 4110 |
| 182 | Ga0307406_10089557 | 3300031901 | Unclassified | 2068 |
| 183 | Ga0307406_10337113 | 3300031901 | Bacteria | 1173 |
| 184 | Ga0307407_10348261 | 3300031903 | Bacteria | 1048 |
| 185 | Ga0307412_10460437 | 3300031911 | Bacteria | 1050 |
| 186 | Ga0307409_100009575 | 3300031995 | Bacteria | 5964 |
| 187 | Ga0307409_100027311 | 3300031995 | Bacteria | 4043 |
| 188 | Ga0307409_100037460 | 3300031995 | Bacteria | 3576 |
| 189 | Ga0307409_100128230 | 3300031995 | Bacteria | 2162 |
| 190 | Ga0307409_100259365 | 3300031995 | Bacteria | 1594 |
| 191 | Ga0307409_100351602 | 3300031995 | Bacteria | 1391 |
| 192 | Ga0307409_100485696 | 3300031995 | Bacteria | 1199 |
| 193 | Ga0307416_100034835 | 3300032002 | Bacteria | 3837 |
| 194 | Ga0307416_100103029 | 3300032002 | Bacteria | 2490 |
| 195 | Ga0307416_100122374 | 3300032002 | Bacteria | 2322 |
| 196 | Ga0307416_100331242 | 3300032002 | Bacteria | 1530 |
| 197 | Ga0307416_100625422 | 3300032002 | Bacteria | 1159 |
| 198 | Ga0307411_10012199 | 3300032005 | Archaea | 4676 |
| 199 | Ga0307411_10100143 | 3300032005 | Bacteria | 2047 |
| 200 | Ga0307411_10610910 | 3300032005 | Bacteria | 939 |
| 201 | Ga0307415_100005179 | 3300032126 | Bacteria | 6885 |
| 202 | Ga0307415_100008232 | 3300032126 | Bacteria | 5770 |
| 203 | Ga0307415_100348767 | 3300032126 | Bacteria | 1245 |
| 204 | Ga0307415_100457764 | 3300032126 | Bacteria | 1105 |
| 205 | Ga0373962_0019252 | 3300035242 | Bacteria | 1784 |
| 206 | Ga0373931_0084136 | 3300035691 | Bacteria | 1761 |
| 207 | Ga0395899_0338384 | 3300037312 | Bacteria | 1009 |
| 208 | Ga0395900_0174114 | 3300037418 | Bacteria | 2189 |
| 209 | Ga0395900_0617949 | 3300037418 | Bacteria | 1023 |
| 210 | Ga0395898_0189615 | 3300037466 | Bacteria | 1964 |
| 211 | Ga0395898_0503431 | 3300037466 | Bacteria | 1152 |
| 212 | Ga0395898_0549714 | 3300037466 | Bacteria | 1097 |
| 213 | Ga0395905_0016275 | 3300037471 | Bacteria | 7065 |
| 214 | Ga0395905_0465237 | 3300037471 | Bacteria | 1163 |
| 215 | Ga0395901_0139730 | 3300038443 | Bacteria | 2546 |
| 216 | Ga0395901_0587441 | 3300038443 | Bacteria | 1124 |
| 217 | Ga0439463_020367 | 3300042016 | Bacteria | 1654 |
| 218 | Ga0466971_0063834 | 3300044719 | Bacteria | 1667 |
| 219 | Ga0495603_0000044 | 3300046455 | Bacteria | 53548 |
| 220 | Ga0495603_0000291 | 3300046455 | Bacteria | 26643 |
| 221 | Ga0495641_0068770 | 3300046461 | Bacteria | 1592 |
| 222 | Ga0495653_0158347 | 3300046463 | Bacteria | 1575 |
| 223 | Ga0495662_0075391 | 3300046476 | Bacteria | 1637 |
| 224 | Ga0495606_0000082 | 3300046507 | Bacteria | 159585 |
| 225 | Ga0495608_0007029 | 3300046511 | Bacteria | 7967 |
| 226 | Ga0495620_0000446 | 3300046515 | Bacteria | 27496 |
| 227 | Ga0495628_0024500 | 3300046516 | Bacteria | 4939 |
| 228 | Ga0495628_0164331 | 3300046516 | Bacteria | 1686 |
| 229 | Ga0495628_0269743 | 3300046516 | Bacteria | 1266 |
| 230 | Ga0495630_0000007 | 3300046517 | Bacteria | 376915 |
| 231 | Ga0495630_0025125 | 3300046517 | Bacteria | 4403 |
| 232 | Ga0495586_0000384 | 3300046535 | Bacteria | 27060 |
| 233 | Ga0495621_0005604 | 3300046539 | Bacteria | 3621 |
| 234 | Ga0495634_0000125 | 3300046642 | Bacteria | 65586 |
| 235 | Ga0495634_0000828 | 3300046642 | Bacteria | 29940 |
| 236 | Ga0495634_0009750 | 3300046642 | Bacteria | 7066 |
| 237 | Ga0495588_0000241 | 3300046674 | Bacteria | 46762 |
| 238 | Ga0495657_0025057 | 3300046675 | Bacteria | 4239 |
| 239 | Ga0495647_0000014 | 3300046681 | Bacteria | 87792 |
| 240 | Ga0495647_0003736 | 3300046681 | Bacteria | 4890 |
| 241 | Ga0495624_0000256 | 3300046690 | Bacteria | 42059 |
| 242 | Ga0495624_0132074 | 3300046690 | Bacteria | 1531 |
| 243 | Ga0495624_0201517 | 3300046690 | Bacteria | 1209 |
| 244 | Ga0495589_0104072 | 3300046794 | Bacteria | 1372 |
| 245 | Ga0495589_0169248 | 3300046794 | Bacteria | 1039 |
| 246 | Ga0495581_0300780 | 3300047315 | Bacteria | 938 |
| 247 | Ga0495672_0012106 | 3300047320 | Bacteria | 6040 |
| 248 | Ga0495676_0029455 | 3300047321 | Bacteria | 4674 |
| 249 | Ga0495676_0189380 | 3300047321 | Bacteria | 1436 |
| 250 | Ga0495680_0035417 | 3300047322 | Bacteria | 4021 |
| 251 | Ga0496100_0000016 | 3300048903 | Bacteria | 166058 |
| 252 | Ga0496101_0000038 | 3300048904 | Bacteria | 166058 |
| 253 | Ga0496102_0579709 | 3300048905 | Bacteria | 1045 |
| 254 | Ga0496104_0000003 | 3300048907 | Bacteria | 669219 |
| 255 | Ga0496104_0000007 | 3300048907 | Bacteria | 524804 |
| 256 | Ga0496105_0000002 | 3300048908 | Bacteria | 753215 |
| 257 | Ga0496105_0000008 | 3300048908 | Bacteria | 335652 |
| 258 | Ga0496106_0000013 | 3300048909 | Bacteria | 202263 |
| 259 | Ga0496106_0000027 | 3300048909 | Bacteria | 149560 |
| 260 | Ga0496107_0000003 | 3300048910 | Bacteria | 304038 |
| 261 | Ga0496107_0018663 | 3300048910 | Bacteria | 4887 |
