F418937

General Info

Members Datasets Scaffolds Average Seq Length
352 162 704 188

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100003341|Ga0070698_10000334117
Length 212
Sequence MEHEGKHEGHEVLLMNLASVHNSIMNFEKDIETCLEVLRSGGLILYPTDTIWGIGCDATNEKAVARIYKLKKRDDEKAMIVLVADERDIMQHVAAPDLSLFDHLEETTKPTTVVYDGALGFADNLIAQDGSIAIRICKEEFCRHLIKRFRKPIVSTSANISGMTAPKIFKEITDEIKKGVDYIVKYKQDDETPAQPSSLIKWNNGNITVLRN

Samples

Sample ID Description Type Environment
1 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
123 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
126 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
127 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
128 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
129 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
130 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
131 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
132 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
133 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
134 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
135 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
136 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
137 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
138 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
139 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
140 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
141 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
142 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
149 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
150 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
151 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
152 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
153 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
154 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
155 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
156 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
157 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
158 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
159 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
160 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
161 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
162 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.28
Nodule 0
Rhizoplane 0.85
Rhizosphere 98.01
Stem 0
Stem Tuber 0
Unclassified 7.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070698_100003341 3300005471 Bacteria 17658
2 Ga0065712_10007360 3300005290 Bacteria 4854
3 Ga0065712_10016574 3300005290 Bacteria 1892
4 Ga0065715_10014572 3300005293 Bacteria 2209
5 Ga0065707_10099883 3300005295 Bacteria 2972
6 Ga0065707_10115917 3300005295 Bacteria 2236
7 Ga0070683_100000369 3300005329 Bacteria 31172
8 Ga0070683_100025139 3300005329 Bacteria 5345
9 Ga0070683_100034965 3300005329 Bacteria 4593
10 Ga0070683_100179742 3300005329 Bacteria 2008
11 Ga0070690_100319083 3300005330 Bacteria 1119
12 Ga0070670_100010996 3300005331 Bacteria 7731
13 Ga0068869_100004706 3300005334 Bacteria 8516
14 Ga0068869_100014721 3300005334 Bacteria 5232
15 Ga0068869_100043249 3300005334 Bacteria 3235
16 Ga0068869_100081333 3300005334 Bacteria 2419
17 Ga0068869_100147398 3300005334 Bacteria 1822
18 Ga0068869_100158816 3300005334 Bacteria 1758
19 Ga0068869_100353029 3300005334 Unclassified 1199
20 Ga0070666_10008505 3300005335 Bacteria 6374
21 Ga0070666_10083621 3300005335 Bacteria 2183
22 Ga0070682_100011786 3300005337 Bacteria 5001
23 Ga0070660_100065056 3300005339 Bacteria 2838
24 Ga0070660_100144333 3300005339 Bacteria 1911
25 Ga0070689_100003471 3300005340 Bacteria 10494
