F418958

General Info

Members Datasets Scaffolds Average Seq Length
352 207 352 258

Family's Representative Sequence

Representative Sequence 3300005981|Ga0081538_10000963|Ga0081538_100009637
Length 242
Sequence VLPEINIGPLDLQTFGICFALAFLASGLIISRRLHELGKPVEWAYEMVFAALVGGLVGARVNYLIQNWDEVSDDLLGNIFSGSGLVFFGGLVGGALGVLLWAQMADAAAVPIAIGYAVGRVGCQLSGDGDYGIESDLPWAMAYPEGTVPTTEEVHPTPVYETVTIGIGALILWHLRDRFAPGVLFGLYLILTGGERFLVEFIRRNDSVVAGLTEPQLISLVVLALGAAIVTVRRAAPRAVTA

Samples

Sample ID Description Type Environment
1 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
36 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
37 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
38 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
109 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
110 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
111 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
112 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
113 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
114 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
115 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
116 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
117 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
118 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
119 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
120 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
121 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
122 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
123 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
124 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
125 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
126 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
127 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
128 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
129 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
130 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
131 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
132 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
133 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
134 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
135 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
136 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
137 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
138 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
139 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
140 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
141 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
142 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
143 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
144 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
145 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
146 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
147 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
148 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
149 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
150 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
151 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
152 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
153 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
154 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
155 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
156 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
157 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
158 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
159 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
160 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
161 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
162 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
163 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
164 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
165 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
166 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
167 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
168 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
182 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
183 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
184 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
185 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
186 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
187 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
188 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
189 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
190 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
191 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
193 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
194 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
195 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
196 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
197 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
198 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
199 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
200 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
201 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
202 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
203 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
204 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
205 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
206 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
207 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.85
Nodule 0
Rhizoplane 11.36
Rhizosphere 87.5
Stem 0
Stem Tuber 0
Unclassified 0.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1002401 3300000549 Bacteria 2608
2 JGI24034J26672_10000738 3300002239 Bacteria 4216
3 JGI25407J50210_10008326 3300003373 Bacteria 2614
4 JGI25407J50210_10020834 3300003373 Bacteria 1705
5 JGI25407J50210_10033982 3300003373 Bacteria 1316
6 Ga0070683_100000331 3300005329 Bacteria 32634
7 Ga0070683_100047183 3300005329 Bacteria 3980
8 Ga0070670_100070481 3300005331 Bacteria 3001
9 Ga0070677_10000030 3300005333 Bacteria 41834
10 Ga0070666_10013945 3300005335 Bacteria 5108
11 Ga0070680_100021103 3300005336 Bacteria 5173
12 Ga0068868_100592866 3300005338 Bacteria 981
13 Ga0070660_100031735 3300005339 Bacteria 3969
14 Ga0070660_100285185 3300005339 Bacteria 1352
15 Ga0070661_100003073 3300005344 Bacteria 11482
16 Ga0070661_100376169 3300005344 Bacteria 1119
17 Ga0070668_100438346 3300005347 Bacteria 1121
18 Ga0070675_100000073 3300005354 Bacteria 57652
19 Ga0070674_100001851 3300005356 Bacteria 11478
20 Ga0070674_100017707 3300005356 Bacteria 4488
21 Ga0070659_100030555 3300005366 Bacteria 4169
22 Ga0070667_100603147 3300005367 Bacteria 1012
23 Ga0070711_100006965 3300005439 Bacteria 6856
24 Ga0070662_100004047 3300005457 Bacteria 9205
25 Ga0070681_10032484 3300005458 Bacteria 5238
26 Ga0070679_100114092 3300005530 Bacteria 2687
27 Ga0070684_100008356 3300005535 Bacteria 8085
28 Ga0070684_100018501 3300005535 Bacteria 5741
29 Ga0070684_100150972 3300005535 Bacteria 2105
30 Ga0070697_100275825 3300005536 Unclassified 1442
31 Ga0068853_100080220 3300005539 Bacteria 2854
32 Ga0068853_100216272 3300005539 Bacteria 1748
33 Ga0070672_100000023 3300005543 Bacteria 68631
34 Ga0070665_100005655 3300005548 Bacteria 12855
35 Ga0070664_100104936 3300005564 Bacteria 2461
36 Ga0070664_100107162 3300005564 Bacteria 2436
37 Ga0070664_100430395 3300005564 Bacteria 1209