| 262 | Ga0496107_0127743 | 3300048910 | Bacteria | 1875 |
| 263 | Ga0496108_0000002 | 3300048911 | Bacteria | 700890 |
| 264 | Ga0496108_0000110 | 3300048911 | Bacteria | 84585 |
| 265 | Ga0496108_0030218 | 3300048911 | Bacteria | 4490 |
| 266 | Ga0496108_0099527 | 3300048911 | Bacteria | 2479 |
| 267 | Ga0496108_0353484 | 3300048911 | Bacteria | 1282 |
| 268 | Ga0496109_0000001 | 3300048912 | Bacteria | 700852 |
| 269 | Ga0496109_0000046 | 3300048912 | Bacteria | 131025 |
| 270 | Ga0496109_0000087 | 3300048912 | Bacteria | 95196 |
| 271 | Ga0496109_0074328 | 3300048912 | Bacteria | 3124 |
| 272 | Ga0496109_0075046 | 3300048912 | Bacteria | 3109 |
| 273 | Ga0496109_0242739 | 3300048912 | Bacteria | 1696 |
| 274 | Ga0496110_0033469 | 3300048913 | Bacteria | 4446 |
| 275 | Ga0496110_0053643 | 3300048913 | Bacteria | 3545 |
| 276 | Ga0496110_0154763 | 3300048913 | Bacteria | 2077 |
| 277 | Ga0496110_0212948 | 3300048913 | Bacteria | 1757 |
| 278 | Ga0496111_0020696 | 3300048914 | Bacteria | 4585 |
| 279 | Ga0496111_0025151 | 3300048914 | Bacteria | 4199 |
| 280 | Ga0496111_0035821 | 3300048914 | Bacteria | 3548 |
| 281 | Ga0496111_0072003 | 3300048914 | Bacteria | 2516 |
| 282 | Ga0496111_0154816 | 3300048914 | Bacteria | 1701 |
| 283 | Ga0496112_0073858 | 3300048915 | Bacteria | 3371 |
| 284 | Ga0496112_0216538 | 3300048915 | Bacteria | 1871 |
| 285 | Ga0496113_0004020 | 3300048916 | Bacteria | 8951 |
| 286 | Ga0496113_0011314 | 3300048916 | Bacteria | 5946 |
| 287 | Ga0496113_0014998 | 3300048916 | Bacteria | 5307 |
| 288 | Ga0496113_0028178 | 3300048916 | Bacteria | 4037 |
| 289 | Ga0496114_0000010 | 3300048917 | Bacteria | 363396 |
| 290 | Ga0496115_0000710 | 3300048918 | Bacteria | 24673 |
| 291 | Ga0496119_0114751 | 3300048922 | Bacteria | 1489 |
| 292 | Ga0501031_0009949 | 3300049568 | Bacteria | 6192 |
| 293 | Ga0501032_0009066 | 3300049569 | Bacteria | 7225 |
| 294 | Ga0501033_0009639 | 3300049570 | Bacteria | 7430 |
| 295 | Ga0501034_0035677 | 3300049571 | Bacteria | 5040 |
| 296 | Ga0501036_0018640 | 3300049572 | Bacteria | 5818 |
| 297 | Ga0501036_0304314 | 3300049572 | Bacteria | 1333 |
| 298 | Ga0501037_0112829 | 3300049573 | Bacteria | 1957 |
| 299 | Ga0501038_0032054 | 3300049574 | Bacteria | 4640 |
| 300 | Ga0501039_0020827 | 3300049575 | Bacteria | 5027 |
| 301 | Ga0501042_0027635 | 3300049578 | Bacteria | 3990 |
| 302 | Ga0501043_0034948 | 3300049579 | Bacteria | 3953 |
| 303 | Ga0501046_0023848 | 3300049580 | Bacteria | 5026 |
| 304 | Ga0501046_0109741 | 3300049580 | Bacteria | 2109 |
| 305 | Ga0501047_0069774 | 3300049581 | Bacteria | 3383 |
| 306 | Ga0501048_0025821 | 3300049582 | Bacteria | 4279 |
| 307 | Ga0501048_0351579 | 3300049582 | Bacteria | 1051 |
| 308 | Ga0501067_0005754 | 3300049583 | Bacteria | 6879 |
| 309 | Ga0501068_0002292 | 3300049584 | Bacteria | 10190 |
| 310 | Ga0501069_0016854 | 3300049585 | Bacteria | 3925 |
| 311 | Ga0501071_0053506 | 3300049587 | Bacteria | 2912 |
| 312 | Ga0501071_0116997 | 3300049587 | Bacteria | 1974 |
| 313 | Ga0501072_0032450 | 3300049588 | Bacteria | 4090 |
| 314 | Ga0501073_0016285 | 3300049589 | Bacteria | 5388 |
| 315 | Ga0501074_0014343 | 3300049590 | Bacteria | 5765 |
| 316 | Ga0501074_0343792 | 3300049590 | Bacteria | 1059 |
| 317 | Ga0501079_0180520 | 3300049741 | Bacteria | 1647 |
| 318 | Ga0501079_0351982 | 3300049741 | Bacteria | 1154 |
| 319 | Ga0501080_0023463 | 3300049742 | Bacteria | 5717 |
| 320 | Ga0501081_0338096 | 3300049743 | Bacteria | 1108 |
| 321 | Ga0501081_0380973 | 3300049743 | Bacteria | 1042 |
| 322 | Ga0501035_0046785 | 3300049822 | Bacteria | 3890 |
| 323 | Ga0501035_0405944 | 3300049822 | Bacteria | 1133 |
| 324 | Ga0501035_0600338 | 3300049822 | Bacteria | 897 |
| 325 | Ga0501044_0040324 | 3300049823 | Bacteria | 4866 |
| 326 | nmdc:mga0yw44_149118_c1 | 3300050492 | Bacteria | 1524 |
| 327 | nmdc:mga05p37_196250_c1 | 3300050507 | Bacteria | 2447 |
| 328 | nmdc:mga05p37_40688_c1 | 3300050507 | Bacteria | 5707 |
| 329 | nmdc:mga05p37_431368_c1 | 3300050507 | Bacteria | 1531 |
| 330 | nmdc:mga05p37_875010_c1 | 3300050507 | Bacteria | 972 |
| 331 | nmdc:mga05p37_924843_c1 | 3300050507 | Bacteria | 937 |
| 332 | nmdc:mga09592_9222_c1 | 3300050508 | Bacteria | 8025 |
| 333 | nmdc:mga0qj67_207893_c1 | 3300050509 | Bacteria | 1590 |
| 334 | nmdc:mga0qj67_25411_c1 | 3300050509 | Bacteria | 4576 |
| 335 | nmdc:mga0qj67_31166_c1 | 3300050509 | Bacteria | 4154 |
| 336 | nmdc:mga0qj67_372_c1 | 3300050509 | Bacteria | 30883 |
| 337 | nmdc:mga06r32_104593_c1 | 3300050510 | Bacteria | 2780 |
| 338 | nmdc:mga08y16_268833_c1 | 3300050511 | Bacteria | 1760 |
| 339 | nmdc:mga08y16_484580_c1 | 3300050511 | Bacteria | 1258 |
| 340 | nmdc:mga08y16_90806_c1 | 3300050511 | Bacteria | 3184 |
| 341 | nmdc:mga0a205_124_c2 | 3300050515 | Bacteria | 20732 |