26 Ga0070689_100006047 3300005340 Bacteria 8340
27 Ga0070689_100014706 3300005340 Bacteria 5691
28 Ga0070687_100694583 3300005343 Bacteria 710
29 Ga0070661_100002729 3300005344 Bacteria 12103
30 Ga0070661_100003755 3300005344 Bacteria 10470
31 Ga0070661_100190746 3300005344 Bacteria 1563
32 Ga0070668_100118051 3300005347 Bacteria 2117
33 Ga0070669_100003999 3300005353 Bacteria 10653
34 Ga0070669_100074026 3300005353 Bacteria 2524
35 Ga0070669_100208882 3300005353 Bacteria 1539
36 Ga0070669_100245700 3300005353 Bacteria 1423
37 Ga0070669_100634605 3300005353 Bacteria 897
38 Ga0070675_100014040 3300005354 Bacteria 6308
39 Ga0070671_100089410 3300005355 Bacteria 2578
40 Ga0070671_100353926 3300005355 Bacteria 1253
41 Ga0070671_100682194 3300005355 Bacteria 890
42 Ga0070674_100192298 3300005356 Bacteria 1570
43 Ga0070674_100548674 3300005356 Bacteria 969
44 Ga0070673_100026833 3300005364 Bacteria 4260
45 Ga0070673_100058093 3300005364 Bacteria 3058
46 Ga0070673_100087337 3300005364 Bacteria 2542
47 Ga0070673_100264583 3300005364 Unclassified 1503
48 Ga0070688_100006097 3300005365 Bacteria 6406
49 Ga0070688_100010145 3300005365 Bacteria 5182
50 Ga0070688_100012285 3300005365 Bacteria 4793
51 Ga0070688_100228203 3300005365 Bacteria 1316
52 Ga0070659_100000832 3300005366 Bacteria 22486
53 Ga0070667_100057498 3300005367 Bacteria 3288
54 Ga0070667_100151332 3300005367 Bacteria 2038
55 Ga0070701_10213322 3300005438 Bacteria 1147
56 Ga0070705_100731847 3300005440 Bacteria 780
57 Ga0070700_100096722 3300005441 Bacteria 1938
58 Ga0070700_100312722 3300005441 Bacteria 1151
59 Ga0070663_100242695 3300005455 Bacteria 1423
60 Ga0070663_100704847 3300005455 Bacteria 858
61 Ga0070678_100049274 3300005456 Bacteria 3039
62 Ga0070662_100003002 3300005457 Bacteria 10492
63 Ga0070662_100093731 3300005457 Bacteria 2259
64 Ga0070662_100229868 3300005457 Bacteria 1483
65 Ga0068867_100295935 3300005459 Unclassified 1332
66 Ga0070685_10003897 3300005466 Bacteria 7541
67 Ga0070685_10147174 3300005466 Bacteria 1489
68 Ga0070698_100004733 3300005471 Bacteria 14948
69 Ga0070699_100116394 3300005518 Bacteria 2349
70 Ga0070684_100009153 3300005535 Bacteria 7787
71 Ga0070684_100031207 3300005535 Bacteria 4534
72 Ga0068853_100008084 3300005539 Bacteria 8440
73 Ga0068853_100013550 3300005539 Bacteria 6663
74 Ga0068853_100593365 3300005539 Bacteria 1052
75 Ga0068853_100909600 3300005539 Bacteria 845
76 Ga0068853_101154477 3300005539 Bacteria 747
77 Ga0070672_100004453 3300005543 Bacteria 9172
78 Ga0070672_100071457 3300005543 Bacteria 2761
79 Ga0070672_100133893 3300005543 Bacteria 2039
80 Ga0070672_100249857 3300005543 Bacteria 1494
81 Ga0070665_100725577 3300005548 Bacteria 1007
82 Ga0070664_100010950 3300005564 Bacteria 7356
83 Ga0070664_100016755 3300005564 Bacteria 6013
84 Ga0070664_100037952 3300005564 Bacteria 4052
85 Ga0070664_100156983 3300005564 Bacteria 2011
86 Ga0070664_100699415 3300005564 Bacteria 944
87 Ga0070664_100859393 3300005564 Bacteria 850
88 Ga0070664_100897270 3300005564 Unclassified 831
89 Ga0068857_100001073 3300005577 Bacteria 21162
90 Ga0068857_100042792 3300005577 Bacteria 4018
91 Ga0068857_100135666 3300005577 Bacteria 2222
92 Ga0068857_100529621 3300005577 Bacteria 1108
93 Ga0068857_101384805 3300005577 Bacteria 684
94 Ga0068854_100014556 3300005578 Bacteria 5190
95 Ga0068854_100285695 3300005578 Bacteria 1330
96 Ga0068854_100850901 3300005578 Bacteria 798
97 Ga0070702_100473441 3300005615 Bacteria 914
98 Ga0068852_100005383 3300005616 Bacteria 9151
99 Ga0068852_100121746 3300005616 Bacteria 2390
100 Ga0068852_100351320 3300005616 Bacteria 1440
101 Ga0068852_100649597 3300005616 Bacteria 1062
102 Ga0068859_100047267 3300005617 Bacteria 4323
103 Ga0068859_100268922 3300005617 Bacteria 1796