38 Ga0068857_100111149 3300005577 Bacteria 2463
39 Ga0068854_100151524 3300005578 Bacteria 1789
40 Ga0068856_100159115 3300005614 Bacteria 2269
41 Ga0068852_100110743 3300005616 Bacteria 2495
42 Ga0068866_10027900 3300005718 Bacteria 2685
43 Ga0068861_100058795 3300005719 Bacteria 2941
44 Ga0068861_100237925 3300005719 Bacteria 1547
45 Ga0068858_100000043 3300005842 Bacteria 132444
46 Ga0081455_10127203 3300005937 Bacteria 1997
47 Ga0081538_10000149 3300005981 Bacteria 72945
48 Ga0081538_10000517 3300005981 Bacteria 43195
49 Ga0081538_10000945 3300005981 Bacteria 31307
50 Ga0081538_10000963 3300005981 Bacteria 30702
51 Ga0081538_10001326 3300005981 Bacteria 25535
52 Ga0081538_10006574 3300005981 Bacteria 10205
53 Ga0081538_10014692 3300005981 Bacteria 6113
54 Ga0081538_10016515 3300005981 Bacteria 5655
55 Ga0081538_10021572 3300005981 Bacteria 4691
56 Ga0081538_10026136 3300005981 Bacteria 4092
57 Ga0081538_10038476 3300005981 Bacteria 3085
58 Ga0081538_10066482 3300005981 Bacteria 2021
59 Ga0081538_10072321 3300005981 Bacteria 1891
60 Ga0081538_10115699 3300005981 Unclassified 1303
61 Ga0081538_10130614 3300005981 Bacteria 1181
62 Ga0081538_10130919 3300005981 Bacteria 1179
63 Ga0075365_10178896 3300006038 Bacteria 1482
64 Ga0075432_10092053 3300006058 Bacteria 1111
65 Ga0070715_10000012 3300006163 Bacteria 173731
66 Ga0070712_100030112 3300006175 Bacteria 3644
67 Ga0075428_100017187 3300006844 Bacteria 7992
68 Ga0075428_100062783 3300006844 Bacteria 4066
69 Ga0075430_100002745 3300006846 Bacteria 14695
70 Ga0075430_100012413 3300006846 Bacteria 7248
71 Ga0075430_100026848 3300006846 Bacteria 4897
72 Ga0075430_100103988 3300006846 Bacteria 2371
73 Ga0075430_100215304 3300006846 Bacteria 1594
74 Ga0075430_100405686 3300006846 Bacteria 1125
75 Ga0075431_100003853 3300006847 Bacteria 14591
76 Ga0075431_100023665 3300006847 Bacteria 6288
77 Ga0075431_100216708 3300006847 Bacteria 1953
78 Ga0075429_100012152 3300006880 Bacteria 7463
79 Ga0097620_100750323 3300006931 Bacteria 1065
80 Ga0075435_100701378 3300007076 Bacteria 880
81 Ga0105240_10051664 3300009093 Bacteria 5171
82 Ga0111539_10007192 3300009094 Bacteria 14262
83 Ga0111539_10352108 3300009094 Bacteria 1714
84 Ga0105245_10252501 3300009098 Bacteria 1714
85 Ga0105245_10347688 3300009098 Bacteria 1468
86 Ga0105247_10002347 3300009101 Bacteria 12921
87 Ga0105247_10052054 3300009101 Bacteria 2523
88 Ga0114129_10051681 3300009147 Bacteria 5769
89 Ga0114129_10288437 3300009147 Bacteria 2191
90 Ga0114129_10321571 3300009147 Unclassified 2057
91 Ga0105243_10045575 3300009148 Bacteria 3446
92 Ga0105243_10208730 3300009148 Bacteria 1718
93 Ga0105242_10018654 3300009176 Bacteria 5427
94 Ga0105248_10000466 3300009177 Bacteria 46063
95 Ga0105248_10500987 3300009177 Bacteria 1369
96 Ga0105237_10210161 3300009545 Unclassified 1946
97 Ga0105238_10146290 3300009551 Bacteria 2340
98 Ga0105249_10000192 3300009553 Bacteria 69997
99 Ga0105249_10005193 3300009553 Bacteria 11239
100 Ga0105239_10059329 3300010375 Bacteria 4199
101 Ga0105239_10425498 3300010375 Bacteria 1505
102 Ga0157371_10007237 3300013102 Bacteria 9013
103 Ga0157370_10062919 3300013104 Bacteria 3517
104 Ga0157369_10220149 3300013105 Bacteria 1987
105 Ga0157374_10010028 3300013296 Bacteria 8132
106 Ga0157378_10017735 3300013297 Bacteria 6249
107 Ga0157378_10018698 3300013297 Bacteria 6091
108 Ga0157372_10031712 3300013307 Bacteria 5787
109 Ga0157375_10000322 3300013308 Bacteria 42941
110 Ga0157379_10014324 3300014968 Bacteria 6958
111 Ga0207682_10000003 3300025893 Bacteria 128548
112 Ga0207642_10004304 3300025899 Bacteria 4588
113 Ga0207710_10000422 3300025900 Bacteria 27760
114 Ga0207688_10022707 3300025901 Bacteria 3435
115 Ga0207680_10004531 3300025903 Bacteria 6593
116 Ga0207685_10000001 3300025905 Bacteria 604473
117 Ga0207705_10048398 3300025909 Bacteria 3058
118 Ga0207707_10014354 3300025912 Bacteria 6899
119 Ga0207695_10445753 3300025913 Bacteria 1178
120 Ga0207693_10004469 3300025915 Bacteria 11824
121 Ga0207663_10004537 3300025916 Bacteria 6914
122 Ga0207660_10067054 3300025917 Bacteria 2598
123 Ga0207657_10026111 3300025919 Bacteria 5373
124 Ga0207657_10150926 3300025919 Bacteria 1893
125 Ga0207649_10078909 3300025920 Bacteria 2125
126 Ga0207652_10009003 3300025921 Bacteria 8045
127 Ga0207681_10247815 3300025923 Bacteria 1390
128 Ga0207694_10270640 3300025924 Bacteria 1393
129 Ga0207650_10142591 3300025925 Bacteria 1885
130 Ga0207659_10000082 3300025926 Bacteria 57573
131 Ga0207687_10000012 3300025927 Bacteria 370729
132 Ga0207690_10008712 3300025932 Bacteria 6019
133 Ga0207690_10094235 3300025932 Bacteria 2124
134 Ga0207690_10542030 3300025932 Unclassified 945
135 Ga0207706_10021827 3300025933 Bacteria 5746
136 Ga0207706_10112116 3300025933 Bacteria 2399
137 Ga0207686_10041392 3300025934 Bacteria 2809
138 Ga0207709_10015313 3300025935 Bacteria 4252
139 Ga0207709_10084600 3300025935 Bacteria 2054
140 Ga0207709_10138436 3300025935 Bacteria 1670
141 Ga0207704_10343972 3300025938 Bacteria 1159
142 Ga0207691_10000172 3300025940 Bacteria 60310
143 Ga0207691_10438026 3300025940 Bacteria 1113
144 Ga0207711_10000085 3300025941 Bacteria 99467
145 Ga0207661_10000192 3300025944 Bacteria 39824
146 Ga0207661_10007315 3300025944 Bacteria 7852
147 Ga0207679_10081240 3300025945 Bacteria 2478
148 Ga0207679_10101623 3300025945 Bacteria 2250
149 Ga0207679_10113014 3300025945 Bacteria 2147
150 Ga0207667_10408207 3300025949 Bacteria 1383
151 Ga0207712_10000003 3300025961 Bacteria 615314
152 Ga0207712_10055457 3300025961 Bacteria 2788
153 Ga0207668_10001630 3300025972 Bacteria 13112
154 Ga0207703_10000053 3300026035 Bacteria 143924
155 Ga0207703_10321387 3300026035 Bacteria 1417
156 Ga0207639_10180474 3300026041 Bacteria 1795
157 Ga0207639_10346773 3300026041 Bacteria 1325
158 Ga0207678_10128687 3300026067 Bacteria 2159
159 Ga0207708_10007953 3300026075 Bacteria 7859
160 Ga0207708_10045766 3300026075 Bacteria 3334
161 Ga0207702_10642159 3300026078 Bacteria 1043
162 Ga0207675_100007422 3300026118 Bacteria 10359
163 Ga0207675_100015600 3300026118 Bacteria 7086
164 Ga0207698_10087463 3300026142 Bacteria 2538
165 Ga0207428_10077853 3300027907 Bacteria 2596
166 Ga0268266_10000182 3300028379 Bacteria 111453
167 Ga0268265_10418350 3300028380 Bacteria 1244
168 Ga0268265_10536216 3300028380 Bacteria 1109
169 Ga0265334_10094198 3300028573 Bacteria 1090
170 Ga0265338_10319510 3300028800 Bacteria 1124
171 Ga0307408_100067671 3300031548 Bacteria 2628
172 Ga0307408_100070120 3300031548 Bacteria 2587
173 Ga0316576_10481862 3300031727 Bacteria 914
174 Ga0307405_10112811 3300031731 Bacteria 1845
175 Ga0307405_10470546 3300031731 Bacteria 1001
176 Ga0307413_10131032 3300031824 Bacteria 1716
177 Ga0307413_10182704 3300031824 Bacteria 1497
178 Ga0307410_10067489 3300031852 Bacteria 2468
179 Ga0307410_10171912 3300031852 Bacteria 1633
180 Ga0307410_10329106 3300031852 Bacteria 1214
181 Ga0307406_10018107 3300031901 Bacteria 4110
182 Ga0307406_10089557 3300031901 Unclassified 2068
183 Ga0307406_10337113 3300031901 Bacteria 1173
184 Ga0307407_10348261 3300031903 Bacteria 1048
185 Ga0307412_10460437 3300031911 Bacteria 1050
186 Ga0307409_100009575 3300031995 Bacteria 5964
187 Ga0307409_100027311 3300031995 Bacteria 4043
188 Ga0307409_100037460 3300031995 Bacteria 3576
189 Ga0307409_100128230 3300031995 Bacteria 2162
190 Ga0307409_100259365 3300031995 Bacteria 1594
191 Ga0307409_100351602 3300031995 Bacteria 1391
192 Ga0307409_100485696 3300031995 Bacteria 1199
193 Ga0307416_100034835 3300032002 Bacteria 3837
194 Ga0307416_100103029 3300032002 Bacteria 2490