| 342 | Ga0495601_0000214 | 3300053077 | Bacteria | 31046 |
| 343 | Ga0495601_0017635 | 3300053077 | Bacteria | 4336 |
| 344 | Ga0495612_0003739 | 3300053078 | Bacteria | 6324 |
| 345 | Ga0495619_0000024 | 3300053085 | Bacteria | 180821 |
| 346 | Ga0495619_0002211 | 3300053085 | Bacteria | 12886 |
| 347 | Ga0500566_0003427 | 3300053094 | Bacteria | 9458 |
| 348 | Ga0501084_0031112 | 3300054114 | Bacteria | 4464 |
| 349 | Ga0501084_0486113 | 3300054114 | Bacteria | 1044 |
| 350 | Ga0501082_0028964 | 3300060353 | Bacteria | 4770 |
| 351 | Ga0466962_0097428 | 3300061719 | Bacteria | 1411 |
| 352 | Ga0530510_0037485 | 3300061734 | Bacteria | 3497 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049573 | Ga0501037_0112829 | Ga0501037_0112829_1224_1946 | 220 |
| 2 | 3300005338 | Ga0068868_100592866 | Ga0068868_1005928661 | 232 |
| 3 | 3300005981 | Ga0081538_10000963 | Ga0081538_100009637 | 240 |
| 4 | 3300005564 | Ga0070664_100107162 | Ga0070664_1001071622 | 243 |
| 5 | 3300025940 | Ga0207691_10438026 | Ga0207691_104380262 | 243 |
| 6 | 3300025945 | Ga0207679_10101623 | Ga0207679_101016233 | 243 |
| 7 | 3300031901 | Ga0307406_10337113 | Ga0307406_103371132 | 244 |
| 8 | 3300047315 | Ga0495581_0300780 | Ga0495581_0300780_54_809 | 244 |
| 9 | 3300049568 | Ga0501031_0009949 | Ga0501031_0009949_4379_5173 | 244 |
| 10 | 3300049569 | Ga0501032_0009066 | Ga0501032_0009066_6272_7066 | 244 |
| 11 | 3300049570 | Ga0501033_0009639 | Ga0501033_0009639_3291_4085 | 244 |
| 12 | 3300049571 | Ga0501034_0035677 | Ga0501034_0035677_2153_2947 | 244 |
| 13 | 3300049572 | Ga0501036_0018640 | Ga0501036_0018640_3291_4085 | 244 |
| 14 | 3300049574 | Ga0501038_0032054 | Ga0501038_0032054_2961_3755 | 244 |
| 15 | 3300049575 | Ga0501039_0020827 | Ga0501039_0020827_3372_4166 | 244 |
| 16 | 3300049578 | Ga0501042_0027635 | Ga0501042_0027635_1104_1898 | 244 |
| 17 | 3300049579 | Ga0501043_0034948 | Ga0501043_0034948_1265_2059 | 244 |
| 18 | 3300049580 | Ga0501046_0023848 | Ga0501046_0023848_861_1655 | 244 |
| 19 | 3300049581 | Ga0501047_0069774 | Ga0501047_0069774_496_1290 | 244 |
| 20 | 3300049582 | Ga0501048_0025821 | Ga0501048_0025821_1091_1885 | 244 |
| 21 | 3300049583 | Ga0501067_0005754 | Ga0501067_0005754_3637_4431 | 244 |
| 22 | 3300049584 | Ga0501068_0002292 | Ga0501068_0002292_6308_7102 | 244 |
| 23 | 3300049585 | Ga0501069_0016854 | Ga0501069_0016854_1367_2161 | 244 |
| 24 | 3300049587 | Ga0501071_0053506 | Ga0501071_0053506_929_1723 | 244 |
| 25 | 3300049588 | Ga0501072_0032450 | Ga0501072_0032450_2950_3744 | 244 |
| 26 | 3300049589 | Ga0501073_0016285 | Ga0501073_0016285_1634_2428 | 244 |
| 27 | 3300049590 | Ga0501074_0014343 | Ga0501074_0014343_2022_2816 | 244 |
| 28 | 3300049741 | Ga0501079_0180520 | Ga0501079_0180520_837_1631 | 244 |
| 29 | 3300049742 | Ga0501080_0023463 | Ga0501080_0023463_1957_2751 | 244 |
| 30 | 3300049822 | Ga0501035_0046785 | Ga0501035_0046785_1004_1798 | 244 |
| 31 | 3300049823 | Ga0501044_0040324 | Ga0501044_0040324_2951_3745 | 244 |
| 32 | 3300054114 | Ga0501084_0031112 | Ga0501084_0031112_2028_2822 | 244 |
| 33 | 3300060353 | Ga0501082_0028964 | Ga0501082_0028964_3012_3806 | 244 |
| 34 | 3300005356 | Ga0070674_100001851 | Ga0070674_1000018517 | 245 |
| 35 | 3300005536 | Ga0070697_100275825 | Ga0070697_1002758252 | 245 |
| 36 | 3300009148 | Ga0105243_10045575 | Ga0105243_100455753 | 245 |
| 37 | 3300025935 | Ga0207709_10015313 | Ga0207709_100153132 | 245 |
| 38 | 3300028380 | Ga0268265_10418350 | Ga0268265_104183502 | 245 |
| 39 | 3300037466 | Ga0395898_0549714 | Ga0395898_0549714_82_834 | 245 |
| 40 | 3300005339 | Ga0070660_100285185 | Ga0070660_1002851852 | 247 |
| 41 | 3300005356 | Ga0070674_100017707 | Ga0070674_1000177073 | 247 |
| 42 | 3300005564 | Ga0070664_100430395 | Ga0070664_1004303952 | 247 |
| 43 | 3300005578 | Ga0068854_100151524 | Ga0068854_1001515243 | 247 |
| 44 | 3300005719 | Ga0068861_100237925 | Ga0068861_1002379252 | 247 |
| 45 | 3300006846 | Ga0075430_100012413 | Ga0075430_1000124133 | 247 |
| 46 | 3300006846 | Ga0075430_100215304 | Ga0075430_1002153042 | 247 |
| 47 | 3300009147 | Ga0114129_10288437 | Ga0114129_102884372 | 247 |
| 48 | 3300009148 | Ga0105243_10208730 | Ga0105243_102087302 | 247 |
| 49 | 3300025919 | Ga0207657_10150926 | Ga0207657_101509262 | 247 |
| 50 | 3300025933 | Ga0207706_10112116 | Ga0207706_101121161 | 247 |
| 51 | 3300025935 | Ga0207709_10084600 | Ga0207709_100846002 | 247 |
| 52 | 3300025945 | Ga0207679_10113014 | Ga0207679_101130142 | 247 |
| 53 | 3300025949 | Ga0207667_10408207 | Ga0207667_104082072 | 247 |
| 54 | 3300026075 | Ga0207708_10007953 | Ga0207708_100079535 | 247 |
| 55 | 3300026118 | Ga0207675_100015600 | Ga0207675_1000156007 | 247 |
| 56 | 3300028380 | Ga0268265_10536216 | Ga0268265_105362162 | 247 |
| 57 | 3300031727 | Ga0316576_10481862 | Ga0316576_104818622 | 247 |
