F418795

General Info

Members Datasets Scaffolds Average Seq Length
351 248 327 407

Family's Representative Sequence

Representative Sequence 3300049569|Ga0501032_0003287|Ga0501032_0003287_5675_7075
Length 466
Sequence MMPFRVVICGFQPFESPGVRLPASTPTTIDGEQIMPKPPPASLSDRTIALSFCAGGFRGWLGVVTDSTTCAIVGGGPAGMMLGLILARCGVDVTVLEKHADFLRDFRGDTVHPSTMRLLDELGLLQKFDEIPYSKVEKGDFTVDGQAITMVDFRRLRQPHPYVAMVPQWDFLDLLADAGKSEPHFTLRMQTEVTGLLRDGDRITGVRYESPDGPGELRADLTVGCDGRWSVTRRESGLSVREYPVPFDVWWLRVPRTNDGDYSLIPRTAPGKALIMIPRRGYFQIAYLIPKGSDTGLRSRGLDRFKSELAELIPESDVDSLNSWDDVKFLDVRLNRLHTWHRDGLLCIGDAAHAMSPAGGVGVNVAIQDAVAASRLLHAPLREHRLTETNLAAVQRQRTVPTVVTQGFQRIVHRQVLAPAMAGKEIIPPPALRNLLHRLPRLATVPGYIIGTGVRPEHVPTIARRR