104 Ga0068859_100460715 3300005617 Bacteria 1367
105 Ga0068859_101321535 3300005617 Bacteria 795
106 Ga0068859_101867441 3300005617 Bacteria 663
107 Ga0068864_100017221 3300005618 Bacteria 6026
108 Ga0068864_100025636 3300005618 Bacteria 4967
109 Ga0068861_100003788 3300005719 Bacteria 10101
110 Ga0068861_100067191 3300005719 Bacteria 2766
111 Ga0068861_100128430 3300005719 Bacteria 2054
112 Ga0068861_100421244 3300005719 Bacteria 1190
113 Ga0068870_10027001 3300005840 Bacteria 2868
114 Ga0068870_10058275 3300005840 Bacteria 2068
115 Ga0068863_101025013 3300005841 Unclassified 828
116 Ga0068858_100009282 3300005842 Bacteria 9392
117 Ga0068858_100170845 3300005842 Bacteria 2050
118 Ga0068860_100665327 3300005843 Bacteria 1050
119 Ga0068862_100025761 3300005844 Bacteria 4939
120 Ga0068862_100374120 3300005844 Bacteria 1327
121 Ga0097621_100027912 3300006237 Bacteria 4444
122 Ga0068871_100132855 3300006358 Bacteria 2111
123 Ga0068871_100151895 3300006358 Bacteria 1975
124 Ga0068871_100169087 3300006358 Bacteria 1873
125 Ga0068871_100278987 3300006358 Bacteria 1461
126 Ga0075428_100418617 3300006844 Bacteria 1435
127 Ga0075430_100345297 3300006846 Bacteria 1229
128 Ga0075434_100996272 3300006871 Unclassified 852
129 Ga0075429_100011697 3300006880 Bacteria 7610
130 Ga0075429_100276537 3300006880 Bacteria 1470
131 Ga0075429_100530098 3300006880 Bacteria 1032
132 Ga0068865_100067423 3300006881 Bacteria 2527
133 Ga0068865_100120992 3300006881 Unclassified 1946
134 Ga0097620_100047273 3300006931 Bacteria 4323
135 Ga0097620_100234455 3300006931 Bacteria 1924
136 Ga0097620_100268922 3300006931 Bacteria 1796
137 Ga0097620_100460689 3300006931 Bacteria 1367
138 Ga0097620_101321533 3300006931 Bacteria 795
139 Ga0097620_101867302 3300006931 Bacteria 663
140 Ga0105251_10081311 3300009011 Bacteria 1497
141 Ga0105251_10207409 3300009011 Bacteria 882
142 Ga0105240_10258931 3300009093 Unclassified 2008
143 Ga0111539_10006460 3300009094 Bacteria 15103
144 Ga0111539_10075796 3300009094 Bacteria 3961
145 Ga0105245_10565479 3300009098 Bacteria 1160
146 Ga0105247_10002173 3300009101 Bacteria 13531
147 Ga0114129_10077339 3300009147 Bacteria 4629
148 Ga0105242_10003372 3300009176 Bacteria 12431
149 Ga0105242_10072153 3300009176 Bacteria 2867
150 Ga0105242_10073987 3300009176 Bacteria 2834
151 Ga0105242_10207712 3300009176 Unclassified 1743
152 Ga0105242_10219916 3300009176 Bacteria 1697
153 Ga0105248_10331029 3300009177 Bacteria 1715
154 Ga0105249_10018954 3300009553 Bacteria 6133
155 Ga0105249_10450400 3300009553 Bacteria 1326
156 Ga0105249_10507316 3300009553 Bacteria 1252
157 Ga0105239_10272090 3300010375 Bacteria 1905
158 Ga0157369_11257596 3300013105 Bacteria 755
159 Ga0157374_10001825 3300013296 Bacteria 17957
160 Ga0157374_10029084 3300013296 Bacteria 4999
161 Ga0157374_10032342 3300013296 Bacteria 4762
162 Ga0157374_10384365 3300013296 Bacteria 1398
163 Ga0157378_10173869 3300013297 Bacteria 2022
164 Ga0163162_10236068 3300013306 Bacteria 1959
165 Ga0163162_10254814 3300013306 Bacteria 1887
166 Ga0163162_10531038 3300013306 Bacteria 1306
167 Ga0157372_10139777 3300013307 Bacteria 2789
168 Ga0157372_10521517 3300013307 Unclassified 1385
169 Ga0157372_10856316 3300013307 Bacteria 1055
170 Ga0157375_10011552 3300013308 Bacteria 7800
171 Ga0157375_10015758 3300013308 Bacteria 6772
172 Ga0157375_10055226 3300013308 Bacteria 3915
173 Ga0157375_10087261 3300013308 Bacteria 3172
174 Ga0157375_10163692 3300013308 Bacteria 2368
175 Ga0157375_10846401 3300013308 Bacteria 1061
176 Ga0157375_11293727 3300013308 Bacteria 857
177 Ga0163163_10003350 3300014325 Bacteria 13597
178 Ga0163163_10095506 3300014325 Bacteria 2992
179 Ga0163163_10267043 3300014325 Bacteria 1762