| 58 | 3300031731 | Ga0307405_10470546 | Ga0307405_104705461 | 247 |
| 59 | 3300032005 | Ga0307411_10610910 | Ga0307411_106109102 | 247 |
| 60 | 3300032126 | Ga0307415_100457764 | Ga0307415_1004577642 | 247 |
| 61 | 3300037418 | Ga0395900_0617949 | Ga0395900_0617949_26_781 | 247 |
| 62 | 3300042016 | Ga0439463_020367 | Ga0439463_020367_335_1123 | 247 |
| 63 | 3300048912 | Ga0496109_0242739 | Ga0496109_0242739_788_1543 | 247 |
| 64 | 3300050509 | nmdc:mga0qj67_372_c1 | nmdc:mga0qj67_372_c1_11022_11807 | 247 |
| 65 | 3300002239 | JGI24034J26672_10000738 | JGI24034J26672_100007385 | 248 |
| 66 | 3300003373 | JGI25407J50210_10008326 | JGI25407J50210_100083264 | 248 |
| 67 | 3300003373 | JGI25407J50210_10020834 | JGI25407J50210_100208342 | 248 |
| 68 | 3300003373 | JGI25407J50210_10033982 | JGI25407J50210_100339822 | 248 |
| 69 | 3300005457 | Ga0070662_100004047 | Ga0070662_1000040477 | 248 |
| 70 | 3300005719 | Ga0068861_100058795 | Ga0068861_1000587952 | 248 |
| 71 | 3300005937 | Ga0081455_10127203 | Ga0081455_101272031 | 248 |
| 72 | 3300005981 | Ga0081538_10000149 | Ga0081538_100001492 | 248 |
| 73 | 3300005981 | Ga0081538_10000517 | Ga0081538_1000051729 | 248 |
| 74 | 3300005981 | Ga0081538_10000945 | Ga0081538_1000094512 | 248 |
| 75 | 3300005981 | Ga0081538_10001326 | Ga0081538_1000132616 | 248 |
| 76 | 3300005981 | Ga0081538_10006574 | Ga0081538_100065744 | 248 |
| 77 | 3300005981 | Ga0081538_10014692 | Ga0081538_100146924 | 248 |
| 78 | 3300005981 | Ga0081538_10016515 | Ga0081538_100165154 | 248 |
| 79 | 3300005981 | Ga0081538_10021572 | Ga0081538_100215722 | 248 |
| 80 | 3300005981 | Ga0081538_10026136 | Ga0081538_100261364 | 248 |
| 81 | 3300005981 | Ga0081538_10038476 | Ga0081538_100384762 | 248 |
| 82 | 3300005981 | Ga0081538_10066482 | Ga0081538_100664821 | 248 |
| 83 | 3300005981 | Ga0081538_10072321 | Ga0081538_100723212 | 248 |
| 84 | 3300005981 | Ga0081538_10115699 | Ga0081538_101156991 | 248 |
| 85 | 3300005981 | Ga0081538_10130614 | Ga0081538_101306141 | 248 |
| 86 | 3300005981 | Ga0081538_10130919 | Ga0081538_101309192 | 248 |
| 87 | 3300006038 | Ga0075365_10178896 | Ga0075365_101788962 | 248 |
| 88 | 3300006058 | Ga0075432_10092053 | Ga0075432_100920531 | 248 |
| 89 | 3300006844 | Ga0075428_100017187 | Ga0075428_1000171878 | 248 |
| 90 | 3300006844 | Ga0075428_100062783 | Ga0075428_1000627834 | 248 |
| 91 | 3300006846 | Ga0075430_100002745 | Ga0075430_10000274511 | 248 |
| 92 | 3300006846 | Ga0075430_100405686 | Ga0075430_1004056862 | 248 |
| 93 | 3300006847 | Ga0075431_100003853 | Ga0075431_1000038536 | 248 |
| 94 | 3300009094 | Ga0111539_10007192 | Ga0111539_1000719212 | 248 |
| 95 | 3300009098 | Ga0105245_10252501 | Ga0105245_102525012 | 248 |
| 96 | 3300009147 | Ga0114129_10051681 | Ga0114129_100516813 | 248 |
| 97 | 3300009147 | Ga0114129_10321571 | Ga0114129_103215712 | 248 |
| 98 | 3300009553 | Ga0105249_10005193 | Ga0105249_100051934 | 248 |
| 99 | 3300010375 | Ga0105239_10059329 | Ga0105239_100593295 | 248 |
| 100 | 3300025923 | Ga0207681_10247815 | Ga0207681_102478151 | 248 |
| 101 | 3300025932 | Ga0207690_10542030 | Ga0207690_105420301 | 248 |
| 102 | 3300025933 | Ga0207706_10021827 | Ga0207706_100218275 | 248 |
| 103 | 3300025935 | Ga0207709_10138436 | Ga0207709_101384362 | 248 |
| 104 | 3300025961 | Ga0207712_10055457 | Ga0207712_100554572 | 248 |
| 105 | 3300025972 | Ga0207668_10001630 | Ga0207668_100016304 | 248 |
| 106 | 3300026075 | Ga0207708_10045766 | Ga0207708_100457663 | 248 |
| 107 | 3300026118 | Ga0207675_100007422 | Ga0207675_1000074225 | 248 |
| 108 | 3300027907 | Ga0207428_10077853 | Ga0207428_100778532 | 248 |
| 109 | 3300031548 | Ga0307408_100067671 | Ga0307408_1000676712 | 248 |
| 110 | 3300031731 | Ga0307405_10112811 | Ga0307405_101128111 | 248 |
| 111 | 3300031824 | Ga0307413_10131032 | Ga0307413_101310322 | 248 |
| 112 | 3300031852 | Ga0307410_10329106 | Ga0307410_103291062 | 248 |
| 113 | 3300031901 | Ga0307406_10018107 | Ga0307406_100181073 | 248 |
| 114 | 3300031901 | Ga0307406_10089557 | Ga0307406_100895574 | 248 |
| 115 | 3300031903 | Ga0307407_10348261 | Ga0307407_103482612 | 248 |
| 116 | 3300031911 | Ga0307412_10460437 | Ga0307412_104604372 | 248 |
| 117 | 3300031995 | Ga0307409_100009575 | Ga0307409_1000095755 | 248 |
| 118 | 3300031995 | Ga0307409_100027311 | Ga0307409_1000273115 | 248 |
| 119 | 3300031995 | Ga0307409_100037460 | Ga0307409_1000374604 | 248 |
| 120 | 3300031995 | Ga0307409_100259365 | Ga0307409_1002593651 | 248 |
| 121 | 3300031995 | Ga0307409_100351602 | Ga0307409_1003516022 | 248 |
| 122 | 3300031995 | Ga0307409_100485696 | Ga0307409_1004856961 | 248 |
| 123 | 3300032002 | Ga0307416_100034835 | Ga0307416_1000348352 | 248 |
| 124 | 3300032002 | Ga0307416_100122374 | Ga0307416_1001223741 | 248 |