195 Ga0307416_100122374 3300032002 Bacteria 2322
196 Ga0307416_100331242 3300032002 Bacteria 1530
197 Ga0307416_100625422 3300032002 Bacteria 1159
198 Ga0307411_10012199 3300032005 Archaea 4676
199 Ga0307411_10100143 3300032005 Bacteria 2047
200 Ga0307411_10610910 3300032005 Bacteria 939
201 Ga0307415_100005179 3300032126 Bacteria 6885
202 Ga0307415_100008232 3300032126 Bacteria 5770
203 Ga0307415_100348767 3300032126 Bacteria 1245
204 Ga0307415_100457764 3300032126 Bacteria 1105
205 Ga0373962_0019252 3300035242 Bacteria 1784
206 Ga0373931_0084136 3300035691 Bacteria 1761
207 Ga0395899_0338384 3300037312 Bacteria 1009
208 Ga0395900_0174114 3300037418 Bacteria 2189
209 Ga0395900_0617949 3300037418 Bacteria 1023
210 Ga0395898_0189615 3300037466 Bacteria 1964
211 Ga0395898_0503431 3300037466 Bacteria 1152
212 Ga0395898_0549714 3300037466 Bacteria 1097
213 Ga0395905_0016275 3300037471 Bacteria 7065
214 Ga0395905_0465237 3300037471 Bacteria 1163
215 Ga0395901_0139730 3300038443 Bacteria 2546
216 Ga0395901_0587441 3300038443 Bacteria 1124
217 Ga0439463_020367 3300042016 Bacteria 1654
218 Ga0466971_0063834 3300044719 Bacteria 1667
219 Ga0495603_0000044 3300046455 Bacteria 53548
220 Ga0495603_0000291 3300046455 Bacteria 26643
221 Ga0495641_0068770 3300046461 Bacteria 1592
222 Ga0495653_0158347 3300046463 Bacteria 1575
223 Ga0495662_0075391 3300046476 Bacteria 1637
224 Ga0495606_0000082 3300046507 Bacteria 159585
225 Ga0495608_0007029 3300046511 Bacteria 7967
226 Ga0495620_0000446 3300046515 Bacteria 27496
227 Ga0495628_0024500 3300046516 Bacteria 4939
228 Ga0495628_0164331 3300046516 Bacteria 1686
229 Ga0495628_0269743 3300046516 Bacteria 1266
230 Ga0495630_0000007 3300046517 Bacteria 376915
231 Ga0495630_0025125 3300046517 Bacteria 4403
232 Ga0495586_0000384 3300046535 Bacteria 27060
233 Ga0495621_0005604 3300046539 Bacteria 3621
234 Ga0495634_0000125 3300046642 Bacteria 65586
235 Ga0495634_0000828 3300046642 Bacteria 29940
236 Ga0495634_0009750 3300046642 Bacteria 7066
237 Ga0495588_0000241 3300046674 Bacteria 46762
238 Ga0495657_0025057 3300046675 Bacteria 4239
239 Ga0495647_0000014 3300046681 Bacteria 87792
240 Ga0495647_0003736 3300046681 Bacteria 4890
241 Ga0495624_0000256 3300046690 Bacteria 42059
242 Ga0495624_0132074 3300046690 Bacteria 1531
243 Ga0495624_0201517 3300046690 Bacteria 1209
244 Ga0495589_0104072 3300046794 Bacteria 1372
245 Ga0495589_0169248 3300046794 Bacteria 1039
246 Ga0495581_0300780 3300047315 Bacteria 938
247 Ga0495672_0012106 3300047320 Bacteria 6040
248 Ga0495676_0029455 3300047321 Bacteria 4674
249 Ga0495676_0189380 3300047321 Bacteria 1436
250 Ga0495680_0035417 3300047322 Bacteria 4021
251 Ga0496100_0000016 3300048903 Bacteria 166058
252 Ga0496101_0000038 3300048904 Bacteria 166058
253 Ga0496102_0579709 3300048905 Bacteria 1045
254 Ga0496104_0000003 3300048907 Bacteria 669219
255 Ga0496104_0000007 3300048907 Bacteria 524804
256 Ga0496105_0000002 3300048908 Bacteria 753215
257 Ga0496105_0000008 3300048908 Bacteria 335652
258 Ga0496106_0000013 3300048909 Bacteria 202263
259 Ga0496106_0000027 3300048909 Bacteria 149560
260 Ga0496107_0000003 3300048910 Bacteria 304038
261 Ga0496107_0018663 3300048910 Bacteria 4887
262 Ga0496107_0127743 3300048910 Bacteria 1875
263 Ga0496108_0000002 3300048911 Bacteria 700890
264 Ga0496108_0000110 3300048911 Bacteria 84585
265 Ga0496108_0030218 3300048911 Bacteria 4490
266 Ga0496108_0099527 3300048911 Bacteria 2479
267 Ga0496108_0353484 3300048911 Bacteria 1282
268 Ga0496109_0000001 3300048912 Bacteria 700852
269 Ga0496109_0000046 3300048912 Bacteria 131025
270 Ga0496109_0000087 3300048912 Bacteria 95196
271 Ga0496109_0074328 3300048912 Bacteria 3124
272 Ga0496109_0075046 3300048912 Bacteria 3109
273 Ga0496109_0242739 3300048912 Bacteria 1696
274 Ga0496110_0033469 3300048913 Bacteria 4446
275 Ga0496110_0053643 3300048913 Bacteria 3545
276 Ga0496110_0154763 3300048913 Bacteria 2077
277 Ga0496110_0212948 3300048913 Bacteria 1757
278 Ga0496111_0020696 3300048914 Bacteria 4585
279 Ga0496111_0025151 3300048914 Bacteria 4199
280 Ga0496111_0035821 3300048914 Bacteria 3548
281 Ga0496111_0072003 3300048914 Bacteria 2516
282 Ga0496111_0154816 3300048914 Bacteria 1701
283 Ga0496112_0073858 3300048915 Bacteria 3371
284 Ga0496112_0216538 3300048915 Bacteria 1871
285 Ga0496113_0004020 3300048916 Bacteria 8951
286 Ga0496113_0011314 3300048916 Bacteria 5946
287 Ga0496113_0014998 3300048916 Bacteria 5307
288 Ga0496113_0028178 3300048916 Bacteria 4037
289 Ga0496114_0000010 3300048917 Bacteria 363396
290 Ga0496115_0000710 3300048918 Bacteria 24673
291 Ga0496119_0114751 3300048922 Bacteria 1489
292 Ga0501031_0009949 3300049568 Bacteria 6192
293 Ga0501032_0009066 3300049569 Bacteria 7225
294 Ga0501033_0009639 3300049570 Bacteria 7430
295 Ga0501034_0035677 3300049571 Bacteria 5040
296 Ga0501036_0018640 3300049572 Bacteria 5818
297 Ga0501036_0304314 3300049572 Bacteria 1333
298 Ga0501037_0112829 3300049573 Bacteria 1957
299 Ga0501038_0032054 3300049574 Bacteria 4640
300 Ga0501039_0020827 3300049575 Bacteria 5027
301 Ga0501042_0027635 3300049578 Bacteria 3990
302 Ga0501043_0034948 3300049579 Bacteria 3953
303 Ga0501046_0023848 3300049580 Bacteria 5026
304 Ga0501046_0109741 3300049580 Bacteria 2109
305 Ga0501047_0069774 3300049581 Bacteria 3383
306 Ga0501048_0025821 3300049582 Bacteria 4279
307 Ga0501048_0351579 3300049582 Bacteria 1051
308 Ga0501067_0005754 3300049583 Bacteria 6879
309 Ga0501068_0002292 3300049584 Bacteria 10190
310 Ga0501069_0016854 3300049585 Bacteria 3925
311 Ga0501071_0053506 3300049587 Bacteria 2912
312 Ga0501071_0116997 3300049587 Bacteria 1974
313 Ga0501072_0032450 3300049588 Bacteria 4090
314 Ga0501073_0016285 3300049589 Bacteria 5388
315 Ga0501074_0014343 3300049590 Bacteria 5765
316 Ga0501074_0343792 3300049590 Bacteria 1059
317 Ga0501079_0180520 3300049741 Bacteria 1647
318 Ga0501079_0351982 3300049741 Bacteria 1154
319 Ga0501080_0023463 3300049742 Bacteria 5717
320 Ga0501081_0338096 3300049743 Bacteria 1108
321 Ga0501081_0380973 3300049743 Bacteria 1042
322 Ga0501035_0046785 3300049822 Bacteria 3890
323 Ga0501035_0405944 3300049822 Bacteria 1133
324 Ga0501035_0600338 3300049822 Bacteria 897
325 Ga0501044_0040324 3300049823 Bacteria 4866
326 nmdc:mga0yw44_149118_c1 3300050492 Bacteria 1524
327 nmdc:mga05p37_196250_c1 3300050507 Bacteria 2447
328 nmdc:mga05p37_40688_c1 3300050507 Bacteria 5707
329 nmdc:mga05p37_431368_c1 3300050507 Bacteria 1531
330 nmdc:mga05p37_875010_c1 3300050507 Bacteria 972
331 nmdc:mga05p37_924843_c1 3300050507 Bacteria 937
332 nmdc:mga09592_9222_c1 3300050508 Bacteria 8025
333 nmdc:mga0qj67_207893_c1 3300050509 Bacteria 1590
334 nmdc:mga0qj67_25411_c1 3300050509 Bacteria 4576
335 nmdc:mga0qj67_31166_c1 3300050509 Bacteria 4154
336 nmdc:mga0qj67_372_c1 3300050509 Bacteria 30883
337 nmdc:mga06r32_104593_c1 3300050510 Bacteria 2780
338 nmdc:mga08y16_268833_c1 3300050511 Bacteria 1760
339 nmdc:mga08y16_484580_c1 3300050511 Bacteria 1258
340 nmdc:mga08y16_90806_c1 3300050511 Bacteria 3184
341 nmdc:mga0a205_124_c2 3300050515 Bacteria 20732
342 Ga0495601_0000214 3300053077 Bacteria 31046
343 Ga0495601_0017635 3300053077 Bacteria 4336
344 Ga0495612_0003739 3300053078 Bacteria 6324
345 Ga0495619_0000024 3300053085 Bacteria 180821
346 Ga0495619_0002211 3300053085 Bacteria 12886
347 Ga0500566_0003427 3300053094 Bacteria 9458
348 Ga0501084_0031112 3300054114 Bacteria 4464
349 Ga0501084_0486113 3300054114 Bacteria 1044
350 Ga0501082_0028964 3300060353 Bacteria 4770
351 Ga0466962_0097428 3300061719 Bacteria 1411
352 Ga0530510_0037485 3300061734 Bacteria 3497