Samples

Sample ID Description Type Environment
1 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
2 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
3 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
4 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
5 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
6 2867475112 Streptomyces sp. TM32 Isolate Unclassified
7 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
8 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
9 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
10 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
11 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
12 2920879853 Kocuria salina CV6 Isolate Unclassified
13 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
14 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
15 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
16 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
17 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
18 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
19 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
20 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
21 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
22 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
23 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
93 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
94 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
95 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
97 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
98 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
99 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
142 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
143 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
144 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
145 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
146 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
147 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
148 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
149 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
150 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
151 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
152 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
153 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
154 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
155 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
156 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
157 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
158 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
159 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
160 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
161 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
162 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
163 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
164 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
165 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
166 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
167 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
168 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
169 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
170 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
171 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
172 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
173 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
174 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
175 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
176 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
177 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
178 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
179 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
180 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
181 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
182 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
183 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
184 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
185 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
186 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
187 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
188 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
189 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
190 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
191 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
192 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
193 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
194 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
195 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
196 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
197 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
198 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
199 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
200 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
201 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
202 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
203 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
204 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
205 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
206 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
207 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
208 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
209 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
210 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
211 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
212 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
213 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
214 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
215 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
216 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
217 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
218 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
228 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
229 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
230 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
231 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
232 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
234 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
235 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
236 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
237 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
238 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
239 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
240 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
241 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
242 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
243 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
244 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
245 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
246 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
247 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified
248 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.16
Metatranscriptomes 0
Isolates 6.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.41
Nodule 0
Rhizoplane 10.26
Rhizosphere 72.65
Stem 0
Stem Tuber 0
Unclassified 11.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1000922 3300000549 Bacteria 4575
2 JGI25152J39213_1001193 3300002773 Bacteria 11954
3 JGI25160J50197_1006844 3300003354 Bacteria 4558
4 Ga0065714_10084548 3300005288 Bacteria 2192