180 Ga0163163_10767477 3300014325 Unclassified 1027
181 Ga0163163_11014055 3300014325 Unclassified 893
182 Ga0157380_10143535 3300014326 Bacteria 2054
183 Ga0157380_10219136 3300014326 Bacteria 1701
184 Ga0157380_10222570 3300014326 Bacteria 1689
185 Ga0157380_11595288 3300014326 Bacteria 708
186 Ga0157377_10018769 3300014745 Bacteria 3601
187 Ga0157377_10042822 3300014745 Bacteria 2516
188 Ga0157377_10065416 3300014745 Bacteria 2089
189 Ga0157377_10085226 3300014745 Unclassified 1855
190 Ga0157377_10158173 3300014745 Bacteria 1407
191 Ga0157379_10138844 3300014968 Bacteria 2191
192 Ga0157379_10495676 3300014968 Bacteria 1132
193 Ga0157379_10509541 3300014968 Bacteria 1116
194 Ga0157376_10072191 3300014969 Bacteria 2936
195 Ga0157376_10094302 3300014969 Bacteria 2600
196 Ga0157376_10123612 3300014969 Bacteria 2297
197 Ga0163161_10016352 3300017792 Bacteria 5178
198 Ga0163161_10245854 3300017792 Bacteria 1393
199 Ga0207656_10127760 3300025321 Bacteria 1188
200 Ga0207682_10037138 3300025893 Bacteria 1973
201 Ga0207642_10018233 3300025899 Bacteria 2689
202 Ga0207710_10026641 3300025900 Bacteria 2499
203 Ga0207688_10013398 3300025901 Bacteria 4454
204 Ga0207680_10022113 3300025903 Bacteria 3453
205 Ga0207647_10000949 3300025904 Bacteria 22419
206 Ga0207645_10002879 3300025907 Bacteria 13311
207 Ga0207643_10008215 3300025908 Bacteria 5602
208 Ga0207643_10147833 3300025908 Bacteria 1407
209 Ga0207643_10199924 3300025908 Bacteria 1216
210 Ga0207695_10707050 3300025913 Bacteria 888
211 Ga0207657_10097427 3300025919 Bacteria 2445
212 Ga0207657_10175598 3300025919 Bacteria 1734
213 Ga0207649_10001318 3300025920 Bacteria 14782
214 Ga0207649_10024308 3300025920 Bacteria 3520
215 Ga0207649_10066041 3300025920 Bacteria 2292
216 Ga0207681_10057122 3300025923 Bacteria 2665
217 Ga0207681_10068681 3300025923 Bacteria 2462
218 Ga0207681_10301026 3300025923 Bacteria 1269
219 Ga0207681_10524046 3300025923 Bacteria 973
220 Ga0207650_10101413 3300025925 Bacteria 2216
221 Ga0207659_10056253 3300025926 Bacteria 2817
222 Ga0207659_10081793 3300025926 Bacteria 2389
223 Ga0207659_10323769 3300025926 Bacteria 1272
224 Ga0207644_10044133 3300025931 Bacteria 3166
225 Ga0207644_10263354 3300025931 Bacteria 1379
226 Ga0207644_10269175 3300025931 Bacteria 1365
227 Ga0207690_10011088 3300025932 Bacteria 5375
228 Ga0207706_10016153 3300025933 Bacteria 6744
229 Ga0207706_10053753 3300025933 Bacteria 3555
230 Ga0207706_10135348 3300025933 Bacteria 2168
231 Ga0207706_10275612 3300025933 Bacteria 1468
232 Ga0207686_10009520 3300025934 Bacteria 5272
233 Ga0207686_10039551 3300025934 Bacteria 2862
234 Ga0207670_10003479 3300025936 Bacteria 8358
235 Ga0207670_10582437 3300025936 Bacteria 917
236 Ga0207669_10568251 3300025937 Bacteria 917
237 Ga0207704_10189739 3300025938 Bacteria 1494
238 Ga0207704_10195066 3300025938 Bacteria 1476
239 Ga0207704_10199017 3300025938 Bacteria 1464
240 Ga0207704_10258948 3300025938 Bacteria 1311
241 Ga0207691_10010295 3300025940 Bacteria 8970
242 Ga0207691_10011173 3300025940 Bacteria 8618
243 Ga0207691_10063674 3300025940 Bacteria 3344
244 Ga0207691_10114384 3300025940 Bacteria 2397
245 Ga0207691_10147897 3300025940 Bacteria 2067
246 Ga0207691_10196499 3300025940 Bacteria 1757
247 Ga0207689_10003798 3300025942 Bacteria 13769
248 Ga0207689_10008226 3300025942 Bacteria 9089
249 Ga0207689_10035036 3300025942 Bacteria 4170
250 Ga0207689_10035662 3300025942 Bacteria 4131
251 Ga0207689_10044713 3300025942 Bacteria 3662
252 Ga0207689_10133650 3300025942 Unclassified 2042
253 Ga0207661_10001165 3300025944 Bacteria 17552
254 Ga0207661_10032179 3300025944 Bacteria 4060
255 Ga0207661_10243701 3300025944 Unclassified 1596
256 Ga0207679_10000182 3300025945 Bacteria 51887