| 125 | 3300032002 | Ga0307416_100331242 | Ga0307416_1003312422 | 248 |
| 126 | 3300032002 | Ga0307416_100625422 | Ga0307416_1006254222 | 248 |
| 127 | 3300032005 | Ga0307411_10100143 | Ga0307411_101001431 | 248 |
| 128 | 3300032126 | Ga0307415_100005179 | Ga0307415_1000051796 | 248 |
| 129 | 3300032126 | Ga0307415_100008232 | Ga0307415_1000082322 | 248 |
| 130 | 3300032126 | Ga0307415_100348767 | Ga0307415_1003487671 | 248 |
| 131 | 3300035242 | Ga0373962_0019252 | Ga0373962_0019252_26_778 | 248 |
| 132 | 3300035691 | Ga0373931_0084136 | Ga0373931_0084136_651_1403 | 248 |
| 133 | 3300037466 | Ga0395898_0503431 | Ga0395898_0503431_309_1061 | 248 |
| 134 | 3300037471 | Ga0395905_0465237 | Ga0395905_0465237_193_945 | 248 |
| 135 | 3300046794 | Ga0495589_0169248 | Ga0495589_0169248_274_1026 | 248 |
| 136 | 3300049572 | Ga0501036_0304314 | Ga0501036_0304314_514_1266 | 248 |
| 137 | 3300049580 | Ga0501046_0109741 | Ga0501046_0109741_1199_1951 | 248 |
| 138 | 3300049741 | Ga0501079_0351982 | Ga0501079_0351982_301_1053 | 248 |
| 139 | 3300049822 | Ga0501035_0600338 | Ga0501035_0600338_117_869 | 248 |
| 140 | 3300050492 | nmdc:mga0yw44_149118_c1 | nmdc:mga0yw44_149118_c1_75_827 | 248 |
| 141 | 3300050507 | nmdc:mga05p37_196250_c1 | nmdc:mga05p37_196250_c1_449_1201 | 248 |
| 142 | 3300050507 | nmdc:mga05p37_40688_c1 | nmdc:mga05p37_40688_c1_1813_2565 | 248 |
| 143 | 3300050507 | nmdc:mga05p37_431368_c1 | nmdc:mga05p37_431368_c1_164_916 | 248 |
| 144 | 3300050507 | nmdc:mga05p37_875010_c1 | nmdc:mga05p37_875010_c1_189_941 | 248 |
| 145 | 3300050509 | nmdc:mga0qj67_25411_c1 | nmdc:mga0qj67_25411_c1_23_775 | 248 |
| 146 | 3300050510 | nmdc:mga06r32_104593_c1 | nmdc:mga06r32_104593_c1_1288_2040 | 248 |
| 147 | 3300050511 | nmdc:mga08y16_90806_c1 | nmdc:mga08y16_90806_c1_953_1705 | 248 |
| 148 | 3300054114 | Ga0501084_0486113 | Ga0501084_0486113_45_797 | 248 |
| 149 | 3300061734 | Ga0530510_0037485 | Ga0530510_0037485_1833_2585 | 248 |
| 150 | 3300005329 | Ga0070683_100000331 | Ga0070683_10000033133 | 249 |
| 151 | 3300005331 | Ga0070670_100070481 | Ga0070670_1000704813 | 249 |
| 152 | 3300005333 | Ga0070677_10000030 | Ga0070677_100000309 | 249 |
| 153 | 3300005335 | Ga0070666_10013945 | Ga0070666_100139456 | 249 |
| 154 | 3300005344 | Ga0070661_100376169 | Ga0070661_1003761691 | 249 |
| 155 | 3300005347 | Ga0070668_100438346 | Ga0070668_1004383462 | 249 |
| 156 | 3300005354 | Ga0070675_100000073 | Ga0070675_10000007352 | 249 |
| 157 | 3300005367 | Ga0070667_100603147 | Ga0070667_1006031472 | 249 |
| 158 | 3300005439 | Ga0070711_100006965 | Ga0070711_1000069659 | 249 |
| 159 | 3300005535 | Ga0070684_100018501 | Ga0070684_1000185012 | 249 |
| 160 | 3300005535 | Ga0070684_100150972 | Ga0070684_1001509723 | 249 |
| 161 | 3300005539 | Ga0068853_100216272 | Ga0068853_1002162722 | 249 |
| 162 | 3300005543 | Ga0070672_100000023 | Ga0070672_10000002318 | 249 |
| 163 | 3300005548 | Ga0070665_100005655 | Ga0070665_1000056555 | 249 |
| 164 | 3300005577 | Ga0068857_100111149 | Ga0068857_1001111492 | 249 |
| 165 | 3300005718 | Ga0068866_10027900 | Ga0068866_100279003 | 249 |
| 166 | 3300006163 | Ga0070715_10000012 | Ga0070715_10000012182 | 249 |
| 167 | 3300006175 | Ga0070712_100030112 | Ga0070712_1000301123 | 249 |
| 168 | 3300006846 | Ga0075430_100026848 | Ga0075430_1000268485 | 249 |
| 169 | 3300006846 | Ga0075430_100103988 | Ga0075430_1001039883 | 249 |
| 170 | 3300006847 | Ga0075431_100023665 | Ga0075431_1000236653 | 249 |
| 171 | 3300006847 | Ga0075431_100216708 | Ga0075431_1002167081 | 249 |
| 172 | 3300006880 | Ga0075429_100012152 | Ga0075429_1000121523 | 249 |
| 173 | 3300007076 | Ga0075435_100701378 | Ga0075435_1007013781 | 249 |
| 174 | 3300009094 | Ga0111539_10352108 | Ga0111539_103521082 | 249 |
| 175 | 3300009098 | Ga0105245_10347688 | Ga0105245_103476882 | 249 |
| 176 | 3300009101 | Ga0105247_10002347 | Ga0105247_1000234712 | 249 |
| 177 | 3300009101 | Ga0105247_10052054 | Ga0105247_100520542 | 249 |
| 178 | 3300009176 | Ga0105242_10018654 | Ga0105242_100186542 | 249 |
| 179 | 3300009177 | Ga0105248_10000466 | Ga0105248_100004669 | 249 |
| 180 | 3300009177 | Ga0105248_10500987 | Ga0105248_105009871 | 249 |
| 181 | 3300009553 | Ga0105249_10000192 | Ga0105249_1000019218 | 249 |
| 182 | 3300013102 | Ga0157371_10007237 | Ga0157371_100072376 | 249 |
| 183 | 3300013296 | Ga0157374_10010028 | Ga0157374_100100283 | 249 |
| 184 | 3300013297 | Ga0157378_10017735 | Ga0157378_100177353 | 249 |
| 185 | 3300013297 | Ga0157378_10018698 | Ga0157378_100186983 | 249 |
| 186 | 3300013308 | Ga0157375_10000322 | Ga0157375_1000032229 | 249 |
| 187 | 3300014968 | Ga0157379_10014324 | Ga0157379_100143242 | 249 |
| 188 | 3300025893 | Ga0207682_10000003 | Ga0207682_1000000383 | 249 |
| 189 | 3300025899 | Ga0207642_10004304 | Ga0207642_100043043 | 249 |