5 Ga0070683_100007206 3300005329 Bacteria 9382
6 Ga0068869_100077600 3300005334 Bacteria 2472
7 Ga0070666_10001964 3300005335 Bacteria 12522
8 Ga0070666_10058193 3300005335 Bacteria 2613
9 Ga0070666_10097735 3300005335 Bacteria 2021
10 Ga0070682_100019825 3300005337 Bacteria 3949
11 Ga0068868_100021443 3300005338 Bacteria 4864
12 Ga0068868_100078789 3300005338 Bacteria 2638
13 Ga0070689_100057050 3300005340 Bacteria 3030
14 Ga0070668_100007768 3300005347 Bacteria 7963
15 Ga0070668_100026917 3300005347 Bacteria 4365
16 Ga0070668_100087866 3300005347 Bacteria 2446
17 Ga0070668_100092456 3300005347 Bacteria 2386
18 Ga0070659_100037689 3300005366 Bacteria 3770
19 Ga0070659_100168022 3300005366 Bacteria 1795
20 Ga0070659_100234879 3300005366 Bacteria 1516
21 Ga0070667_100004728 3300005367 Bacteria 11414
22 Ga0070667_100064299 3300005367 Bacteria 3113
23 Ga0070709_10015462 3300005434 Bacteria 4343
24 Ga0070714_100002102 3300005435 Bacteria 14607
25 Ga0070714_100007490 3300005435 Bacteria 8495
26 Ga0070714_100038593 3300005435 Bacteria 4016
27 Ga0070710_10088015 3300005437 Bacteria 1826
28 Ga0070710_10133392 3300005437 Bacteria 1516
29 Ga0070711_100006031 3300005439 Bacteria 7276
30 Ga0070711_100037446 3300005439 Bacteria 3255
31 Ga0070700_100007486 3300005441 Bacteria 5901
32 Ga0070700_100156636 3300005441 Bacteria 1564
33 Ga0070678_100118736 3300005456 Bacteria 2082
34 Ga0070678_100168278 3300005456 Bacteria 1782
35 Ga0068867_100001731 3300005459 Bacteria 15202
36 Ga0070685_10022773 3300005466 Bacteria 3420
37 Ga0070685_10041499 3300005466 Bacteria 2622
38 Ga0070706_100001197 3300005467 Bacteria 27787
39 Ga0068853_100039145 3300005539 Bacteria 4043
40 Ga0068853_100173744 3300005539 Bacteria 1950
41 Ga0070672_100213407 3300005543 Bacteria 1617
42 Ga0070695_100021598 3300005545 Bacteria 3942
43 Ga0070695_100146374 3300005545 Bacteria 1644
44 Ga0070693_100055870 3300005547 Bacteria 2276
45 Ga0070665_100000137 3300005548 Bacteria 137413
46 Ga0070665_100022107 3300005548 Bacteria 6398
47 Ga0070665_100083366 3300005548 Bacteria 3202
48 Ga0070704_100000886 3300005549 Bacteria 14990
49 Ga0068855_100002492 3300005563 Bacteria 22681
50 Ga0068854_100048220 3300005578 Bacteria 3038
51 Ga0068856_100005684 3300005614 Bacteria 12283
52 Ga0068866_10000844 3300005718 Bacteria 13608
53 Ga0068861_100028159 3300005719 Bacteria 4099
54 Ga0068863_100006453 3300005841 Bacteria 11503
55 Ga0068858_100105616 3300005842 Bacteria 2628
56 Ga0068860_100009685 3300005843 Bacteria 9570
57 Ga0068862_100021725 3300005844 Bacteria 5368
58 Ga0081455_10004855 3300005937 Bacteria 14918
59 Ga0081455_10029502 3300005937 Bacteria 5001
60 Ga0081455_10034160 3300005937 Bacteria 4559
61 Ga0081455_10067238 3300005937 Bacteria 2987
62 Ga0070717_10018143 3300006028 Bacteria 5491
63 Ga0075365_10017771 3300006038 Bacteria 4360
64 Ga0075363_100006824 3300006048 Bacteria 5218
65 Ga0075364_10014930 3300006051 Bacteria 4808
66 Ga0075432_10033292 3300006058 Bacteria 1787
67 Ga0070716_100024412 3300006173 Bacteria 3217
68 Ga0070712_100008363 3300006175 Bacteria 6506
69 Ga0070712_100104784 3300006175 Bacteria 2099
70 Ga0097621_100093475 3300006237 Bacteria 2520
71 Ga0075431_100020408 3300006847 Bacteria 6770
72 Ga0075434_100072294 3300006871 Bacteria 3441
73 Ga0075429_100285720 3300006880 Bacteria 1445
74 Ga0068865_100015011 3300006881 Bacteria 4933
75 Ga0068865_100025367 3300006881 Bacteria 3899
76 Ga0068865_100084416 3300006881 Bacteria 2288
77 Ga0105251_10041520 3300009011 Bacteria 2238
78 Ga0105240_10054459 3300009093 Bacteria 5013
79 Ga0105240_10085272 3300009093 Bacteria 3870
80 Ga0111539_10024117 3300009094 Bacteria 7471
81 Ga0111539_10152556 3300009094 Bacteria 2704
82 Ga0111539_10229017 3300009094 Bacteria 2164
83 Ga0105245_10001126 3300009098 Bacteria 24176
84 Ga0105247_10000094 3300009101 Bacteria 96396
85 Ga0105247_10013750 3300009101 Bacteria 4853
86 Ga0105243_10003000 3300009148 Bacteria 13943
87 Ga0105242_10199604 3300009176 Bacteria 1776
88 Ga0105248_10023984 3300009177 Bacteria 6782
89 Ga0105248_10032542 3300009177 Bacteria 5828
90 Ga0105237_10217108 3300009545 Bacteria 1912
91 Ga0105238_10051348 3300009551 Bacteria 4147
92 Ga0105238_10106509 3300009551 Bacteria 2785
93 Ga0105249_10009623 3300009553 Bacteria 8468
94 Ga0105246_10024904 3300011119 Bacteria 3895
95 Ga0157371_10094569 3300013102 Bacteria 2118
96 Ga0157369_10062806 3300013105 Bacteria 4002
97 Ga0157378_10003396 3300013297 Bacteria 14157
98 Ga0163162_10210211 3300013306 Bacteria 2075
99 Ga0157372_10100364 3300013307 Bacteria 3303
100 Ga0157372_10189058 3300013307 Bacteria 2385
101 Ga0157375_10048444 3300013308 Bacteria 4157
102 Ga0157380_10078540 3300014326 Bacteria 2693
103 Ga0182008_10041605 3300014497 Bacteria 2292
104 Ga0157379_10001866 3300014968 Bacteria 17433
105 Ga0157379_10021091 3300014968 Bacteria 5766
106 Ga0157379_10176588 3300014968 Bacteria 1929
107 Ga0157376_10085082 3300014969 Bacteria 2724
108 Ga0157376_10134485 3300014969 Bacteria 2211
109 Ga0213872_10000239 3300021361 Bacteria 48382
110 Ga0213876_10000795 3300021384 Bacteria 21427
111 Ga0213876_10021200 3300021384 Bacteria 3436
112 Ga0213876_10022522 3300021384 Bacteria 3330
113 Ga0213875_10020060 3300021388 Unclassified 3208
114 Ga0209148_1004078 3300025254 Bacteria 3703
115 Ga0209129_1000052 3300025258 Bacteria 265251
116 Ga0209025_1001043 3300025294 Bacteria 40722
117 Ga0207426_1000625 3300025302 Bacteria 44906
118 Ga0207426_1002131 3300025302 Bacteria 13542
119 Ga0209051_1013890 3300025303 Bacteria 3797
120 Ga0207697_10008811 3300025315 Bacteria 4390
121 Ga0207682_10003807 3300025893 Bacteria 6473
122 Ga0207692_10004545 3300025898 Bacteria 5504
123 Ga0207692_10044147 3300025898 Bacteria 2222
124 Ga0207710_10000119 3300025900 Bacteria 97053
125 Ga0207710_10078808 3300025900 Bacteria 1525
126 Ga0207688_10004649 3300025901 Bacteria 7481
127 Ga0207688_10034936 3300025901 Bacteria 2784
128 Ga0207680_10000837 3300025903 Bacteria 14529
129 Ga0207680_10063516 3300025903 Bacteria 2260
130 Ga0207685_10023165 3300025905 Bacteria 2110
131 Ga0207699_10169682 3300025906 Bacteria 1459
132 Ga0207645_10023752 3300025907 Bacteria 3981
133 Ga0207645_10034831 3300025907 Bacteria 3234
134 Ga0207684_10005097 3300025910 Bacteria 12246
135 Ga0207695_10002853 3300025913 Bacteria 25128
136 Ga0207695_10025397 3300025913 Bacteria 6632
137 Ga0207671_10238015 3300025914 Bacteria 1429
138 Ga0207693_10002096 3300025915 Bacteria 17406
139 Ga0207693_10060160 3300025915 Bacteria 2975
140 Ga0207663_10089734 3300025916 Bacteria 2036
141 Ga0207662_10036962 3300025918 Bacteria 2856
142 Ga0207681_10162869 3300025923 Bacteria 1683
143 Ga0207687_10005249 3300025927 Bacteria 8591
144 Ga0207700_10247575 3300025928 Bacteria 1521
145 Ga0207664_10036345 3300025929 Bacteria 3807
146 Ga0207664_10061927 3300025929 Bacteria 2987
147 Ga0207706_10012282 3300025933 Bacteria 7804
148 Ga0207704_10014204 3300025938 Bacteria 4014
149 Ga0207691_10058223 3300025940 Bacteria 3514
150 Ga0207711_10010465 3300025941 Bacteria 7702
151 Ga0207689_10052266 3300025942 Bacteria 3367
152 Ga0207661_10097076 3300025944 Bacteria 2467
153 Ga0207667_10001408 3300025949 Bacteria 30168
154 Ga0207712_10087253 3300025961 Bacteria 2288
155 Ga0207668_10092945 3300025972 Bacteria 2221
156 Ga0207668_10175397 3300025972 Bacteria 1685
157 Ga0207658_10021152 3300025986 Bacteria 4512
158 Ga0207677_10087485 3300026023 Bacteria 2256
159 Ga0207703_10213415 3300026035 Bacteria 1722
160 Ga0207639_10015169 3300026041 Bacteria 5429
161 Ga0207708_10004969 3300026075 Bacteria 9794
162 Ga0207708_10086698 3300026075 Bacteria 2409
163 Ga0207702_10045441 3300026078 Bacteria 3694
164 Ga0207641_10081715 3300026088 Bacteria 2806
165 Ga0207641_10338703 3300026088 Bacteria 1431