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049573 Ga0501037_0112829 Ga0501037_0112829_1224_1946 220
2 3300005338 Ga0068868_100592866 Ga0068868_1005928661 232
3 3300005981 Ga0081538_10000963 Ga0081538_100009637 240
4 3300005564 Ga0070664_100107162 Ga0070664_1001071622 243
5 3300025940 Ga0207691_10438026 Ga0207691_104380262 243
6 3300025945 Ga0207679_10101623 Ga0207679_101016233 243
7 3300031901 Ga0307406_10337113 Ga0307406_103371132 244
8 3300047315 Ga0495581_0300780 Ga0495581_0300780_54_809 244
9 3300049568 Ga0501031_0009949 Ga0501031_0009949_4379_5173 244
10 3300049569 Ga0501032_0009066 Ga0501032_0009066_6272_7066 244
11 3300049570 Ga0501033_0009639 Ga0501033_0009639_3291_4085 244
12 3300049571 Ga0501034_0035677 Ga0501034_0035677_2153_2947 244
13 3300049572 Ga0501036_0018640 Ga0501036_0018640_3291_4085 244
14 3300049574 Ga0501038_0032054 Ga0501038_0032054_2961_3755 244
15 3300049575 Ga0501039_0020827 Ga0501039_0020827_3372_4166 244
16 3300049578 Ga0501042_0027635 Ga0501042_0027635_1104_1898 244
17 3300049579 Ga0501043_0034948 Ga0501043_0034948_1265_2059 244
18 3300049580 Ga0501046_0023848 Ga0501046_0023848_861_1655 244
19 3300049581 Ga0501047_0069774 Ga0501047_0069774_496_1290 244
20 3300049582 Ga0501048_0025821 Ga0501048_0025821_1091_1885 244
21 3300049583 Ga0501067_0005754 Ga0501067_0005754_3637_4431 244
22 3300049584 Ga0501068_0002292 Ga0501068_0002292_6308_7102 244
23 3300049585 Ga0501069_0016854 Ga0501069_0016854_1367_2161 244
24 3300049587 Ga0501071_0053506 Ga0501071_0053506_929_1723 244
25 3300049588 Ga0501072_0032450 Ga0501072_0032450_2950_3744 244
26 3300049589 Ga0501073_0016285 Ga0501073_0016285_1634_2428 244
27 3300049590 Ga0501074_0014343 Ga0501074_0014343_2022_2816 244
28 3300049741 Ga0501079_0180520 Ga0501079_0180520_837_1631 244
29 3300049742 Ga0501080_0023463 Ga0501080_0023463_1957_2751 244
30 3300049822 Ga0501035_0046785 Ga0501035_0046785_1004_1798 244
31 3300049823 Ga0501044_0040324 Ga0501044_0040324_2951_3745 244
32 3300054114 Ga0501084_0031112 Ga0501084_0031112_2028_2822 244
33 3300060353 Ga0501082_0028964 Ga0501082_0028964_3012_3806 244
34 3300005356 Ga0070674_100001851 Ga0070674_1000018517 245
35 3300005536 Ga0070697_100275825 Ga0070697_1002758252 245
36 3300009148 Ga0105243_10045575 Ga0105243_100455753 245
37 3300025935 Ga0207709_10015313 Ga0207709_100153132 245
38 3300028380 Ga0268265_10418350 Ga0268265_104183502 245
39 3300037466 Ga0395898_0549714 Ga0395898_0549714_82_834 245
40 3300005339 Ga0070660_100285185 Ga0070660_1002851852 247
41 3300005356 Ga0070674_100017707 Ga0070674_1000177073 247
42 3300005564 Ga0070664_100430395 Ga0070664_1004303952 247
43 3300005578 Ga0068854_100151524 Ga0068854_1001515243 247
44 3300005719 Ga0068861_100237925 Ga0068861_1002379252 247
45 3300006846 Ga0075430_100012413 Ga0075430_1000124133 247
46 3300006846 Ga0075430_100215304 Ga0075430_1002153042 247
47 3300009147 Ga0114129_10288437 Ga0114129_102884372 247
48 3300009148 Ga0105243_10208730 Ga0105243_102087302 247
49 3300025919 Ga0207657_10150926 Ga0207657_101509262 247
50 3300025933 Ga0207706_10112116 Ga0207706_101121161 247
51 3300025935 Ga0207709_10084600 Ga0207709_100846002 247
52 3300025945 Ga0207679_10113014 Ga0207679_101130142 247
53 3300025949 Ga0207667_10408207 Ga0207667_104082072 247
54 3300026075 Ga0207708_10007953 Ga0207708_100079535 247
55 3300026118 Ga0207675_100015600 Ga0207675_1000156007 247
56 3300028380 Ga0268265_10536216 Ga0268265_105362162 247
57 3300031727 Ga0316576_10481862 Ga0316576_104818622 247
58 3300031731 Ga0307405_10470546 Ga0307405_104705461 247
59 3300032005 Ga0307411_10610910 Ga0307411_106109102 247
60 3300032126 Ga0307415_100457764 Ga0307415_1004577642 247
61 3300037418 Ga0395900_0617949 Ga0395900_0617949_26_781 247
62 3300042016 Ga0439463_020367 Ga0439463_020367_335_1123 247
63 3300048912 Ga0496109_0242739 Ga0496109_0242739_788_1543 247
64 3300050509 nmdc:mga0qj67_372_c1 nmdc:mga0qj67_372_c1_11022_11807 247
65 3300002239 JGI24034J26672_10000738 JGI24034J26672_100007385 248
66 3300003373 JGI25407J50210_10008326 JGI25407J50210_100083264 248
67 3300003373 JGI25407J50210_10020834 JGI25407J50210_100208342 248
68 3300003373 JGI25407J50210_10033982 JGI25407J50210_100339822 248
69 3300005457 Ga0070662_100004047 Ga0070662_1000040477 248
70 3300005719 Ga0068861_100058795 Ga0068861_1000587952 248
71 3300005937 Ga0081455_10127203 Ga0081455_101272031 248
72 3300005981 Ga0081538_10000149 Ga0081538_100001492 248
73 3300005981 Ga0081538_10000517 Ga0081538_1000051729 248
74 3300005981 Ga0081538_10000945 Ga0081538_1000094512 248
75 3300005981 Ga0081538_10001326 Ga0081538_1000132616 248
76 3300005981 Ga0081538_10006574 Ga0081538_100065744 248
77 3300005981 Ga0081538_10014692 Ga0081538_100146924 248
78 3300005981 Ga0081538_10016515 Ga0081538_100165154 248
79 3300005981 Ga0081538_10021572 Ga0081538_100215722 248
80 3300005981 Ga0081538_10026136 Ga0081538_100261364 248
81 3300005981 Ga0081538_10038476 Ga0081538_100384762 248
82 3300005981 Ga0081538_10066482 Ga0081538_100664821 248
83 3300005981 Ga0081538_10072321 Ga0081538_100723212 248
84 3300005981 Ga0081538_10115699 Ga0081538_101156991 248
85 3300005981 Ga0081538_10130614 Ga0081538_101306141 248
86 3300005981 Ga0081538_10130919 Ga0081538_101309192 248
87 3300006038 Ga0075365_10178896 Ga0075365_101788962 248
88 3300006058 Ga0075432_10092053 Ga0075432_100920531 248
89 3300006844 Ga0075428_100017187 Ga0075428_1000171878 248
90 3300006844 Ga0075428_100062783 Ga0075428_1000627834 248