| 190 | 3300025900 | Ga0207710_10000422 | Ga0207710_1000042212 | 249 |
| 191 | 3300025901 | Ga0207688_10022707 | Ga0207688_100227072 | 249 |
| 192 | 3300025903 | Ga0207680_10004531 | Ga0207680_100045316 | 249 |
| 193 | 3300025905 | Ga0207685_10000001 | Ga0207685_10000001598 | 249 |
| 194 | 3300025909 | Ga0207705_10048398 | Ga0207705_100483983 | 249 |
| 195 | 3300025915 | Ga0207693_10004469 | Ga0207693_1000446915 | 249 |
| 196 | 3300025916 | Ga0207663_10004537 | Ga0207663_100045372 | 249 |
| 197 | 3300025925 | Ga0207650_10142591 | Ga0207650_101425912 | 249 |
| 198 | 3300025926 | Ga0207659_10000082 | Ga0207659_1000008252 | 249 |
| 199 | 3300025927 | Ga0207687_10000012 | Ga0207687_10000012124 | 249 |
| 200 | 3300025934 | Ga0207686_10041392 | Ga0207686_100413923 | 249 |
| 201 | 3300025938 | Ga0207704_10343972 | Ga0207704_103439721 | 249 |
| 202 | 3300025940 | Ga0207691_10000172 | Ga0207691_1000017266 | 249 |
| 203 | 3300025941 | Ga0207711_10000085 | Ga0207711_1000008553 | 249 |
| 204 | 3300025944 | Ga0207661_10000192 | Ga0207661_1000019211 | 249 |
| 205 | 3300025961 | Ga0207712_10000003 | Ga0207712_10000003341 | 249 |
| 206 | 3300026035 | Ga0207703_10321387 | Ga0207703_103213872 | 249 |
| 207 | 3300026041 | Ga0207639_10180474 | Ga0207639_101804742 | 249 |
| 208 | 3300026067 | Ga0207678_10128687 | Ga0207678_101286872 | 249 |
| 209 | 3300028379 | Ga0268266_10000182 | Ga0268266_1000018299 | 249 |
| 210 | 3300031852 | Ga0307410_10067489 | Ga0307410_100674894 | 249 |
| 211 | 3300038443 | Ga0395901_0139730 | Ga0395901_0139730_183_956 | 249 |
| 212 | 3300044719 | Ga0466971_0063834 | Ga0466971_0063834_803_1561 | 249 |
| 213 | 3300046455 | Ga0495603_0000044 | Ga0495603_0000044_5797_6588 | 249 |
| 214 | 3300046461 | Ga0495641_0068770 | Ga0495641_0068770_443_1231 | 249 |
| 215 | 3300046463 | Ga0495653_0158347 | Ga0495653_0158347_15_800 | 249 |
| 216 | 3300046476 | Ga0495662_0075391 | Ga0495662_0075391_329_1117 | 249 |
| 217 | 3300046507 | Ga0495606_0000082 | Ga0495606_0000082_122014_122799 | 249 |
| 218 | 3300046515 | Ga0495620_0000446 | Ga0495620_0000446_10546_11337 | 249 |
| 219 | 3300046516 | Ga0495628_0164331 | Ga0495628_0164331_767_1552 | 249 |
| 220 | 3300046516 | Ga0495628_0269743 | Ga0495628_0269743_37_828 | 249 |
| 221 | 3300046517 | Ga0495630_0000007 | Ga0495630_0000007_53195_53980 | 249 |
| 222 | 3300046517 | Ga0495630_0025125 | Ga0495630_0025125_1480_2265 | 249 |
| 223 | 3300046535 | Ga0495586_0000384 | Ga0495586_0000384_10583_11374 | 249 |
| 224 | 3300046539 | Ga0495621_0005604 | Ga0495621_0005604_727_1518 | 249 |
| 225 | 3300046642 | Ga0495634_0000125 | Ga0495634_0000125_62390_63181 | 249 |
| 226 | 3300046642 | Ga0495634_0000828 | Ga0495634_0000828_1754_2545 | 249 |
| 227 | 3300046642 | Ga0495634_0009750 | Ga0495634_0009750_891_1676 | 249 |
| 228 | 3300046674 | Ga0495588_0000241 | Ga0495588_0000241_26049_26834 | 249 |
| 229 | 3300046675 | Ga0495657_0025057 | Ga0495657_0025057_155_940 | 249 |
| 230 | 3300046681 | Ga0495647_0000014 | Ga0495647_0000014_32357_33148 | 249 |
| 231 | 3300046681 | Ga0495647_0003736 | Ga0495647_0003736_741_1529 | 249 |
| 232 | 3300046690 | Ga0495624_0000256 | Ga0495624_0000256_12538_13326 | 249 |
| 233 | 3300046690 | Ga0495624_0132074 | Ga0495624_0132074_352_1137 | 249 |
| 234 | 3300047320 | Ga0495672_0012106 | Ga0495672_0012106_2629_3414 | 249 |
| 235 | 3300047321 | Ga0495676_0029455 | Ga0495676_0029455_1571_2356 | 249 |
| 236 | 3300047321 | Ga0495676_0189380 | Ga0495676_0189380_268_1053 | 249 |
| 237 | 3300047322 | Ga0495680_0035417 | Ga0495680_0035417_306_1091 | 249 |
| 238 | 3300048903 | Ga0496100_0000016 | Ga0496100_0000016_146959_147750 | 249 |
| 239 | 3300048904 | Ga0496101_0000038 | Ga0496101_0000038_18309_19100 | 249 |
| 240 | 3300048905 | Ga0496102_0579709 | Ga0496102_0579709_144_917 | 249 |
| 241 | 3300048907 | Ga0496104_0000003 | Ga0496104_0000003_336295_337086 | 249 |
| 242 | 3300048907 | Ga0496104_0000007 | Ga0496104_0000007_317727_318512 | 249 |
| 243 | 3300048908 | Ga0496105_0000002 | Ga0496105_0000002_520666_521451 | 249 |
| 244 | 3300048908 | Ga0496105_0000008 | Ga0496105_0000008_135781_136572 | 249 |
| 245 | 3300048909 | Ga0496106_0000013 | Ga0496106_0000013_46119_46913 | 249 |
| 246 | 3300048909 | Ga0496106_0000027 | Ga0496106_0000027_1823_2614 | 249 |
| 247 | 3300048910 | Ga0496107_0000003 | Ga0496107_0000003_156289_157080 | 249 |
| 248 | 3300048910 | Ga0496107_0018663 | Ga0496107_0018663_3690_4463 | 249 |
| 249 | 3300048910 | Ga0496107_0127743 | Ga0496107_0127743_977_1771 | 249 |
| 250 | 3300048911 | Ga0496108_0000002 | Ga0496108_0000002_399526_400317 | 249 |
| 251 | 3300048911 | Ga0496108_0000110 | Ga0496108_0000110_74562_75347 | 249 |
| 252 | 3300048911 | Ga0496108_0030218 | Ga0496108_0030218_1604_2389 | 249 |
| 253 | 3300048911 | Ga0496108_0099527 | Ga0496108_0099527_822_1595 | 249 |