166 Ga0207648_10006698 3300026089 Bacteria 11426
167 Ga0207648_10064552 3300026089 Bacteria 3191
168 Ga0207676_10038354 3300026095 Bacteria 3656
169 Ga0207683_10092436 3300026121 Bacteria 2696
170 Ga0207683_10141440 3300026121 Bacteria 2168
171 Ga0268266_10086881 3300028379 Bacteria 2735
172 Ga0268265_10036882 3300028380 Bacteria 3584
173 Ga0268264_10104095 3300028381 Bacteria 2473
174 Ga0265337_1002501 3300028556 Bacteria 8380
175 Ga0265319_1013504 3300028563 Bacteria 3243
176 Ga0316181_1100278 3300030744 Bacteria 1729
177 Ga0265320_10001483 3300031240 Bacteria 17128
178 Ga0265331_10004294 3300031250 Bacteria 8926
179 Ga0265327_10000069 3300031251 Bacteria 217784
180 Ga0307513_10021495 3300031456 Bacteria 7616
181 Ga0307408_100021066 3300031548 Bacteria 4407
182 Ga0307408_100220453 3300031548 Bacteria 1547
183 Ga0265313_10000469 3300031595 Bacteria 42166
184 Ga0307405_10032897 3300031731 Bacteria 3070
185 Ga0307413_10156943 3300031824 Bacteria 1593
186 Ga0307518_10057853 3300031838 Bacteria 2816
187 Ga0307410_10134912 3300031852 Bacteria 1818
188 Ga0307507_10019620 3300033179 Bacteria 7608
189 Ga0307510_10017084 3300033180 Bacteria 8560
190 Ga0316584_0045222 3300036712 Bacteria 3286
191 Ga0395898_0197177 3300037466 Bacteria 1923
192 Ga0436364_0019204 3300037853 Bacteria 6670
193 Ga0436364_0897743 3300037853 Unclassified 3474
194 Ga0436364_1003317 3300037853 Unclassified 2966
195 Ga0395901_0199069 3300038443 Bacteria 2100
196 Ga0436365_0123721 3300039437 Bacteria 18265
197 Ga0436365_0928916 3300039437 Bacteria 34395
198 Ga0436365_1051189 3300039437 Unclassified 2169
199 Ga0436365_1296534 3300039437 Bacteria 12430
200 Ga0436361_0863641 3300039447 Bacteria 83672
201 Ga0436363_0097909 3300039450 Bacteria 7261
202 Ga0436363_0114223 3300039450 Bacteria 3096
203 Ga0466966_0134347 3300044684 Bacteria 1513
204 Ga0466961_0001979 3300044693 Bacteria 12749
205 Ga0466957_0006258 3300044842 Bacteria 6717
206 Ga0466959_0001681 3300045049 Bacteria 13712
207 Ga0466958_0002563 3300045836 Bacteria 9173
208 Ga0466967_0012846 3300045976 Bacteria 6436
209 Ga0466967_0036273 3300045976 Bacteria 4207
210 Ga0466967_0087793 3300045976 Bacteria 2820
211 Ga0466967_0127613 3300045976 Bacteria 2358
212 Ga0495629_0125983 3300046459 Bacteria 1784
213 Ga0495653_0001613 3300046463 Bacteria 17714
214 Ga0495580_0041011 3300046472 Bacteria 3303
215 Ga0495582_0079323 3300046473 Bacteria 1822
216 Ga0495662_0002270 3300046476 Bacteria 9692
217 Ga0495664_0004073 3300046477 Bacteria 7972
218 Ga0495642_0033948 3300046528 Bacteria 2053
219 Ga0495654_0102478 3300046530 Bacteria 1316
220 Ga0495665_0000402 3300046531 Bacteria 21980
221 Ga0495665_0034074 3300046531 Bacteria 2723
222 Ga0495586_0001126 3300046535 Bacteria 15044
223 Ga0495586_0003775 3300046535 Bacteria 8117
224 Ga0495587_0003592 3300046536 Bacteria 10325
225 Ga0495645_0000495 3300046543 Bacteria 27241
226 Ga0495667_0000098 3300046559 Bacteria 62781
227 Ga0495635_0166415 3300046663 Bacteria 1500
228 Ga0495659_0007297 3300046664 Bacteria 3504
229 Ga0495588_0003836 3300046674 Bacteria 6588
230 Ga0495588_0017268 3300046674 Bacteria 3500
231 Ga0495670_0004291 3300046691 Bacteria 6984
232 Ga0495671_0055974 3300046692 Bacteria 1953
233 Ga0495581_0099217 3300047315 Bacteria 1692
234 Ga0495581_0107888 3300047315 Bacteria 1618
235 Ga0495604_0062271 3300047317 Bacteria 2851
236 Ga0495636_0003754 3300047318 Bacteria 5910
237 Ga0495672_0016470 3300047320 Bacteria 4979
238 Ga0495680_0015578 3300047322 Bacteria 6557
239 Ga0495675_0008849 3300047444 Bacteria 6250
240 Ga0495681_0038174 3300047470 Bacteria 2357
241 Ga0496100_0000836 3300048903 Bacteria 14772
242 Ga0496100_0002912 3300048903 Bacteria 8786
243 Ga0496101_0000056 3300048904 Bacteria 135446
244 Ga0496101_0001135 3300048904 Bacteria 15897
245 Ga0496101_0195314 3300048904 Bacteria 1563
246 Ga0496102_0000177 3300048905 Bacteria 86724
247 Ga0496102_0008169 3300048905 Bacteria 8957
248 Ga0496102_0009865 3300048905 Bacteria 8209
249 Ga0496102_0011501 3300048905 Bacteria 7632
250 Ga0496103_0000003 3300048906 Bacteria 603967
251 Ga0496103_0006151 3300048906 Bacteria 7174
252 Ga0496103_0006434 3300048906 Bacteria 7013
253 Ga0496103_0052351 3300048906 Bacteria 2529
254 Ga0496104_0005253 3300048907 Bacteria 11319
255 Ga0496105_0045825 3300048908 Bacteria 3608
256 Ga0496105_0107657 3300048908 Bacteria 2301
257 Ga0496106_0005204 3300048909 Bacteria 9633
258 Ga0496106_0025658 3300048909 Bacteria 4387
259 Ga0496106_0027381 3300048909 Bacteria 4245
260 Ga0496107_0006291 3300048910 Bacteria 8160
261 Ga0496107_0035308 3300048910 Bacteria 3584
262 Ga0496107_0057452 3300048910 Bacteria 2812
263 Ga0496108_0093557 3300048911 Bacteria 2557
264 Ga0496108_0200105 3300048911 Bacteria 1733
265 Ga0496109_0000029 3300048912 Bacteria 164675
266 Ga0496109_0001405 3300048912 Bacteria 19963
267 Ga0496109_0150052 3300048912 Bacteria 2182
268 Ga0496110_0094704 3300048913 Bacteria 2674
269 Ga0496111_0103237 3300048914 Bacteria 2096
270 Ga0496111_0138573 3300048914 Bacteria 1803
271 Ga0496112_0056982 3300048915 Bacteria 3847
272 Ga0496112_0061222 3300048915 Bacteria 3710
273 Ga0496112_0097118 3300048915 Bacteria 2917
274 Ga0496113_0150474 3300048916 Bacteria 1836
275 Ga0496114_0026019 3300048917 Bacteria 4787
276 Ga0496115_0210662 3300048918 Bacteria 1605
277 Ga0496116_0000013 3300048919 Bacteria 603993
278 Ga0496117_0000013 3300048920 Bacteria 603995
279 Ga0496118_0000011 3300048921 Bacteria 603995
280 Ga0496118_0104010 3300048921 Bacteria 1908
281 Ga0496119_0000946 3300048922 Bacteria 37374
282 Ga0496119_0007186 3300048922 Bacteria 10087
283 Ga0496120_0000224 3300048923 Bacteria 97511
284 Ga0496121_0000060 3300048924 Bacteria 276682
285 Ga0496125_0113398 3300048928 Bacteria 1956
286 Ga0496126_0001987 3300048929 Bacteria 28983
287 Ga0496126_0005424 3300048929 Bacteria 14548
288 Ga0501032_0002021 3300049569 Bacteria 15995
289 Ga0501032_0003287 3300049569 Bacteria 12437
290 Ga0501034_0000960 3300049571 Bacteria 41575
291 Ga0501034_0006815 3300049571 Bacteria 12219
292 Ga0501034_0041644 3300049571 Bacteria 4647
293 Ga0501036_0002271 3300049572 Bacteria 15022
294 Ga0501036_0050944 3300049572 Bacteria 3506
295 Ga0501037_0002160 3300049573 Bacteria 14235
296 Ga0501039_0000903 3300049575 Bacteria 21630
297 Ga0501043_0001683 3300049579 Bacteria 19186
298 Ga0501046_0007491 3300049580 Bacteria 9581
299 Ga0501047_0005226 3300049581 Bacteria 12188
300 Ga0501047_0115878 3300049581 Bacteria 2561
301 Ga0501047_0117395 3300049581 Bacteria 2542
302 Ga0501048_0001799 3300049582 Bacteria 16297
303 Ga0501067_0013088 3300049583 Bacteria 4592
304 Ga0501068_0090188 3300049584 Bacteria 1891
305 Ga0501069_0111777 3300049585 Bacteria 1556
306 Ga0501070_0007399 3300049586 Bacteria 9329
307 Ga0501070_0052794 3300049586 Bacteria 3374
308 Ga0501080_0064551 3300049742 Bacteria 3405
309 Ga0501035_0051345 3300049822 Bacteria 3692
310 Ga0501035_0283825 3300049822 Bacteria 1399
311 Ga0501044_0005851 3300049823 Bacteria 13619
312 Ga0501044_0006114 3300049823 Bacteria 13282
313 nmdc:mga00v17_17813_c1 3300050491 Bacteria 4029
314 nmdc:mga0yw44_10272_c1 3300050492 Bacteria 4774
315 nmdc:mga06r32_12530_c1 3300050510 Bacteria 7654
316 nmdc:mga06r32_72434_c1 3300050510 Bacteria 3336
317 nmdc:mga08y16_153790_c1 3300050511 Bacteria 2391
318 nmdc:mga08y16_192281_c1 3300050511 Bacteria 2116
319 nmdc:mga08x19_33097_c1 3300050514 Bacteria 3261
320 nmdc:mga0sz30_23899_c1 3300050516 Bacteria 2491
321 nmdc:mga0sz30_7251_c1 3300050516 Bacteria 4154
322 Ga0495619_0072451 3300053085 Bacteria 2307
323 Ga0500652_030572 3300053131 Bacteria 2107
324 Ga0500559_0023216 3300053136 Bacteria 2633
325 Ga0500645_000055 3300053730 Bacteria 92181
326 Ga0500645_036617 3300053730 Bacteria 1460
327 Ga0501084_0018544 3300054114 Bacteria 5792