91 3300006846 Ga0075430_100002745 Ga0075430_10000274511 248
92 3300006846 Ga0075430_100405686 Ga0075430_1004056862 248
93 3300006847 Ga0075431_100003853 Ga0075431_1000038536 248
94 3300009094 Ga0111539_10007192 Ga0111539_1000719212 248
95 3300009098 Ga0105245_10252501 Ga0105245_102525012 248
96 3300009147 Ga0114129_10051681 Ga0114129_100516813 248
97 3300009147 Ga0114129_10321571 Ga0114129_103215712 248
98 3300009553 Ga0105249_10005193 Ga0105249_100051934 248
99 3300010375 Ga0105239_10059329 Ga0105239_100593295 248
100 3300025923 Ga0207681_10247815 Ga0207681_102478151 248
101 3300025932 Ga0207690_10542030 Ga0207690_105420301 248
102 3300025933 Ga0207706_10021827 Ga0207706_100218275 248
103 3300025935 Ga0207709_10138436 Ga0207709_101384362 248
104 3300025961 Ga0207712_10055457 Ga0207712_100554572 248
105 3300025972 Ga0207668_10001630 Ga0207668_100016304 248
106 3300026075 Ga0207708_10045766 Ga0207708_100457663 248
107 3300026118 Ga0207675_100007422 Ga0207675_1000074225 248
108 3300027907 Ga0207428_10077853 Ga0207428_100778532 248
109 3300031548 Ga0307408_100067671 Ga0307408_1000676712 248
110 3300031731 Ga0307405_10112811 Ga0307405_101128111 248
111 3300031824 Ga0307413_10131032 Ga0307413_101310322 248
112 3300031852 Ga0307410_10329106 Ga0307410_103291062 248
113 3300031901 Ga0307406_10018107 Ga0307406_100181073 248
114 3300031901 Ga0307406_10089557 Ga0307406_100895574 248
115 3300031903 Ga0307407_10348261 Ga0307407_103482612 248
116 3300031911 Ga0307412_10460437 Ga0307412_104604372 248
117 3300031995 Ga0307409_100009575 Ga0307409_1000095755 248
118 3300031995 Ga0307409_100027311 Ga0307409_1000273115 248
119 3300031995 Ga0307409_100037460 Ga0307409_1000374604 248
120 3300031995 Ga0307409_100259365 Ga0307409_1002593651 248
121 3300031995 Ga0307409_100351602 Ga0307409_1003516022 248
122 3300031995 Ga0307409_100485696 Ga0307409_1004856961 248
123 3300032002 Ga0307416_100034835 Ga0307416_1000348352 248
124 3300032002 Ga0307416_100122374 Ga0307416_1001223741 248
125 3300032002 Ga0307416_100331242 Ga0307416_1003312422 248
126 3300032002 Ga0307416_100625422 Ga0307416_1006254222 248
127 3300032005 Ga0307411_10100143 Ga0307411_101001431 248
128 3300032126 Ga0307415_100005179 Ga0307415_1000051796 248
129 3300032126 Ga0307415_100008232 Ga0307415_1000082322 248
130 3300032126 Ga0307415_100348767 Ga0307415_1003487671 248
131 3300035242 Ga0373962_0019252 Ga0373962_0019252_26_778 248
132 3300035691 Ga0373931_0084136 Ga0373931_0084136_651_1403 248
133 3300037466 Ga0395898_0503431 Ga0395898_0503431_309_1061 248
134 3300037471 Ga0395905_0465237 Ga0395905_0465237_193_945 248
135 3300046794 Ga0495589_0169248 Ga0495589_0169248_274_1026 248
136 3300049572 Ga0501036_0304314 Ga0501036_0304314_514_1266 248
137 3300049580 Ga0501046_0109741 Ga0501046_0109741_1199_1951 248
138 3300049741 Ga0501079_0351982 Ga0501079_0351982_301_1053 248
139 3300049822 Ga0501035_0600338 Ga0501035_0600338_117_869 248
140 3300050492 nmdc:mga0yw44_149118_c1 nmdc:mga0yw44_149118_c1_75_827 248
141 3300050507 nmdc:mga05p37_196250_c1 nmdc:mga05p37_196250_c1_449_1201 248
142 3300050507 nmdc:mga05p37_40688_c1 nmdc:mga05p37_40688_c1_1813_2565 248
143 3300050507 nmdc:mga05p37_431368_c1 nmdc:mga05p37_431368_c1_164_916 248
144 3300050507 nmdc:mga05p37_875010_c1 nmdc:mga05p37_875010_c1_189_941 248
145 3300050509 nmdc:mga0qj67_25411_c1 nmdc:mga0qj67_25411_c1_23_775 248
146 3300050510 nmdc:mga06r32_104593_c1 nmdc:mga06r32_104593_c1_1288_2040 248
147 3300050511 nmdc:mga08y16_90806_c1 nmdc:mga08y16_90806_c1_953_1705 248
148 3300054114 Ga0501084_0486113 Ga0501084_0486113_45_797 248
149 3300061734 Ga0530510_0037485 Ga0530510_0037485_1833_2585 248
150 3300005329 Ga0070683_100000331 Ga0070683_10000033133 249
151 3300005331 Ga0070670_100070481 Ga0070670_1000704813 249
152 3300005333 Ga0070677_10000030 Ga0070677_100000309 249
153 3300005335 Ga0070666_10013945 Ga0070666_100139456 249
154 3300005344 Ga0070661_100376169 Ga0070661_1003761691 249
155 3300005347 Ga0070668_100438346 Ga0070668_1004383462 249
156 3300005354 Ga0070675_100000073 Ga0070675_10000007352 249
157 3300005367 Ga0070667_100603147 Ga0070667_1006031472 249
158 3300005439 Ga0070711_100006965 Ga0070711_1000069659 249
159 3300005535 Ga0070684_100018501 Ga0070684_1000185012 249
160 3300005535 Ga0070684_100150972 Ga0070684_1001509723 249
161 3300005539 Ga0068853_100216272 Ga0068853_1002162722 249
162 3300005543 Ga0070672_100000023 Ga0070672_10000002318 249
163 3300005548 Ga0070665_100005655 Ga0070665_1000056555 249
164 3300005577 Ga0068857_100111149 Ga0068857_1001111492 249
165 3300005718 Ga0068866_10027900 Ga0068866_100279003 249
166 3300006163 Ga0070715_10000012 Ga0070715_10000012182 249
167 3300006175 Ga0070712_100030112 Ga0070712_1000301123 249
168 3300006846 Ga0075430_100026848 Ga0075430_1000268485 249
169 3300006846 Ga0075430_100103988 Ga0075430_1001039883 249
170 3300006847 Ga0075431_100023665 Ga0075431_1000236653 249
171 3300006847 Ga0075431_100216708 Ga0075431_1002167081 249
172 3300006880 Ga0075429_100012152 Ga0075429_1000121523 249
173 3300007076 Ga0075435_100701378 Ga0075435_1007013781 249
174 3300009094 Ga0111539_10352108 Ga0111539_103521082 249
175 3300009098 Ga0105245_10347688 Ga0105245_103476882 249
176 3300009101 Ga0105247_10002347 Ga0105247_1000234712 249
177 3300009101 Ga0105247_10052054 Ga0105247_100520542 249
178 3300009176 Ga0105242_10018654 Ga0105242_100186542 249
179 3300009177 Ga0105248_10000466 Ga0105248_100004669 249
180 3300009177 Ga0105248_10500987 Ga0105248_105009871 249
181 3300009553 Ga0105249_10000192 Ga0105249_1000019218 249
182 3300013102 Ga0157371_10007237 Ga0157371_100072376 249
183 3300013296 Ga0157374_10010028 Ga0157374_100100283 249
184 3300013297 Ga0157378_10017735 Ga0157378_100177353 249
185 3300013297 Ga0157378_10018698 Ga0157378_100186983 249
186 3300013308 Ga0157375_10000322 Ga0157375_1000032229 249
187 3300014968 Ga0157379_10014324 Ga0157379_100143242 249
188 3300025893 Ga0207682_10000003 Ga0207682_1000000383 249
189 3300025899 Ga0207642_10004304 Ga0207642_100043043 249
190 3300025900 Ga0207710_10000422 Ga0207710_1000042212 249
191 3300025901 Ga0207688_10022707 Ga0207688_100227072 249
192 3300025903 Ga0207680_10004531 Ga0207680_100045316 249
193 3300025905 Ga0207685_10000001 Ga0207685_10000001598 249
194 3300025909 Ga0207705_10048398 Ga0207705_100483983 249
195 3300025915 Ga0207693_10004469 Ga0207693_1000446915 249
196 3300025916 Ga0207663_10004537 Ga0207663_100045372 249
197 3300025925 Ga0207650_10142591 Ga0207650_101425912 249
198 3300025926 Ga0207659_10000082 Ga0207659_1000008252 249
199 3300025927 Ga0207687_10000012 Ga0207687_10000012124 249
200 3300025934 Ga0207686_10041392 Ga0207686_100413923 249
201 3300025938 Ga0207704_10343972 Ga0207704_103439721 249
202 3300025940 Ga0207691_10000172 Ga0207691_1000017266 249
203 3300025941 Ga0207711_10000085 Ga0207711_1000008553 249
204 3300025944 Ga0207661_10000192 Ga0207661_1000019211 249
205 3300025961 Ga0207712_10000003 Ga0207712_10000003341 249
206 3300026035 Ga0207703_10321387 Ga0207703_103213872 249
207 3300026041 Ga0207639_10180474 Ga0207639_101804742 249
208 3300026067 Ga0207678_10128687 Ga0207678_101286872 249
209 3300028379 Ga0268266_10000182 Ga0268266_1000018299 249
210 3300031852 Ga0307410_10067489 Ga0307410_100674894 249
211 3300038443 Ga0395901_0139730 Ga0395901_0139730_183_956 249
212 3300044719 Ga0466971_0063834 Ga0466971_0063834_803_1561 249
213 3300046455 Ga0495603_0000044 Ga0495603_0000044_5797_6588 249
214 3300046461 Ga0495641_0068770 Ga0495641_0068770_443_1231 249
215 3300046463 Ga0495653_0158347 Ga0495653_0158347_15_800 249
216 3300046476 Ga0495662_0075391 Ga0495662_0075391_329_1117 249
217 3300046507 Ga0495606_0000082 Ga0495606_0000082_122014_122799 249
218 3300046515 Ga0495620_0000446 Ga0495620_0000446_10546_11337 249
219 3300046516 Ga0495628_0164331 Ga0495628_0164331_767_1552 249
220 3300046516 Ga0495628_0269743 Ga0495628_0269743_37_828 249
221 3300046517 Ga0495630_0000007 Ga0495630_0000007_53195_53980 249
222 3300046517 Ga0495630_0025125 Ga0495630_0025125_1480_2265 249
223 3300046535 Ga0495586_0000384 Ga0495586_0000384_10583_11374 249
224 3300046539 Ga0495621_0005604 Ga0495621_0005604_727_1518 249
225 3300046642 Ga0495634_0000125 Ga0495634_0000125_62390_63181 249
226 3300046642 Ga0495634_0000828 Ga0495634_0000828_1754_2545 249
227 3300046642 Ga0495634_0009750 Ga0495634_0009750_891_1676 249
228 3300046674 Ga0495588_0000241 Ga0495588_0000241_26049_26834 249
229 3300046675 Ga0495657_0025057 Ga0495657_0025057_155_940 249
230 3300046681 Ga0495647_0000014 Ga0495647_0000014_32357_33148 249
231 3300046681 Ga0495647_0003736 Ga0495647_0003736_741_1529 249
232 3300046690 Ga0495624_0000256 Ga0495624_0000256_12538_13326 249
233 3300046690 Ga0495624_0132074 Ga0495624_0132074_352_1137 249
234 3300047320 Ga0495672_0012106 Ga0495672_0012106_2629_3414 249
235 3300047321 Ga0495676_0029455 Ga0495676_0029455_1571_2356 249
236 3300047321 Ga0495676_0189380 Ga0495676_0189380_268_1053 249
237 3300047322 Ga0495680_0035417 Ga0495680_0035417_306_1091 249
238 3300048903 Ga0496100_0000016 Ga0496100_0000016_146959_147750 249
239 3300048904 Ga0496101_0000038 Ga0496101_0000038_18309_19100 249
240 3300048905 Ga0496102_0579709 Ga0496102_0579709_144_917 249
241 3300048907 Ga0496104_0000003 Ga0496104_0000003_336295_337086 249
242 3300048907 Ga0496104_0000007 Ga0496104_0000007_317727_318512 249
243 3300048908 Ga0496105_0000002 Ga0496105_0000002_520666_521451 249
244 3300048908 Ga0496105_0000008 Ga0496105_0000008_135781_136572 249
245 3300048909 Ga0496106_0000013 Ga0496106_0000013_46119_46913 249
246 3300048909 Ga0496106_0000027 Ga0496106_0000027_1823_2614 249
247 3300048910 Ga0496107_0000003 Ga0496107_0000003_156289_157080 249
248 3300048910 Ga0496107_0018663 Ga0496107_0018663_3690_4463 249
249 3300048910 Ga0496107_0127743 Ga0496107_0127743_977_1771 249
250 3300048911 Ga0496108_0000002 Ga0496108_0000002_399526_400317 249
251 3300048911 Ga0496108_0000110 Ga0496108_0000110_74562_75347 249
252 3300048911 Ga0496108_0030218 Ga0496108_0030218_1604_2389 249
253 3300048911 Ga0496108_0099527 Ga0496108_0099527_822_1595 249
254 3300048911 Ga0496108_0353484 Ga0496108_0353484_238_1011 249
255 3300048912 Ga0496109_0000001 Ga0496109_0000001_399488_400279 249
256 3300048912 Ga0496109_0000046 Ga0496109_0000046_60315_61100 249
257 3300048912 Ga0496109_0000087 Ga0496109_0000087_74562_75347 249
258 3300048912 Ga0496109_0074328 Ga0496109_0074328_259_1032 249
259 3300048913 Ga0496110_0033469 Ga0496110_0033469_2711_3499 249
260 3300048913 Ga0496110_0053643 Ga0496110_0053643_664_1449 249
261 3300048913 Ga0496110_0154763 Ga0496110_0154763_1206_1991 249
262 3300048914 Ga0496111_0020696 Ga0496111_0020696_3566_4354 249
263 3300048914 Ga0496111_0025151 Ga0496111_0025151_1092_1877 249
264 3300048914 Ga0496111_0035821 Ga0496111_0035821_2338_3111 249
265 3300048914 Ga0496111_0072003 Ga0496111_0072003_1453_2238 249
266 3300048915 Ga0496112_0073858 Ga0496112_0073858_2095_2868 249
267 3300048915 Ga0496112_0216538 Ga0496112_0216538_242_1015 249
268 3300048916 Ga0496113_0011314 Ga0496113_0011314_282_1073 249
269 3300048916 Ga0496113_0014998 Ga0496113_0014998_2325_3110 249
270 3300048916 Ga0496113_0028178 Ga0496113_0028178_820_1593 249
271 3300048917 Ga0496114_0000010 Ga0496114_0000010_16720_17505 249
272 3300048918 Ga0496115_0000710 Ga0496115_0000710_7169_7954 249
273 3300048922 Ga0496119_0114751 Ga0496119_0114751_190_975 249
274 3300049582 Ga0501048_0351579 Ga0501048_0351579_115_885 249
275 3300049587 Ga0501071_0116997 Ga0501071_0116997_844_1605 249
276 3300049590 Ga0501074_0343792 Ga0501074_0343792_264_1034 249
277 3300049743 Ga0501081_0338096 Ga0501081_0338096_281_1066 249
278 3300049743 Ga0501081_0380973 Ga0501081_0380973_238_1008 249
279 3300049822 Ga0501035_0405944 Ga0501035_0405944_312_1073 249
280 3300050507 nmdc:mga05p37_924843_c1 nmdc:mga05p37_924843_c1_76_843 249
281 3300050508 nmdc:mga09592_9222_c1 nmdc:mga09592_9222_c1_1051_1812 249
282 3300050509 nmdc:mga0qj67_207893_c1 nmdc:mga0qj67_207893_c1_704_1489 249
283 3300050509 nmdc:mga0qj67_31166_c1 nmdc:mga0qj67_31166_c1_876_1637 249
284 3300050511 nmdc:mga08y16_268833_c1 nmdc:mga08y16_268833_c1_834_1601 249
285 3300050511 nmdc:mga08y16_484580_c1 nmdc:mga08y16_484580_c1_64_861 249
286 3300053077 Ga0495601_0000214 Ga0495601_0000214_29976_30761 249
287 3300053077 Ga0495601_0017635 Ga0495601_0017635_3233_4018 249
288 3300053078 Ga0495612_0003739 Ga0495612_0003739_2098_2883 249
289 3300053085 Ga0495619_0002211 Ga0495619_0002211_4800_5585 249
290 3300053094 Ga0500566_0003427 Ga0500566_0003427_7091_7876 249
291 3300061719 Ga0466962_0097428 Ga0466962_0097428_206_964 249
292 3300006931 Ga0097620_100750323 Ga0097620_1007503231 250
293 3300025932 Ga0207690_10094235 Ga0207690_100942352 250
294 3300028573 Ga0265334_10094198 Ga0265334_100941982 250
295 3300028800 Ga0265338_10319510 Ga0265338_103195102 250
296 3300046455 Ga0495603_0000291 Ga0495603_0000291_12604_13395 250
297 3300046690 Ga0495624_0201517 Ga0495624_0201517_377_1168 250
298 3300046794 Ga0495589_0104072 Ga0495589_0104072_518_1312 250
299 3300048912 Ga0496109_0075046 Ga0496109_0075046_1439_2230 250
300 3300048913 Ga0496110_0212948 Ga0496110_0212948_649_1437 250
301 3300048914 Ga0496111_0154816 Ga0496111_0154816_795_1583 250
302 3300048916 Ga0496113_0004020 Ga0496113_0004020_5496_6287 250
303 3300050515 nmdc:mga0a205_124_c2 nmdc:mga0a205_124_c2_3790_4587 250
304 3300005329 Ga0070683_100047183 Ga0070683_1000471835 251
305 3300005336 Ga0070680_100021103 Ga0070680_1000211035 251
306 3300005339 Ga0070660_100031735 Ga0070660_1000317352 251
307 3300005344 Ga0070661_100003073 Ga0070661_10000307310 251
308 3300005366 Ga0070659_100030555 Ga0070659_1000305554 251
309 3300005458 Ga0070681_10032484 Ga0070681_100324845 251
310 3300005530 Ga0070679_100114092 Ga0070679_1001140923 251
311 3300005535 Ga0070684_100008356 Ga0070684_1000083562 251
312 3300005539 Ga0068853_100080220 Ga0068853_1000802204 251
313 3300005564 Ga0070664_100104936 Ga0070664_1001049362 251
314 3300005614 Ga0068856_100159115 Ga0068856_1001591152 251
315 3300005616 Ga0068852_100110743 Ga0068852_1001107433 251
316 3300005842 Ga0068858_100000043 Ga0068858_10000004320 251
317 3300009093 Ga0105240_10051664 Ga0105240_100516645 251
318 3300009545 Ga0105237_10210161 Ga0105237_102101612 251
319 3300009551 Ga0105238_10146290 Ga0105238_101462902 251
320 3300010375 Ga0105239_10425498 Ga0105239_104254982 251
321 3300013104 Ga0157370_10062919 Ga0157370_100629194 251
322 3300013105 Ga0157369_10220149 Ga0157369_102201493 251
323 3300013307 Ga0157372_10031712 Ga0157372_100317123 251
324 3300025912 Ga0207707_10014354 Ga0207707_100143542 251
325 3300025913 Ga0207695_10445753 Ga0207695_104457532 251
326 3300025917 Ga0207660_10067054 Ga0207660_100670542 251
327 3300025919 Ga0207657_10026111 Ga0207657_100261113 251
328 3300025920 Ga0207649_10078909 Ga0207649_100789093 251
329 3300025921 Ga0207652_10009003 Ga0207652_100090031 251
330 3300025924 Ga0207694_10270640 Ga0207694_102706402 251
331 3300025932 Ga0207690_10008712 Ga0207690_100087124 251
332 3300025944 Ga0207661_10007315 Ga0207661_100073152 251
333 3300025945 Ga0207679_10081240 Ga0207679_100812403 251
334 3300026035 Ga0207703_10000053 Ga0207703_10000053142 251
335 3300026041 Ga0207639_10346773 Ga0207639_103467731 251
336 3300026078 Ga0207702_10642159 Ga0207702_106421592 251
337 3300026142 Ga0207698_10087463 Ga0207698_100874633 251
338 3300031548 Ga0307408_100070120 Ga0307408_1000701204 251
339 3300031824 Ga0307413_10182704 Ga0307413_101827042 251
340 3300031852 Ga0307410_10171912 Ga0307410_101719122 251
341 3300031995 Ga0307409_100128230 Ga0307409_1001282302 251
342 3300032002 Ga0307416_100103029 Ga0307416_1001030293 251
343 3300032005 Ga0307411_10012199 Ga0307411_100121993 251
344 3300037312 Ga0395899_0338384 Ga0395899_0338384_176_967 251
345 3300037418 Ga0395900_0174114 Ga0395900_0174114_565_1356 251
346 3300037466 Ga0395898_0189615 Ga0395898_0189615_702_1493 251
347 3300037471 Ga0395905_0016275 Ga0395905_0016275_1768_2559 251
348 3300038443 Ga0395901_0587441 Ga0395901_0587441_176_967 251
349 3300046511 Ga0495608_0007029 Ga0495608_0007029_5340_6128 251
350 3300046516 Ga0495628_0024500 Ga0495628_0024500_488_1276 251
351 3300053085 Ga0495619_0000024 Ga0495619_0000024_162803_163591 251
352 3300000549 LJQas_1002401 LJQas_10024011 252

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01790

LGT

Prolipoprotein diacylglyceryl transferase

4

232

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
5azc-assembly1.cif.gz_A crystal structure of escherichia coli lgt in complex with phosphatidylglycerol 0.8285 3 240
5azc-assembly1.cif.gz_A crystal structure of escherichia coli lgt in complex with phosphatidylglycerol 0.7825 3 240
3gnc-assembly1.cif.gz_C crystal structure of glutaryl-coa dehydrogenase from burkholderia pseudomallei with fragment 6421 0.4327 114 244
2r0n-assembly1.cif.gz_A the effect of a glu370asp mutation in glutaryl-coa dehydrogenase on proton transfer to the dienolate intermediate 0.429 113 235
7ocd-assembly1.cif.gz_J resting state glua1/a2 heterotetramer in complex with auxiliary subunit tarp gamma 8 (lbd-tmd) 0.4198 114 243
ID Description Score Start End Superfamily
af_G5EEQ9_4_113_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.5548 110 239 1.20.120.550
af_G5EEQ9_4_113_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.5351 110 239 1.20.120.550
af_Q9VDI6_16_125_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.511 111 227 1.20.120.550
af_Q3KQJ0_93_231_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.4974 100 239 1.10.10.1740
af_Q9VDI6_16_125_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.4927 111 227 1.20.120.550
ID Description Score Start End GO Terms
AF-A0A7C7G6D6-F1-model_v4 deleted 0.9629 1 247
AF-A0A7X4FIV6-F1-model_v4 Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase (EC 2.5.1.145) 0.9614 1 242 GO:0005886
GO:0008961
GO:0042158
AF-A0A7W1HA79-F1-model_v4 Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase (EC 2.5.1.145) 0.9575 1 239 GO:0005886
GO:0008961
GO:0042158
AF-A0A2H6B8X2-F1-model_v4 Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase (EC 2.5.1.145) 0.9559 2 247 GO:0005886
GO:0008961
GO:0042158
AF-A0A1V5IP04-F1-model_v4 Prolipoprotein diacylglyceryl transferase (EC 2.4.99.-) 0.9549 1 239 GO:0005886
GO:0008961
GO:0042158

Feature Viewer

pLDDT pTM Quality
91.09 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map