| 254 | 3300048911 | Ga0496108_0353484 | Ga0496108_0353484_238_1011 | 249 |
| 255 | 3300048912 | Ga0496109_0000001 | Ga0496109_0000001_399488_400279 | 249 |
| 256 | 3300048912 | Ga0496109_0000046 | Ga0496109_0000046_60315_61100 | 249 |
| 257 | 3300048912 | Ga0496109_0000087 | Ga0496109_0000087_74562_75347 | 249 |
| 258 | 3300048912 | Ga0496109_0074328 | Ga0496109_0074328_259_1032 | 249 |
| 259 | 3300048913 | Ga0496110_0033469 | Ga0496110_0033469_2711_3499 | 249 |
| 260 | 3300048913 | Ga0496110_0053643 | Ga0496110_0053643_664_1449 | 249 |
| 261 | 3300048913 | Ga0496110_0154763 | Ga0496110_0154763_1206_1991 | 249 |
| 262 | 3300048914 | Ga0496111_0020696 | Ga0496111_0020696_3566_4354 | 249 |
| 263 | 3300048914 | Ga0496111_0025151 | Ga0496111_0025151_1092_1877 | 249 |
| 264 | 3300048914 | Ga0496111_0035821 | Ga0496111_0035821_2338_3111 | 249 |
| 265 | 3300048914 | Ga0496111_0072003 | Ga0496111_0072003_1453_2238 | 249 |
| 266 | 3300048915 | Ga0496112_0073858 | Ga0496112_0073858_2095_2868 | 249 |
| 267 | 3300048915 | Ga0496112_0216538 | Ga0496112_0216538_242_1015 | 249 |
| 268 | 3300048916 | Ga0496113_0011314 | Ga0496113_0011314_282_1073 | 249 |
| 269 | 3300048916 | Ga0496113_0014998 | Ga0496113_0014998_2325_3110 | 249 |
| 270 | 3300048916 | Ga0496113_0028178 | Ga0496113_0028178_820_1593 | 249 |
| 271 | 3300048917 | Ga0496114_0000010 | Ga0496114_0000010_16720_17505 | 249 |
| 272 | 3300048918 | Ga0496115_0000710 | Ga0496115_0000710_7169_7954 | 249 |
| 273 | 3300048922 | Ga0496119_0114751 | Ga0496119_0114751_190_975 | 249 |
| 274 | 3300049582 | Ga0501048_0351579 | Ga0501048_0351579_115_885 | 249 |
| 275 | 3300049587 | Ga0501071_0116997 | Ga0501071_0116997_844_1605 | 249 |
| 276 | 3300049590 | Ga0501074_0343792 | Ga0501074_0343792_264_1034 | 249 |
| 277 | 3300049743 | Ga0501081_0338096 | Ga0501081_0338096_281_1066 | 249 |
| 278 | 3300049743 | Ga0501081_0380973 | Ga0501081_0380973_238_1008 | 249 |
| 279 | 3300049822 | Ga0501035_0405944 | Ga0501035_0405944_312_1073 | 249 |
| 280 | 3300050507 | nmdc:mga05p37_924843_c1 | nmdc:mga05p37_924843_c1_76_843 | 249 |
| 281 | 3300050508 | nmdc:mga09592_9222_c1 | nmdc:mga09592_9222_c1_1051_1812 | 249 |
| 282 | 3300050509 | nmdc:mga0qj67_207893_c1 | nmdc:mga0qj67_207893_c1_704_1489 | 249 |
| 283 | 3300050509 | nmdc:mga0qj67_31166_c1 | nmdc:mga0qj67_31166_c1_876_1637 | 249 |
| 284 | 3300050511 | nmdc:mga08y16_268833_c1 | nmdc:mga08y16_268833_c1_834_1601 | 249 |
| 285 | 3300050511 | nmdc:mga08y16_484580_c1 | nmdc:mga08y16_484580_c1_64_861 | 249 |
| 286 | 3300053077 | Ga0495601_0000214 | Ga0495601_0000214_29976_30761 | 249 |
| 287 | 3300053077 | Ga0495601_0017635 | Ga0495601_0017635_3233_4018 | 249 |
| 288 | 3300053078 | Ga0495612_0003739 | Ga0495612_0003739_2098_2883 | 249 |
| 289 | 3300053085 | Ga0495619_0002211 | Ga0495619_0002211_4800_5585 | 249 |
| 290 | 3300053094 | Ga0500566_0003427 | Ga0500566_0003427_7091_7876 | 249 |
| 291 | 3300061719 | Ga0466962_0097428 | Ga0466962_0097428_206_964 | 249 |
| 292 | 3300006931 | Ga0097620_100750323 | Ga0097620_1007503231 | 250 |
| 293 | 3300025932 | Ga0207690_10094235 | Ga0207690_100942352 | 250 |
| 294 | 3300028573 | Ga0265334_10094198 | Ga0265334_100941982 | 250 |
| 295 | 3300028800 | Ga0265338_10319510 | Ga0265338_103195102 | 250 |
| 296 | 3300046455 | Ga0495603_0000291 | Ga0495603_0000291_12604_13395 | 250 |
| 297 | 3300046690 | Ga0495624_0201517 | Ga0495624_0201517_377_1168 | 250 |
| 298 | 3300046794 | Ga0495589_0104072 | Ga0495589_0104072_518_1312 | 250 |
| 299 | 3300048912 | Ga0496109_0075046 | Ga0496109_0075046_1439_2230 | 250 |
| 300 | 3300048913 | Ga0496110_0212948 | Ga0496110_0212948_649_1437 | 250 |
| 301 | 3300048914 | Ga0496111_0154816 | Ga0496111_0154816_795_1583 | 250 |
| 302 | 3300048916 | Ga0496113_0004020 | Ga0496113_0004020_5496_6287 | 250 |
| 303 | 3300050515 | nmdc:mga0a205_124_c2 | nmdc:mga0a205_124_c2_3790_4587 | 250 |
| 304 | 3300005329 | Ga0070683_100047183 | Ga0070683_1000471835 | 251 |
| 305 | 3300005336 | Ga0070680_100021103 | Ga0070680_1000211035 | 251 |
| 306 | 3300005339 | Ga0070660_100031735 | Ga0070660_1000317352 | 251 |
| 307 | 3300005344 | Ga0070661_100003073 | Ga0070661_10000307310 | 251 |
| 308 | 3300005366 | Ga0070659_100030555 | Ga0070659_1000305554 | 251 |
| 309 | 3300005458 | Ga0070681_10032484 | Ga0070681_100324845 | 251 |
| 310 | 3300005530 | Ga0070679_100114092 | Ga0070679_1001140923 | 251 |
| 311 | 3300005535 | Ga0070684_100008356 | Ga0070684_1000083562 | 251 |
| 312 | 3300005539 | Ga0068853_100080220 | Ga0068853_1000802204 | 251 |
| 313 | 3300005564 | Ga0070664_100104936 | Ga0070664_1001049362 | 251 |
| 314 | 3300005614 | Ga0068856_100159115 | Ga0068856_1001591152 | 251 |
| 315 | 3300005616 | Ga0068852_100110743 | Ga0068852_1001107433 | 251 |
| 316 | 3300005842 | Ga0068858_100000043 | Ga0068858_10000004320 | 251 |