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025903 Ga0207680_10000837 Ga0207680_100008371 341
2 3300049569 Ga0501032_0002021 Ga0501032_0002021_17_1126 368
3 3300053085 Ga0495619_0072451 Ga0495619_0072451_469_1611 368
4 3300033179 Ga0307507_10019620 Ga0307507_100196207 375
5 3300005937 Ga0081455_10004855 Ga0081455_1000485514 376
6 3300006881 Ga0068865_100015011 Ga0068865_1000150112 379
7 3300005335 Ga0070666_10001964 Ga0070666_1000196410 380
8 3300005366 Ga0070659_100037689 Ga0070659_1000376892 380
9 3300005614 Ga0068856_100005684 Ga0068856_10000568410 380
10 3300013102 Ga0157371_10094569 Ga0157371_100945692 380
11 3300013105 Ga0157369_10062806 Ga0157369_100628062 380
12 3300025938 Ga0207704_10014204 Ga0207704_100142042 380
13 3300026078 Ga0207702_10045441 Ga0207702_100454413 380
14 3300037466 Ga0395898_0197177 Ga0395898_0197177_554_1717 380
15 3300053131 Ga0500652_030572 Ga0500652_030572_616_1824 380
16 3300009101 Ga0105247_10000094 Ga0105247_1000009419 381
17 3300009177 Ga0105248_10032542 Ga0105248_100325423 381
18 3300014968 Ga0157379_10001866 Ga0157379_100018663 381
19 3300021384 Ga0213876_10021200 Ga0213876_100212002 381
20 3300048922 Ga0496119_0000946 Ga0496119_0000946_12102_13328 381
21 3300048923 Ga0496120_0000224 Ga0496120_0000224_19665_20891 381
22 3300011119 Ga0105246_10024904 Ga0105246_100249043 382
23 3300014968 Ga0157379_10176588 Ga0157379_101765882 382
24 3300014969 Ga0157376_10134485 Ga0157376_101344852 382
25 3300031595 Ga0265313_10000469 Ga0265313_1000046923 382
26 3300048912 Ga0496109_0001405 Ga0496109_0001405_9409_10560 382
27 3300048915 Ga0496112_0056982 Ga0496112_0056982_1385_2536 382
28 3300050510 nmdc:mga06r32_72434_c1 nmdc:mga06r32_72434_c1_1530_2687 382
29 3300005937 Ga0081455_10029502 Ga0081455_100295023 383
30 3300009094 Ga0111539_10024117 Ga0111539_100241174 383
31 3300037853 Ga0436364_1003317 Ga0436364_1003317_1416_2669 383
32 3300039437 Ga0436365_1051189 Ga0436365_1051189_528_1781 383
33 3300050510 nmdc:mga06r32_12530_c1 nmdc:mga06r32_12530_c1_2122_3282 383
34 3300050511 nmdc:mga08y16_153790_c1 nmdc:mga08y16_153790_c1_407_1567 383
35 3300005340 Ga0070689_100057050 Ga0070689_1000570503 384
36 3300009093 Ga0105240_10085272 Ga0105240_100852723 384
37 3300009551 Ga0105238_10051348 Ga0105238_100513483 384
38 3300013308 Ga0157375_10048444 Ga0157375_100484441 384
39 3300025303 Ga0209051_1013890 Ga0209051_10138902 384
40 3300005466 Ga0070685_10022773 Ga0070685_100227732 386
41 3300044684 Ga0466966_0134347 Ga0466966_0134347_62_1288 387
42 3300044693 Ga0466961_0001979 Ga0466961_0001979_10555_11781 387
43 3300044842 Ga0466957_0006258 Ga0466957_0006258_4151_5377 387
44 3300045049 Ga0466959_0001681 Ga0466959_0001681_10396_11622 387
45 3300045836 Ga0466958_0002563 Ga0466958_0002563_1163_2389 387
46 3300046528 Ga0495642_0033948 Ga0495642_0033948_510_1706 387
47 3300046664 Ga0495659_0007297 Ga0495659_0007297_1267_2463 387
48 3300046691 Ga0495670_0004291 Ga0495670_0004291_3040_4236 387
49 3300047470 Ga0495681_0038174 Ga0495681_0038174_558_1754 387
50 iso_pu_bacteria 2946033335 2946035424 387
51 iso_pu_bacteria 2946080515 2946082723 387
52 3300039450 Ga0436363_0114223 Ga0436363_0114223_1125_2465 388
53 iso_pu_bacteria 2852646457 2852649430 388
54 3300005435 Ga0070714_100002102 Ga0070714_1000021022 389
55 3300021388 Ga0213875_10020060 Ga0213875_100200603 389
56 3300025929 Ga0207664_10061927 Ga0207664_100619272 389
57 3300005435 Ga0070714_100007490 Ga0070714_1000074902 390
58 3300005435 Ga0070714_100038593 Ga0070714_1000385933 390
59 3300009093 Ga0105240_10054459 Ga0105240_100544594 390
60 3300025929 Ga0207664_10036345 Ga0207664_100363453 390
61 3300025944 Ga0207661_10097076 Ga0207661_100970762 390
62 3300031548 Ga0307408_100021066 Ga0307408_1000210662 390
63 3300031824 Ga0307413_10156943 Ga0307413_101569432 390
64 3300031852 Ga0307410_10134912 Ga0307410_101349122 390
65 3300005347 Ga0070668_100007768 Ga0070668_1000077686 391
66 3300006880 Ga0075429_100285720 Ga0075429_1002857201 391
67 3300048929 Ga0496126_0005424 Ga0496126_0005424_10938_12125 391
68 3300005347 Ga0070668_100026917 Ga0070668_1000269173 392
69 3300025972 Ga0207668_10092945 Ga0207668_100929452 392
70 3300048903 Ga0496100_0000836 Ga0496100_0000836_11032_12222 392
71 3300048904 Ga0496101_0000056 Ga0496101_0000056_30417_31607 392
72 3300048905 Ga0496102_0000177 Ga0496102_0000177_30642_31832 392
73 3300048906 Ga0496103_0000003 Ga0496103_0000003_54893_56083 392
74 3300048909 Ga0496106_0025658 Ga0496106_0025658_854_2044 392
75 3300048919 Ga0496116_0000013 Ga0496116_0000013_547911_549101 392
76 3300048920 Ga0496117_0000013 Ga0496117_0000013_54893_56083 392
77 3300048921 Ga0496118_0000011 Ga0496118_0000011_547913_549103 392
78 3300048922 Ga0496119_0007186 Ga0496119_0007186_669_1859 392
79 3300048924 Ga0496121_0000060 Ga0496121_0000060_171519_172709 392
80 iso_pu_bacteria 2920879853 2920879997 393
81 3300049571 Ga0501034_0041644 Ga0501034_0041644_1640_2872 394
82 3300049581 Ga0501047_0115878 Ga0501047_0115878_456_1688 394
83 3300054114 Ga0501084_0018544 Ga0501084_0018544_1569_2789 394
84 3300009094 Ga0111539_10229017 Ga0111539_102290171 395
85 3300037853 Ga0436364_0019204 Ga0436364_0019204_4554_5741 395
86 3300039437 Ga0436365_0928916 Ga0436365_0928916_11436_12623 395
87 3300039437 Ga0436365_1296534 Ga0436365_1296534_9326_10513 395
88 3300050511 nmdc:mga08y16_192281_c1 nmdc:mga08y16_192281_c1_569_1840 395
89 iso_pu_bacteria 2919713450 2919719843 395
90 3300025900 Ga0207710_10000119 Ga0207710_1000011921 396
91 3300025302 Ga0207426_1002131 Ga0207426_100213112 397
92 3300028556 Ga0265337_1002501 Ga0265337_10025014 397
93 3300028563 Ga0265319_1013504 Ga0265319_10135043 397
94 3300031240 Ga0265320_10001483 Ga0265320_1000148310 397
95 3300031250 Ga0265331_10004294 Ga0265331_1000429410 397
96 iso_pu_bacteria 2929212328 2929219402 397
97 3300006847 Ga0075431_100020408 Ga0075431_1000204086 398
98 3300006871 Ga0075434_100072294 Ga0075434_1000722942 398
99 3300009094 Ga0111539_10152556 Ga0111539_101525562 398
100 3300028380 Ga0268265_10036882 Ga0268265_100368823 398
101 3300048912 Ga0496109_0000029 Ga0496109_0000029_6897_8129 398
102 iso_pu_bacteria 2738541274 2738708541 398
103 iso_pu_bacteria 2738543028 2739334980 398
104 iso_pu_bacteria 2902799365 2902802224 398
105 3300005329 Ga0070683_100007206 Ga0070683_1000072067 399
106 3300005467 Ga0070706_100001197 Ga0070706_10000119723 399
107 3300005539 Ga0068853_100039145 Ga0068853_1000391453 399
108 3300005563 Ga0068855_100002492 Ga0068855_1000024924 399
109 3300025910 Ga0207684_10005097 Ga0207684_1000509715 399
110 3300025913 Ga0207695_10002853 Ga0207695_1000285325 399
111 3300025913 Ga0207695_10025397 Ga0207695_100253975 399
112 3300025949 Ga0207667_10001408 Ga0207667_100014089 399
113 3300026041 Ga0207639_10015169 Ga0207639_100151693 399
114 3300048906 Ga0496103_0006434 Ga0496103_0006434_5407_6633 399
115 3300048907 Ga0496104_0005253 Ga0496104_0005253_1438_2664 399
116 3300048908 Ga0496105_0045825 Ga0496105_0045825_690_1916 399
117 3300048913 Ga0496110_0094704 Ga0496110_0094704_239_1465 399
118 3300048921 Ga0496118_0104010 Ga0496118_0104010_277_1503 399
119 3300003354 JGI25160J50197_1006844 JGI25160J50197_10068443 400
120 3300005335 Ga0070666_10097735 Ga0070666_100977352 400
121 3300006028 Ga0070717_10018143 Ga0070717_100181432 400
122 3300025302 Ga0207426_1000625 Ga0207426_10006256 400
123 3300047322 Ga0495680_0015578 Ga0495680_0015578_5307_6515 400
124 3300050514 nmdc:mga08x19_33097_c1 nmdc:mga08x19_33097_c1_429_1712 400
125 iso_pu_bacteria 8025478263 8025482463 400
126 3300005334 Ga0068869_100077600 Ga0068869_1000776002 401
127 3300005337 Ga0070682_100019825 Ga0070682_1000198255 401
128 3300005338 Ga0068868_100078789 Ga0068868_1000787893 401
129 3300005347 Ga0070668_100087866 Ga0070668_1000878662 401
130 3300005367 Ga0070667_100004728 Ga0070667_10000472810 401
131 3300005437 Ga0070710_10133392 Ga0070710_101333921 401
132 3300005441 Ga0070700_100156636 Ga0070700_1001566362 401
133 3300005456 Ga0070678_100168278 Ga0070678_1001682782 401
134 3300005543 Ga0070672_100213407 Ga0070672_1002134072 401
135 3300005545 Ga0070695_100146374 Ga0070695_1001463742 401
136 3300005547 Ga0070693_100055870 Ga0070693_1000558702 401
137 3300005548 Ga0070665_100000137 Ga0070665_10000013798 401
138 3300005548 Ga0070665_100022107 Ga0070665_1000221073 401
139 3300005548 Ga0070665_100083366 Ga0070665_1000833661 401
140 3300005719 Ga0068861_100028159 Ga0068861_1000281594 401
141 3300005841 Ga0068863_100006453 Ga0068863_1000064535 401
142 3300005937 Ga0081455_10067238 Ga0081455_100672383 401
143 3300006038 Ga0075365_10017771 Ga0075365_100177713 401
144 3300006058 Ga0075432_10033292 Ga0075432_100332922 401
145 3300006237 Ga0097621_100093475 Ga0097621_1000934752 401
146 3300006881 Ga0068865_100084416 Ga0068865_1000844162 401
147 3300009101 Ga0105247_10013750 Ga0105247_100137502 401
148 3300009176 Ga0105242_10199604 Ga0105242_101996043 401
149 3300009551 Ga0105238_10106509 Ga0105238_101065092 401
150 3300013307 Ga0157372_10189058 Ga0157372_101890581 401
151 3300025900 Ga0207710_10078808 Ga0207710_100788082 401
152 3300025901 Ga0207688_10034936 Ga0207688_100349363 401
153 3300025942 Ga0207689_10052266 Ga0207689_100522664 401
154 3300026023 Ga0207677_10087485 Ga0207677_100874852 401
155 3300026075 Ga0207708_10086698 Ga0207708_100866983 401
156 3300026088 Ga0207641_10081715 Ga0207641_100817152 401
157 3300026088 Ga0207641_10338703 Ga0207641_103387032 401
158 3300026089 Ga0207648_10064552 Ga0207648_100645523 401
159 3300026095 Ga0207676_10038354 Ga0207676_100383542 401
160 3300026121 Ga0207683_10141440 Ga0207683_101414403 401
161 3300033180 Ga0307510_10017084 Ga0307510_1001708410 401
162 3300036712 Ga0316584_0045222 Ga0316584_0045222_1922_3130 401
163 3300047320 Ga0495672_0016470 Ga0495672_0016470_1238_2446 401
164 3300048904 Ga0496101_0195314 Ga0496101_0195314_16_1227 401
165 3300048914 Ga0496111_0138573 Ga0496111_0138573_518_1741 401
166 3300048915 Ga0496112_0061222 Ga0496112_0061222_2019_3242 401
167 3300050492 nmdc:mga0yw44_10272_c1 nmdc:mga0yw44_10272_c1_2329_3537 401
168 3300050516 nmdc:mga0sz30_23899_c1 nmdc:mga0sz30_23899_c1_280_1488 401
169 3300053136 Ga0500559_0023216 Ga0500559_0023216_1359_2567 401
170 3300053730 Ga0500645_000055 Ga0500645_000055_45445_46653 401
171 3300053730 Ga0500645_036617 Ga0500645_036617_169_1377 401
172 iso_pu_bacteria 2537561592 2537900390 401
173 3300046530 Ga0495654_0102478 Ga0495654_0102478_15_1256 402
174 3300046692 Ga0495671_0055974 Ga0495671_0055974_641_1882 402
175 3300047318 Ga0495636_0003754 Ga0495636_0003754_1722_2963 402
176 3300048929 Ga0496126_0001987 Ga0496126_0001987_14074_15285 402
177 3300049569 Ga0501032_0003287 Ga0501032_0003287_5675_7075 402
178 3300049571 Ga0501034_0000960 Ga0501034_0000960_37762_38985 402
179 3300049571 Ga0501034_0006815 Ga0501034_0006815_7557_8957 402
180 3300049572 Ga0501036_0002271 Ga0501036_0002271_10418_11818 402
181 3300049573 Ga0501037_0002160 Ga0501037_0002160_12340_13740 402
182 3300049575 Ga0501039_0000903 Ga0501039_0000903_15287_16687 402
183 3300049579 Ga0501043_0001683 Ga0501043_0001683_4716_6116 402
184 3300049581 Ga0501047_0117395 Ga0501047_0117395_431_1645 402
185 3300049583 Ga0501067_0013088 Ga0501067_0013088_1756_3156 402
186 3300049584 Ga0501068_0090188 Ga0501068_0090188_70_1470 402
187 3300049586 Ga0501070_0052794 Ga0501070_0052794_54_1268 402
188 3300049823 Ga0501044_0006114 Ga0501044_0006114_8350_9750 402
189 iso_pu_bacteria 2917736166 2917744660 402
190 3300005335 Ga0070666_10058193 Ga0070666_100581933 403
191 3300005338 Ga0068868_100021443 Ga0068868_1000214433 403
192 3300005366 Ga0070659_100168022 Ga0070659_1001680222 403
193 3300005366 Ga0070659_100234879 Ga0070659_1002348791 403
194 3300005367 Ga0070667_100064299 Ga0070667_1000642993 403
195 3300005434 Ga0070709_10015462 Ga0070709_100154623 403
196 3300005437 Ga0070710_10088015 Ga0070710_100880151 403
197 3300005439 Ga0070711_100006031 Ga0070711_1000060312 403
198 3300005439 Ga0070711_100037446 Ga0070711_1000374463 403
199 3300005441 Ga0070700_100007486 Ga0070700_1000074866 403
200 3300005459 Ga0068867_100001731 Ga0068867_1000017313 403
201 3300005466 Ga0070685_10041499 Ga0070685_100414993 403
202 3300005539 Ga0068853_100173744 Ga0068853_1001737442 403
203 3300005545 Ga0070695_100021598 Ga0070695_1000215983 403
204 3300005549 Ga0070704_100000886 Ga0070704_1000008863 403
205 3300005578 Ga0068854_100048220 Ga0068854_1000482202 403
206 3300005718 Ga0068866_10000844 Ga0068866_1000084411 403
207 3300005842 Ga0068858_100105616 Ga0068858_1001056162 403
208 3300005843 Ga0068860_100009685 Ga0068860_10000968510 403
209 3300005844 Ga0068862_100021725 Ga0068862_1000217251 403
210 3300006173 Ga0070716_100024412 Ga0070716_1000244121 403
211 3300006175 Ga0070712_100008363 Ga0070712_1000083632 403
212 3300006175 Ga0070712_100104784 Ga0070712_1001047842 403
213 3300006881 Ga0068865_100025367 Ga0068865_1000253675 403
214 3300009098 Ga0105245_10001126 Ga0105245_1000112616 403
215 3300009148 Ga0105243_10003000 Ga0105243_100030002 403
216 3300009545 Ga0105237_10217108 Ga0105237_102171082 403
217 3300009553 Ga0105249_10009623 Ga0105249_100096233 403
218 3300013297 Ga0157378_10003396 Ga0157378_100033969 403
219 3300013307 Ga0157372_10100364 Ga0157372_101003642 403
220 3300014326 Ga0157380_10078540 Ga0157380_100785401 403
221 3300014968 Ga0157379_10021091 Ga0157379_100210917 403
222 3300014969 Ga0157376_10085082 Ga0157376_100850822 403
223 3300025898 Ga0207692_10004545 Ga0207692_100045454 403
224 3300025898 Ga0207692_10044147 Ga0207692_100441472 403
225 3300025901 Ga0207688_10004649 Ga0207688_100046494 403
226 3300025903 Ga0207680_10063516 Ga0207680_100635162 403
227 3300025905 Ga0207685_10023165 Ga0207685_100231652 403
228 3300025906 Ga0207699_10169682 Ga0207699_101696822 403
229 3300025907 Ga0207645_10034831 Ga0207645_100348314 403
230 3300025914 Ga0207671_10238015 Ga0207671_102380152 403
231 3300025915 Ga0207693_10002096 Ga0207693_1000209610 403
232 3300025915 Ga0207693_10060160 Ga0207693_100601603 403
233 3300025916 Ga0207663_10089734 Ga0207663_100897342 403
234 3300025918 Ga0207662_10036962 Ga0207662_100369622 403
235 3300025923 Ga0207681_10162869 Ga0207681_101628691 403
236 3300025927 Ga0207687_10005249 Ga0207687_100052493 403
237 3300025933 Ga0207706_10012282 Ga0207706_1001228210 403
238 3300025941 Ga0207711_10010465 Ga0207711_100104653 403
239 3300025961 Ga0207712_10087253 Ga0207712_100872532 403
240 3300025972 Ga0207668_10175397 Ga0207668_101753971 403
241 3300026035 Ga0207703_10213415 Ga0207703_102134152 403
242 3300026075 Ga0207708_10004969 Ga0207708_100049695 403
243 3300026089 Ga0207648_10006698 Ga0207648_1000669810 403
244 3300028379 Ga0268266_10086881 Ga0268266_100868812 403
245 3300028381 Ga0268264_10104095 Ga0268264_101040952 403
246 3300048905 Ga0496102_0008169 Ga0496102_0008169_1350_2579 403
247 3300048905 Ga0496102_0011501 Ga0496102_0011501_2949_4178 403
248 3300048906 Ga0496103_0006151 Ga0496103_0006151_181_1410 403
249 3300048906 Ga0496103_0052351 Ga0496103_0052351_934_2163 403
250 3300048908 Ga0496105_0107657 Ga0496105_0107657_45_1274 403
251 3300048909 Ga0496106_0005204 Ga0496106_0005204_1335_2564 403
252 3300048909 Ga0496106_0027381 Ga0496106_0027381_2169_3398 403
253 3300048910 Ga0496107_0057452 Ga0496107_0057452_1553_2782 403
254 3300048918 Ga0496115_0210662 Ga0496115_0210662_206_1435 403
255 3300049822 Ga0501035_0283825 Ga0501035_0283825_109_1332 403
256 iso_pu_bacteria 2974294766 2974295383 403
257 iso_pu_bacteria 2974324384 2974324814 403
258 iso_pu_bacteria 2946059875 2946060077 404
259 3300031456 Ga0307513_10021495 Ga0307513_100214952 405
260 3300037853 Ga0436364_0897743 Ga0436364_0897743_1334_2656 405
261 3300048916 Ga0496113_0150474 Ga0496113_0150474_15_1250 405
262 iso_pu_bacteria 8056060235 8056065294 405
263 3300005347 Ga0070668_100092456 Ga0070668_1000924563 406
264 3300031838 Ga0307518_10057853 Ga0307518_100578532 406
265 3300039450 Ga0436363_0097909 Ga0436363_0097909_1383_2606 406
266 iso_pu_bacteria 2862178590 2862184232 407
267 iso_pu_bacteria 2867475112 2867481346 407
268 iso_pu_bacteria 8054160619 8054164272 407
269 3300005456 Ga0070678_100118736 Ga0070678_1001187361 408
270 3300021361 Ga0213872_10000239 Ga0213872_1000023925 408
271 3300021384 Ga0213876_10022522 Ga0213876_100225222 408
272 3300030744 Ga0316181_1100278 Ga0316181_11002782 408
273 3300039437 Ga0436365_0123721 Ga0436365_0123721_3637_4866 408
274 3300039447 Ga0436361_0863641 Ga0436361_0863641_39868_41226 408
275 3300048915 Ga0496112_0097118 Ga0496112_0097118_1247_2524 408
276 3300049582 Ga0501048_0001799 Ga0501048_0001799_14123_15352 408
277 iso_pu_bacteria 2917736166 2917743412 408
278 iso_pu_bacteria 8056667051 8056672050 408
279 iso_pu_bacteria 2895427314 2895434358 409
280 3300005937 Ga0081455_10034160 Ga0081455_100341603 410
281 3300006048 Ga0075363_100006824 Ga0075363_1000068242 410
282 3300006051 Ga0075364_10014930 Ga0075364_100149304 410
283 3300021384 Ga0213876_10000795 Ga0213876_1000079512 410
284 3300025928 Ga0207700_10247575 Ga0207700_102475752 410
285 3300031251 Ga0265327_10000069 Ga0265327_1000006977 410
286 3300045976 Ga0466967_0012846 Ga0466967_0012846_2854_4089 410
287 3300045976 Ga0466967_0087793 Ga0466967_0087793_1486_2721 410
288 3300045976 Ga0466967_0127613 Ga0466967_0127613_1000_2238 410
289 3300049572 Ga0501036_0050944 Ga0501036_0050944_1562_2797 410
290 3300049580 Ga0501046_0007491 Ga0501046_0007491_7280_8515 410
291 3300049581 Ga0501047_0005226 Ga0501047_0005226_6797_8032 410
292 3300049585 Ga0501069_0111777 Ga0501069_0111777_276_1511 410
293 3300049586 Ga0501070_0007399 Ga0501070_0007399_7359_8594 410
294 3300049742 Ga0501080_0064551 Ga0501080_0064551_1168_2403 410
295 3300049822 Ga0501035_0051345 Ga0501035_0051345_1367_2602 410
296 3300049823 Ga0501044_0005851 Ga0501044_0005851_9023_10258 410
297 3300050491 nmdc:mga00v17_17813_c1 nmdc:mga00v17_17813_c1_901_2139 410
298 3300050516 nmdc:mga0sz30_7251_c1 nmdc:mga0sz30_7251_c1_491_1729 410
299 3300014497 Ga0182008_10041605 Ga0182008_100416053 411
300 3300045976 Ga0466967_0036273 Ga0466967_0036273_970_2217 411
301 iso_pu_bacteria 2919391150 2919391860 411
302 iso_pu_bacteria 2945956166 2945957044 411
303 3300013306 Ga0163162_10210211 Ga0163162_102102112 412
304 3300048903 Ga0496100_0002912 Ga0496100_0002912_1868_3109 412
305 3300048904 Ga0496101_0001135 Ga0496101_0001135_7704_8945 412
306 3300048905 Ga0496102_0009865 Ga0496102_0009865_5576_6817 412
307 3300048910 Ga0496107_0006291 Ga0496107_0006291_4372_5613 412
308 3300048911 Ga0496108_0093557 Ga0496108_0093557_440_1681 412
309 3300048912 Ga0496109_0150052 Ga0496109_0150052_773_2014 412
310 3300048914 Ga0496111_0103237 Ga0496111_0103237_53_1294 412
311 3300048917 Ga0496114_0026019 Ga0496114_0026019_72_1313 412
312 3300048928 Ga0496125_0113398 Ga0496125_0113398_68_1309 412
313 3300002773 JGI25152J39213_1001193 JGI25152J39213_10011938 415
314 3300005288 Ga0065714_10084548 Ga0065714_100845482 415
315 3300009011 Ga0105251_10041520 Ga0105251_100415203 415
316 3300009177 Ga0105248_10023984 Ga0105248_100239841 415
317 3300025258 Ga0209129_1000052 Ga0209129_100005263 415
318 3300025294 Ga0209025_1001043 Ga0209025_100104310 415
319 3300025315 Ga0207697_10008811 Ga0207697_100088112 415
320 3300025893 Ga0207682_10003807 Ga0207682_100038073 415
321 3300025907 Ga0207645_10023752 Ga0207645_100237522 415
322 3300025940 Ga0207691_10058223 Ga0207691_100582234 415
323 3300025986 Ga0207658_10021152 Ga0207658_100211524 415
324 3300026121 Ga0207683_10092436 Ga0207683_100924362 415
325 3300031548 Ga0307408_100220453 Ga0307408_1002204532 415
326 3300031731 Ga0307405_10032897 Ga0307405_100328972 415
327 3300038443 Ga0395901_0199069 Ga0395901_0199069_606_1958 415
328 3300046459 Ga0495629_0125983 Ga0495629_0125983_41_1294 415
329 3300046463 Ga0495653_0001613 Ga0495653_0001613_35_1288 415
330 3300046472 Ga0495580_0041011 Ga0495580_0041011_1951_3204 415
331 3300046473 Ga0495582_0079323 Ga0495582_0079323_357_1610 415
332 3300046476 Ga0495662_0002270 Ga0495662_0002270_2363_3616 415
333 3300046477 Ga0495664_0004073 Ga0495664_0004073_5883_7136 415
334 3300046531 Ga0495665_0000402 Ga0495665_0000402_14542_15795 415
335 3300046531 Ga0495665_0034074 Ga0495665_0034074_223_1476 415
336 3300046535 Ga0495586_0001126 Ga0495586_0001126_13325_14578 415
337 3300046535 Ga0495586_0003775 Ga0495586_0003775_1199_2452 415
338 3300046536 Ga0495587_0003592 Ga0495587_0003592_6755_8008 415
339 3300046543 Ga0495645_0000495 Ga0495645_0000495_17593_18846 415
340 3300046559 Ga0495667_0000098 Ga0495667_0000098_25446_26699 415
341 3300046663 Ga0495635_0166415 Ga0495635_0166415_194_1447 415
342 3300046674 Ga0495588_0003836 Ga0495588_0003836_3062_4309 415
343 3300046674 Ga0495588_0017268 Ga0495588_0017268_727_2112 415
344 3300047315 Ga0495581_0099217 Ga0495581_0099217_122_1507 415
345 3300047315 Ga0495581_0107888 Ga0495581_0107888_231_1484 415
346 3300047317 Ga0495604_0062271 Ga0495604_0062271_102_1355 415
347 3300047444 Ga0495675_0008849 Ga0495675_0008849_808_2061 415
348 3300048910 Ga0496107_0035308 Ga0496107_0035308_1902_3149 415
349 3300048911 Ga0496108_0200105 Ga0496108_0200105_333_1580 415
350 3300000549 LJQas_1000922 LJQas_10009222 417
351 3300025254 Ga0209148_1004078 Ga0209148_10040786 417

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01494

FAD_binding_3

FAD binding domain

67

407

0.93

PF00070

Pyr_redox

Pyridine nucleotide-disulphide oxidoreductase

69

124

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
8c79-assembly1.cif.gz_B crystal structure of leishmania donovani 6-phosphogluconate dehydrogenase complexed with nadph 0.9244 6 34
6fqz-assembly1.cif.gz_B plasmodium falciparum 6-phosphogluconate dehydrogenase in its apo form, in complex with its cofactor nadp+ and in complex with its substrate 6-phosphogluconate 0.9069 6 36
6eod-assembly3.cif.gz_C structure of reductive aminase from aspergillus terreus in complex with nadph 0.9028 6 34
6eod-assembly2.cif.gz_B structure of reductive aminase from aspergillus terreus in complex with nadph 0.9017 6 34
6eod-assembly1.cif.gz_A structure of reductive aminase from aspergillus terreus in complex with nadph 0.8983 6 34
ID Description Score Start End Superfamily
af_O65936_274_405_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9877 232 362 3.50.50.60
af_O65936_274_405_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.973 232 362 3.50.50.60
af_O65936_46_234_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9614 1 185 3.50.50.60
af_O69721_5_180_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9489 6 38 3.40.50.720
af_Q4DU92_1_145_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9392 7 34 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A1I7AVI2-F1-model_v4 2-polyprenyl-6-methoxyphenol hydroxylase 0.9898 3 417 GO:0016491
GO:0071949
AF-A0A1I7AVI2-F1-model_v4 2-polyprenyl-6-methoxyphenol hydroxylase 0.9828 3 417 GO:0016491
GO:0071949
AF-A0A166KPL1-F1-model_v4 Monooxygenase 0.9633 21 406 GO:0004497
GO:0071949
AF-A0A166KPL1-F1-model_v4 Monooxygenase 0.9583 21 406 GO:0004497
GO:0071949
AF-A0A370I8C1-F1-model_v4 2-polyprenyl-6-methoxyphenol hydroxylase-like FAD-dependent oxidoreductase 0.9578 19 410 GO:0016491
GO:0071949

Feature Viewer

pLDDT pTM Quality
89.31 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map