257 Ga0207679_10008460 3300025945 Bacteria 6553
258 Ga0207651_10034369 3300025960 Bacteria 3282
259 Ga0207651_10075716 3300025960 Bacteria 2403
260 Ga0207651_10076523 3300025960 Bacteria 2393
261 Ga0207651_10203624 3300025960 Unclassified 1588
262 Ga0207651_10293802 3300025960 Bacteria 1348
263 Ga0207712_10070166 3300025961 Bacteria 2516
264 Ga0207712_10104261 3300025961 Bacteria 2114
265 Ga0207668_10042818 3300025972 Bacteria 3069
266 Ga0207668_10537196 3300025972 Bacteria 1011
267 Ga0207640_10034437 3300025981 Bacteria 3161
268 Ga0207640_10322170 3300025981 Bacteria 1231
269 Ga0207658_10042427 3300025986 Bacteria 3300
270 Ga0207658_10071642 3300025986 Bacteria 2625
271 Ga0207677_10106297 3300026023 Unclassified 2079
272 Ga0207677_10737059 3300026023 Bacteria 877
273 Ga0207639_10007164 3300026041 Bacteria 7597
274 Ga0207639_10352778 3300026041 Bacteria 1314
275 Ga0207639_10474734 3300026041 Bacteria 1139
276 Ga0207639_10633594 3300026041 Bacteria 988
277 Ga0207639_10780429 3300026041 Bacteria 890
278 Ga0207678_10149889 3300026067 Bacteria 1991
279 Ga0207708_10170872 3300026075 Bacteria 1721
280 Ga0207708_10721347 3300026075 Bacteria 853
281 Ga0207641_10000371 3300026088 Bacteria 53368
282 Ga0207641_10033963 3300026088 Bacteria 4240
283 Ga0207641_10043030 3300026088 Bacteria 3791
284 Ga0207641_10358248 3300026088 Bacteria 1392
285 Ga0207641_10447013 3300026088 Bacteria 1248
286 Ga0207648_10093979 3300026089 Bacteria 2622
287 Ga0207648_10305808 3300026089 Bacteria 1427
288 Ga0207648_10331515 3300026089 Bacteria 1369
289 Ga0207676_10028957 3300026095 Bacteria 4142
290 Ga0207676_10206902 3300026095 Bacteria 1738
291 Ga0207676_10328875 3300026095 Bacteria 1406
292 Ga0207674_10003912 3300026116 Bacteria 18125
293 Ga0207674_10018544 3300026116 Bacteria 7560
294 Ga0207674_10025779 3300026116 Bacteria 6262
295 Ga0207674_10752599 3300026116 Bacteria 941
296 Ga0207675_100003235 3300026118 Bacteria 15979
297 Ga0207675_100007524 3300026118 Bacteria 10291
298 Ga0207675_100014988 3300026118 Bacteria 7235
299 Ga0207675_100083180 3300026118 Bacteria 3001
300 Ga0207683_10050906 3300026121 Bacteria 3628
301 Ga0207698_10037457 3300026142 Bacteria 3572
302 Ga0207698_10088845 3300026142 Unclassified 2521
303 Ga0207698_10417527 3300026142 Bacteria 1286
304 Ga0207428_10076546 3300027907 Bacteria 2620
305 Ga0268265_10020255 3300028380 Bacteria 4641
306 Ga0268265_10127061 3300028380 Bacteria 2112
307 Ga0268265_10175875 3300028380 Bacteria 1834
308 Ga0268265_10263044 3300028380 Bacteria 1535
309 Ga0268265_10421211 3300028380 Bacteria 1240
310 Ga0268264_10077260 3300028381 Bacteria 2835
311 Ga0268264_10790392 3300028381 Bacteria 947
312 Ga0307513_10433086 3300031456 Bacteria 1043
313 Ga0307412_10257191 3300031911 Bacteria 1359
314 Ga0373944_0073653 3300035089 Bacteria 1117
315 Ga0395901_0105211 3300038443 Bacteria 2962
316 Ga0451795_1450807 3300041456 Bacteria 1570
317 Ga0451807_0168704 3300041486 Bacteria 2100
318 Ga0451843_0873127 3300041509 Unclassified 731
319 Ga0451855_0128117 3300041511 Unclassified 799
320 Ga0439431_0062664 3300041997 Unclassified 981
321 Ga0439441_033457 3300042001 Bacteria 1006
322 Ga0439449_0061667 3300042007 Bacteria 1384
323 Ga0439449_0115665 3300042007 Unclassified 995
324 Ga0450923_058273 3300042125 Bacteria 839
325 Ga0450894_001730 3300042131 Bacteria 3071
326 Ga0466959_0112585 3300045049 Bacteria 1941
327 Ga0495670_0381277 3300046691 Bacteria 761
328 Ga0495676_0586571 3300047321 Bacteria 727
329 Ga0496108_0351091 3300048911 Bacteria 1287
330 Ga0501034_0195729 3300049571 Bacteria 1981
331 Ga0501036_0234811 3300049572 Bacteria 1538
332 Ga0501043_0007078 3300049579 Bacteria 8927
333 Ga0501046_0005802 3300049580 Bacteria 11015
334 Ga0501047_0125809 3300049581 Bacteria 2443
335 Ga0501048_0011618 3300049582 Bacteria 6567
336 Ga0501068_0011805 3300049584 Bacteria 4940
337 Ga0501070_0573923 3300049586 Unclassified 901
338 Ga0501072_0127470 3300049588 Bacteria 2028
339 Ga0501073_0085069 3300049589 Bacteria 2200
340 Ga0501074_0001404 3300049590 Bacteria 16033
341 Ga0501079_0059991 3300049741 Bacteria 2934
342 Ga0501080_0149852 3300049742 Unclassified 2156
343 Ga0501083_0004497 3300049744 Bacteria 9847
344 Ga0501035_0034909 3300049822 Bacteria 4568
345 nmdc:mga05p37_79151_c1 3300050507 Bacteria 4047
346 nmdc:mga09592_335048_c1 3300050508 Unclassified 1310
347 nmdc:mga09592_891918_c1 3300050508 Bacteria 748
348 nmdc:mga0qj67_159946_c1 3300050509 Bacteria 1828
349 nmdc:mga0qj67_85216_c1 3300050509 Bacteria 2534
350 nmdc:mga08y16_577590_c1 3300050511 Bacteria 1135
351 Ga0500611_000023 3300053727 Bacteria 102347
352 Ga0501084_0038101 3300054114 Bacteria 4019
353 Ga0070698_100003341
354 Ga0065712_10007360
355 Ga0065712_10016574
356 Ga0065715_10014572
357 Ga0065707_10099883
358 Ga0065707_10115917
359 Ga0070683_100000369
360 Ga0070683_100025139
361 Ga0070683_100034965
362 Ga0070683_100179742
363 Ga0070690_100319083
364 Ga0070670_100010996
365 Ga0068869_100004706
366 Ga0068869_100014721
367 Ga0068869_100043249
368 Ga0068869_100081333
369 Ga0068869_100147398
370 Ga0068869_100158816
371 Ga0068869_100353029
372 Ga0070666_10008505
373 Ga0070666_10083621
374 Ga0070682_100011786
375 Ga0070660_100065056
376 Ga0070660_100144333
377 Ga0070689_100003471
378 Ga0070689_100006047
379 Ga0070689_100014706
380 Ga0070687_100694583
381 Ga0070661_100002729
382 Ga0070661_100003755
383 Ga0070661_100190746
384 Ga0070668_100118051
385 Ga0070669_100003999
386 Ga0070669_100074026
387 Ga0070669_100208882
388 Ga0070669_100245700
389 Ga0070669_100634605
390 Ga0070675_100014040
391 Ga0070671_100089410
392 Ga0070671_100353926
393 Ga0070671_100682194
394 Ga0070674_100192298
395 Ga0070674_100548674
396 Ga0070673_100026833
397 Ga0070673_100058093
398 Ga0070673_100087337
399 Ga0070673_100264583
400 Ga0070688_100006097
401 Ga0070688_100010145
402 Ga0070688_100012285
403 Ga0070688_100228203
404 Ga0070659_100000832
405 Ga0070667_100057498
406 Ga0070667_100151332
407 Ga0070701_10213322
408 Ga0070705_100731847
409 Ga0070700_100096722
410 Ga0070700_100312722
411 Ga0070663_100242695
412 Ga0070663_100704847
413 Ga0070678_100049274
414 Ga0070662_100003002
415 Ga0070662_100093731
416 Ga0070662_100229868
417 Ga0068867_100295935
418 Ga0070685_10003897
419 Ga0070685_10147174
420 Ga0070698_100004733
421 Ga0070699_100116394
422 Ga0070684_100009153
423 Ga0070684_100031207
424 Ga0068853_100008084
425 Ga0068853_100013550
426 Ga0068853_100593365
427 Ga0068853_100909600
428 Ga0068853_101154477
429 Ga0070672_100004453
430 Ga0070672_100071457
431 Ga0070672_100133893
432 Ga0070672_100249857
433 Ga0070665_100725577
434 Ga0070664_100010950
435 Ga0070664_100016755
436 Ga0070664_100037952
437 Ga0070664_100156983
438 Ga0070664_100699415
439 Ga0070664_100859393
440 Ga0070664_100897270
441 Ga0068857_100001073
442 Ga0068857_100042792
443 Ga0068857_100135666
444 Ga0068857_100529621
445 Ga0068857_101384805
446 Ga0068854_100014556
447 Ga0068854_100285695
448 Ga0068854_100850901
449 Ga0070702_100473441
450 Ga0068852_100005383
451 Ga0068852_100121746
452 Ga0068852_100351320
453 Ga0068852_100649597
454 Ga0068859_100047267
455 Ga0068859_100268922
456 Ga0068859_100460715
457 Ga0068859_101321535
458 Ga0068859_101867441
459 Ga0068864_100017221
460 Ga0068864_100025636
461 Ga0068861_100003788
462 Ga0068861_100067191
463 Ga0068861_100128430
464 Ga0068861_100421244
465 Ga0068870_10027001
466 Ga0068870_10058275
467 Ga0068863_101025013
468 Ga0068858_100009282
469 Ga0068858_100170845
470 Ga0068860_100665327
471 Ga0068862_100025761
472 Ga0068862_100374120
473 Ga0097621_100027912
474 Ga0068871_100132855
475 Ga0068871_100151895
476 Ga0068871_100169087
477 Ga0068871_100278987
478 Ga0075428_100418617
479 Ga0075430_100345297
480 Ga0075434_100996272
481 Ga0075429_100011697
482 Ga0075429_100276537
483 Ga0075429_100530098
484 Ga0068865_100067423
485 Ga0068865_100120992
486 Ga0097620_100047273
487 Ga0097620_100234455
488 Ga0097620_100268922
489 Ga0097620_100460689
490 Ga0097620_101321533
491 Ga0097620_101867302
492 Ga0105251_10081311
493 Ga0105251_10207409
494 Ga0105240_10258931
495 Ga0111539_10006460
496 Ga0111539_10075796
497 Ga0105245_10565479
498 Ga0105247_10002173
499 Ga0114129_10077339
500 Ga0105242_10003372
501 Ga0105242_10072153
502 Ga0105242_10073987
503 Ga0105242_10207712
504 Ga0105242_10219916
505 Ga0105248_10331029
506 Ga0105249_10018954
507 Ga0105249_10450400
508 Ga0105249_10507316
509 Ga0105239_10272090
510 Ga0157369_11257596
511 Ga0157374_10001825
512 Ga0157374_10029084
513 Ga0157374_10032342
514 Ga0157374_10384365
515 Ga0157378_10173869
516 Ga0163162_10236068
517 Ga0163162_10254814
518 Ga0163162_10531038
519 Ga0157372_10139777
520 Ga0157372_10521517
521 Ga0157372_10856316
522 Ga0157375_10011552
523 Ga0157375_10015758
524 Ga0157375_10055226
525 Ga0157375_10087261
526 Ga0157375_10163692
527 Ga0157375_10846401
528 Ga0157375_11293727
529 Ga0163163_10003350
530 Ga0163163_10095506
531 Ga0163163_10267043
532 Ga0163163_10767477
533 Ga0163163_11014055
534 Ga0157380_10143535
535 Ga0157380_10219136
536 Ga0157380_10222570
537 Ga0157380_11595288
538 Ga0157377_10018769
539 Ga0157377_10042822
540 Ga0157377_10065416
541 Ga0157377_10085226
542 Ga0157377_10158173
543 Ga0157379_10138844
544 Ga0157379_10495676
545 Ga0157379_10509541
546 Ga0157376_10072191
547 Ga0157376_10094302
548 Ga0157376_10123612
549 Ga0163161_10016352
550 Ga0163161_10245854
551 Ga0207656_10127760
552 Ga0207682_10037138
553 Ga0207642_10018233
554 Ga0207710_10026641
555 Ga0207688_10013398
556 Ga0207680_10022113
557 Ga0207647_10000949
558 Ga0207645_10002879
559 Ga0207643_10008215
560 Ga0207643_10147833
561 Ga0207643_10199924
562 Ga0207695_10707050
563 Ga0207657_10097427
564 Ga0207657_10175598
565 Ga0207649_10001318
566 Ga0207649_10024308
567 Ga0207649_10066041
568 Ga0207681_10057122
569 Ga0207681_10068681
570 Ga0207681_10301026
571 Ga0207681_10524046
572 Ga0207650_10101413
573 Ga0207659_10056253
574 Ga0207659_10081793
575 Ga0207659_10323769
576 Ga0207644_10044133
577 Ga0207644_10263354
578 Ga0207644_10269175
579 Ga0207690_10011088
580 Ga0207706_10016153
581 Ga0207706_10053753
582 Ga0207706_10135348
583 Ga0207706_10275612
584 Ga0207686_10009520
585 Ga0207686_10039551
586 Ga0207670_10003479
587 Ga0207670_10582437
588 Ga0207669_10568251
589 Ga0207704_10189739
590 Ga0207704_10195066
591 Ga0207704_10199017
592 Ga0207704_10258948
593 Ga0207691_10010295
594 Ga0207691_10011173
595 Ga0207691_10063674
596 Ga0207691_10114384
597 Ga0207691_10147897
598 Ga0207691_10196499
599 Ga0207689_10003798
600 Ga0207689_10008226
601 Ga0207689_10035036
602 Ga0207689_10035662
603 Ga0207689_10044713
604 Ga0207689_10133650
605 Ga0207661_10001165
606 Ga0207661_10032179
607 Ga0207661_10243701
608 Ga0207679_10000182
609 Ga0207679_10008460
610 Ga0207651_10034369
611 Ga0207651_10075716
612 Ga0207651_10076523
613 Ga0207651_10203624
614 Ga0207651_10293802
615 Ga0207712_10070166
616 Ga0207712_10104261
617 Ga0207668_10042818
618 Ga0207668_10537196
619 Ga0207640_10034437
620 Ga0207640_10322170
621 Ga0207658_10042427
622 Ga0207658_10071642
623 Ga0207677_10106297
624 Ga0207677_10737059
625 Ga0207639_10007164
626 Ga0207639_10352778
627 Ga0207639_10474734
628 Ga0207639_10633594
629 Ga0207639_10780429
630 Ga0207678_10149889
631 Ga0207708_10170872
632 Ga0207708_10721347
633 Ga0207641_10000371
634 Ga0207641_10033963
635 Ga0207641_10043030
636 Ga0207641_10358248
637 Ga0207641_10447013
638 Ga0207648_10093979
639 Ga0207648_10305808
640 Ga0207648_10331515
641 Ga0207676_10028957
642 Ga0207676_10206902
643 Ga0207676_10328875
644 Ga0207674_10003912
645 Ga0207674_10018544
646 Ga0207674_10025779
647 Ga0207674_10752599
648 Ga0207675_100003235
649 Ga0207675_100007524
650 Ga0207675_100014988
651 Ga0207675_100083180
652 Ga0207683_10050906
653 Ga0207698_10037457
654 Ga0207698_10088845
655 Ga0207698_10417527
656 Ga0207428_10076546
657 Ga0268265_10020255
658 Ga0268265_10127061
659 Ga0268265_10175875
660 Ga0268265_10263044
661 Ga0268265_10421211
662 Ga0268264_10077260
663 Ga0268264_10790392
664 Ga0307513_10433086
665 Ga0307412_10257191
666 Ga0373944_0073653
667 Ga0395901_0105211
668 Ga0451795_1450807
669 Ga0451807_0168704
670 Ga0451843_0873127
671 Ga0451855_0128117
672 Ga0439431_0062664
673 Ga0439441_033457
674 Ga0439449_0061667
675 Ga0439449_0115665
676 Ga0450923_058273
677 Ga0450894_001730
678 Ga0466959_0112585
679 Ga0495670_0381277
680 Ga0495676_0586571
681 Ga0496108_0351091
682 Ga0501034_0195729
683 Ga0501036_0234811
684 Ga0501043_0007078
685 Ga0501046_0005802
686 Ga0501047_0125809
687 Ga0501048_0011618
688 Ga0501068_0011805
689 Ga0501070_0573923
690 Ga0501072_0127470
691 Ga0501073_0085069
692 Ga0501074_0001404
693 Ga0501079_0059991
694 Ga0501080_0149852
695 Ga0501083_0004497
696 Ga0501035_0034909
697 nmdc:mga05p37_79151_c1
698 nmdc:mga09592_335048_c1
699 nmdc:mga09592_891918_c1
700 nmdc:mga0qj67_159946_c1
701 nmdc:mga0qj67_85216_c1
702 nmdc:mga08y16_577590_c1
703 Ga0500611_000023
704 Ga0501084_0038101

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01300

Sua5_yciO_yrdC

Telomere recombination

36

212

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6f87-assembly3.cif.gz_C crystal structure of p. abyssi sua5 complexed with l-threonine and ppi 0.8815 4 188
6f89-assembly2.cif.gz_B structure of h234a/y235a p.abyssi sua5 0.8773 4 188
6f89-assembly1.cif.gz_A structure of h234a/y235a p.abyssi sua5 0.8692 4 188
3vth-assembly2.cif.gz_B crystal structure of full-length hypf in the phosphate- and nucleotide-bound form 0.8675 7 187
3aje-assembly1.cif.gz_A crystal structure of s. tokodaii sua5 complexed with l-threonine and amppnp 0.8608 5 188
ID Description Score Start End Superfamily
af_Q2FWE2_20_236_3.90.870.10 Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase 0.8781 7 188 3.90.870.10
af_Q60369_7_206_3.90.870.10 Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase 0.8773 4 188 3.90.870.10
4e1bA01 Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase 0.8681 5 188 3.90.870.10
af_F1R994_49_249_3.90.870.10 Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase 0.8677 7 188 3.90.870.10
af_Q54XJ3_8_241_3.90.870.10 Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase 0.8652 5 188 3.90.870.10
ID Description Score Start End GO Terms
AF-A0A1I5XL32-F1-model_v4 L-threonylcarbamoyladenylate synthase (EC 2.7.7.87) (L-threonylcarbamoyladenylate synthase) 0.9956 3 188 GO:0000049
GO:0003725
GO:0005737
GO:0006450
GO:0008033
GO:0016779
AF-A0A4Q6CJB3-F1-model_v4 deleted 0.9941 1 188
AF-A0A2W5F6U1-F1-model_v4 L-threonylcarbamoyladenylate synthase (EC 2.7.7.87) (L-threonylcarbamoyladenylate synthase) 0.99 3 188 GO:0000049
GO:0003725
GO:0005737
GO:0006450
GO:0008033
GO:0016779
AF-A0A4Q6CJB3-F1-model_v4 deleted 0.9888 1 188
AF-A0A1M3R268-F1-model_v4 L-threonylcarbamoyladenylate synthase (EC 2.7.7.87) (L-threonylcarbamoyladenylate synthase) 0.9887 1 187 GO:0000049
GO:0003725
GO:0005737
GO:0006450
GO:0008033
GO:0016779

Map