| 317 | 3300009093 | Ga0105240_10051664 | Ga0105240_100516645 | 251 |
| 318 | 3300009545 | Ga0105237_10210161 | Ga0105237_102101612 | 251 |
| 319 | 3300009551 | Ga0105238_10146290 | Ga0105238_101462902 | 251 |
| 320 | 3300010375 | Ga0105239_10425498 | Ga0105239_104254982 | 251 |
| 321 | 3300013104 | Ga0157370_10062919 | Ga0157370_100629194 | 251 |
| 322 | 3300013105 | Ga0157369_10220149 | Ga0157369_102201493 | 251 |
| 323 | 3300013307 | Ga0157372_10031712 | Ga0157372_100317123 | 251 |
| 324 | 3300025912 | Ga0207707_10014354 | Ga0207707_100143542 | 251 |
| 325 | 3300025913 | Ga0207695_10445753 | Ga0207695_104457532 | 251 |
| 326 | 3300025917 | Ga0207660_10067054 | Ga0207660_100670542 | 251 |
| 327 | 3300025919 | Ga0207657_10026111 | Ga0207657_100261113 | 251 |
| 328 | 3300025920 | Ga0207649_10078909 | Ga0207649_100789093 | 251 |
| 329 | 3300025921 | Ga0207652_10009003 | Ga0207652_100090031 | 251 |
| 330 | 3300025924 | Ga0207694_10270640 | Ga0207694_102706402 | 251 |
| 331 | 3300025932 | Ga0207690_10008712 | Ga0207690_100087124 | 251 |
| 332 | 3300025944 | Ga0207661_10007315 | Ga0207661_100073152 | 251 |
| 333 | 3300025945 | Ga0207679_10081240 | Ga0207679_100812403 | 251 |
| 334 | 3300026035 | Ga0207703_10000053 | Ga0207703_10000053142 | 251 |
| 335 | 3300026041 | Ga0207639_10346773 | Ga0207639_103467731 | 251 |
| 336 | 3300026078 | Ga0207702_10642159 | Ga0207702_106421592 | 251 |
| 337 | 3300026142 | Ga0207698_10087463 | Ga0207698_100874633 | 251 |
| 338 | 3300031548 | Ga0307408_100070120 | Ga0307408_1000701204 | 251 |
| 339 | 3300031824 | Ga0307413_10182704 | Ga0307413_101827042 | 251 |
| 340 | 3300031852 | Ga0307410_10171912 | Ga0307410_101719122 | 251 |
| 341 | 3300031995 | Ga0307409_100128230 | Ga0307409_1001282302 | 251 |
| 342 | 3300032002 | Ga0307416_100103029 | Ga0307416_1001030293 | 251 |
| 343 | 3300032005 | Ga0307411_10012199 | Ga0307411_100121993 | 251 |
| 344 | 3300037312 | Ga0395899_0338384 | Ga0395899_0338384_176_967 | 251 |
| 345 | 3300037418 | Ga0395900_0174114 | Ga0395900_0174114_565_1356 | 251 |
| 346 | 3300037466 | Ga0395898_0189615 | Ga0395898_0189615_702_1493 | 251 |
| 347 | 3300037471 | Ga0395905_0016275 | Ga0395905_0016275_1768_2559 | 251 |
| 348 | 3300038443 | Ga0395901_0587441 | Ga0395901_0587441_176_967 | 251 |
| 349 | 3300046511 | Ga0495608_0007029 | Ga0495608_0007029_5340_6128 | 251 |
| 350 | 3300046516 | Ga0495628_0024500 | Ga0495628_0024500_488_1276 | 251 |
| 351 | 3300053085 | Ga0495619_0000024 | Ga0495619_0000024_162803_163591 | 251 |
| 352 | 3300000549 | LJQas_1002401 | LJQas_10024011 | 252 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5azc-assembly1.cif.gz_A | crystal structure of escherichia coli lgt in complex with phosphatidylglycerol | 0.8285 | 3 | 240 |
| 5azc-assembly1.cif.gz_A | crystal structure of escherichia coli lgt in complex with phosphatidylglycerol | 0.7825 | 3 | 240 |
| 3gnc-assembly1.cif.gz_C | crystal structure of glutaryl-coa dehydrogenase from burkholderia pseudomallei with fragment 6421 | 0.4327 | 114 | 244 |
| 2r0n-assembly1.cif.gz_A | the effect of a glu370asp mutation in glutaryl-coa dehydrogenase on proton transfer to the dienolate intermediate | 0.429 | 113 | 235 |
| 7ocd-assembly1.cif.gz_J | resting state glua1/a2 heterotetramer in complex with auxiliary subunit tarp gamma 8 (lbd-tmd) | 0.4198 | 114 | 243 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_G5EEQ9_4_113_1.20.120.550 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain | 0.5548 | 110 | 239 | 1.20.120.550 |
| af_G5EEQ9_4_113_1.20.120.550 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain | 0.5351 | 110 | 239 | 1.20.120.550 |
| af_Q9VDI6_16_125_1.20.120.550 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain | 0.511 | 111 | 227 | 1.20.120.550 |
| af_Q3KQJ0_93_231_1.10.10.1740 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like | 0.4974 | 100 | 239 | 1.10.10.1740 |
| af_Q9VDI6_16_125_1.20.120.550 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain | 0.4927 | 111 | 227 | 1.20.120.550 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C7G6D6-F1-model_v4 | deleted | 0.9629 | 1 | 247 |
|
| AF-A0A7X4FIV6-F1-model_v4 | Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase (EC 2.5.1.145) | 0.9614 | 1 | 242 |
GO:0005886
GO:0008961 GO:0042158 |
| AF-A0A7W1HA79-F1-model_v4 | Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase (EC 2.5.1.145) | 0.9575 | 1 | 239 |
GO:0005886
GO:0008961 GO:0042158 |
| AF-A0A2H6B8X2-F1-model_v4 | Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase (EC 2.5.1.145) | 0.9559 | 2 | 247 |
GO:0005886
GO:0008961 GO:0042158 |
| AF-A0A1V5IP04-F1-model_v4 | Prolipoprotein diacylglyceryl transferase (EC 2.4.99.-) | 0.9549 | 1 | 239 |
GO:0005886
GO:0008961 GO:0042158 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar