F418794

General Info

Members Datasets Scaffolds Average Seq Length
351 198 702 258

Family's Representative Sequence

Representative Sequence 3300049568|Ga0501031_0089046|Ga0501031_0089046_1052_1906
Length 284
Sequence MMWNQRSTSWNLREPPDLQAGGFVTDTDTGTVAASGTRAVDRAADLVSTVVRADEPMTFAELQEASGLAKSTTSRMLTALERSGLLERDGAGSYVAGPLFWLYAARHDPWEELVRLARPTMEAIGEDTHETVHLSVARGDRVVQVAQVDSTYLLGTRDWTEVDVPSHCSALGKVFLAWGVLEVPRGPLAAHTAATLTDPERLRGDGDRARRRGWAITADELEVGLTGVAVPVHGPRGDVVAALGVSGPTPRMEGRLDDLGRRLLERAAELSMLLRGRTPKEGVA

Samples

Sample ID Description Type Environment
1 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
44 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
45 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
71 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
108 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
112 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
113 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
114 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
115 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
116 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
117 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
118 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
119 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
120 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
121 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
122 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
123 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
124 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
125 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
126 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
127 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
128 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
129 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
130 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
131 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
132 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
133 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
134 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
135 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
136 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
137 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
138 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
139 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
140 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
141 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
142 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
143 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
144 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
145 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
146 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
147 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
148 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
162 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
163 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
164 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
165 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
166 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
167 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
168 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
169 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
170 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
171 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
172 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
173 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
174 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
175 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
176 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
178 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
179 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
180 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
181 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
182 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
183 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
184 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
185 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
186 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
187 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
188 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
189 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
190 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
191 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
192 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
193 2643221561 Nocardioides sp. Root151 Isolate Unclassified
194 2643221615 Nocardioides sp. Root224 Isolate Unclassified
195 2643221641 Nocardioides sp. Root122 Isolate Unclassified
196 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
197 2643221696 Nocardioides sp. Root140 Isolate Unclassified
198 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.29
Metatranscriptomes 0
Isolates 1.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.24
Nodule 0
Rhizoplane 3.7
Rhizosphere 77.21
Stem 0
Stem Tuber 0
Unclassified 0.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501031_0089046 3300049568 Bacteria 2012
2 LJQas_1000875 3300000549 Bacteria 4692
3 Ga0070683_100003756 3300005329 Bacteria 12390
4 Ga0070683_100062058 3300005329 Bacteria 3475
5 Ga0070683_100796085 3300005329 Unclassified 906
6 Ga0070670_100104185 3300005331 Bacteria 2444
7 Ga0068869_100130639 3300005334 Bacteria 1930
8 Ga0070666_10396971 3300005335 Bacteria 991
9 Ga0070680_100093651 3300005336 Bacteria 2489
10 Ga0068868_100027321 3300005338 Bacteria 4354
11 Ga0068868_100367370 3300005338 Bacteria 1236
12 Ga0070660_100114577 3300005339 Bacteria 2148
13 Ga0070661_100062855 3300005344 Bacteria 2726
14 Ga0070661_100075877 3300005344 Bacteria 2478
15 Ga0070692_10046626 3300005345 Bacteria 2241
16 Ga0070669_100452787 3300005353 Bacteria 1058
17 Ga0070675_100001126 3300005354 Bacteria 19307
18 Ga0070659_100073068 3300005366 Bacteria 2730
19 Ga0070667_100025323 3300005367 Bacteria 4932
20 Ga0070667_100201398 3300005367 Bacteria 1767
21 Ga0070663_100073837 3300005455 Bacteria 2489
22 Ga0070663_100381048 3300005455 Bacteria 1149
23 Ga0070678_100064573 3300005456 Bacteria 2714
24 Ga0070678_100229833 3300005456 Bacteria 1546
25 Ga0070678_100432341 3300005456 Bacteria 1150
26 Ga0070662_100168353 3300005457 Bacteria 1719
27 Ga0070681_10692269 3300005458 Bacteria 935
28 Ga0070685_10112876 3300005466 Bacteria 1677
29 Ga0070685_10182986 3300005466 Bacteria 1351
30 Ga0070684_100039812 3300005535 Bacteria 4045
31 Ga0070684_100046869 3300005535 Bacteria 3746
32 Ga0070672_100059714 3300005543 Bacteria 3001
33 Ga0070693_100195669 3300005547 Bacteria 1310
34 Ga0070665_100220596 3300005548 Bacteria 1896
35 Ga0070665_100291403 3300005548 Bacteria 1634
36 Ga0070665_100404123 3300005548 Bacteria 1374
37 Ga0070665_100477334 3300005548 Bacteria 1258
38 Ga0068855_100070484 3300005563 Bacteria 4067
39 Ga0070664_100000864 3300005564 Bacteria 23434
40 Ga0068857_100009635 3300005577 Bacteria 8393
41 Ga0068857_100028886 3300005577 Bacteria 4894
42 Ga0068854_100216272 3300005578 Bacteria 1514
43 Ga0068856_100043011 3300005614 Bacteria 4445
44 Ga0068856_100546840 3300005614 Bacteria 1179
45 Ga0070702_100165135 3300005615 Bacteria 1435
46 Ga0068852_100032530 3300005616 Bacteria 4320
47 Ga0068852_100188366 3300005616 Bacteria 1945
48 Ga0068852_100331850 3300005616 Bacteria 1480
49 Ga0068859_100270392 3300005617 Bacteria 1792
50 Ga0068864_100073768 3300005618 Bacteria 2976
51 Ga0068864_100241817 3300005618 Bacteria 1673
52 Ga0068866_10146897 3300005718 Bacteria 1361
53 Ga0068861_100026228 3300005719 Bacteria 4236
54 Ga0068870_10162385 3300005840 Bacteria 1326
55 Ga0068863_100128530 3300005841 Bacteria 2418
56 Ga0068858_100083101 3300005842 Bacteria 2978
57 Ga0068860_100000504 3300005843 Bacteria 48482
58 Ga0081455_10000310 3300005937 Bacteria 64261
59 Ga0081455_10004204 3300005937 Bacteria 16224
60 Ga0081539_10013544 3300005985 Bacteria 6134
61 Ga0075365_10022778 3300006038 Bacteria 3929
62 Ga0075365_10078470 3300006038 Bacteria 2232
63 Ga0075365_10087582 3300006038 Bacteria 2117
64 Ga0075365_10090318 3300006038 Bacteria 2086
65 Ga0075365_10134072 3300006038 Bacteria 1715
66 Ga0075365_10204775 3300006038 Bacteria 1383
67 Ga0075365_10204827 3300006038 Bacteria 1382
68 Ga0075368_10022232 3300006042 Bacteria 2414
69 Ga0075368_10063053 3300006042 Bacteria 1486
70 Ga0075363_100011275 3300006048 Bacteria 4275
71 Ga0075363_100083911 3300006048 Bacteria 1746
72 Ga0075363_100084205 3300006048 Bacteria 1743
73 Ga0075363_100120907 3300006048 Bacteria 1462
74 Ga0075364_10019559 3300006051 Bacteria 4250
75 Ga0075364_10039976 3300006051 Bacteria 3041
76 Ga0075364_10064446 3300006051 Bacteria 2405
77 Ga0075364_10119071 3300006051 Bacteria 1766
78 Ga0075364_10175928 3300006051 Bacteria 1447
79 Ga0075367_10009063 3300006178 Bacteria 5184
80 Ga0075367_10050290 3300006178 Bacteria 2460
81 Ga0075367_10120573 3300006178 Bacteria 1616
82 Ga0075367_10130252 3300006178 Bacteria 1555
83 Ga0075367_10200243 3300006178 Bacteria 1247
84 Ga0075367_10200875 3300006178 Bacteria 1245
85 Ga0075370_10014335 3300006353 Bacteria 4227
86 Ga0075370_10026880 3300006353 Bacteria 3190
87 Ga0075370_10183367 3300006353 Bacteria 1232
88 Ga0075428_100115779 3300006844 Bacteria 2920
89 Ga0075430_100047588 3300006846 Bacteria 3622
90 Ga0075433_10263079 3300006852 Bacteria 1529
91 Ga0075434_100221250 3300006871 Bacteria 1913
92 Ga0075429_100000350 3300006880 Bacteria 33659
93 Ga0068865_100101935 3300006881 Bacteria 2103
94 Ga0097620_100270413 3300006931 Bacteria 1792
95 Ga0111539_10010317 3300009094 Bacteria 11761
96 Ga0111539_10028353 3300009094 Bacteria 6833
97 Ga0111539_10533353 3300009094 Bacteria 1367
98 Ga0105245_10014458 3300009098 Bacteria 6875
99 Ga0105245_10423141 3300009098 Bacteria 1335
100 Ga0114129_10004273 3300009147 Bacteria 20181
101 Ga0105243_10212014 3300009148 Bacteria 1706
102 Ga0105248_10286765 3300009177 Bacteria 1854
103 Ga0105237_10240132 3300009545 Bacteria 1813
104 Ga0105238_10217405 3300009551 Bacteria 1887
105 Ga0105249_10212159 3300009553 Bacteria 1900
106 Ga0105239_10001009 3300010375 Bacteria 39368
107 Ga0105239_10179158 3300010375 Bacteria 2371
108 Ga0105246_10007628 3300011119 Bacteria 6638
109 Ga0105246_10096889 3300011119 Bacteria 2139
110 Ga0105246_10174321 3300011119 Bacteria 1650
111 Ga0157371_10094943 3300013102 Bacteria 2113
112 Ga0163162_10107750 3300013306 Bacteria 2882
113 Ga0157372_10001821 3300013307 Bacteria 23109
114 Ga0157375_10007566 3300013308 Bacteria 9499
115 Ga0157375_10144822 3300013308 Bacteria 2506
116 Ga0157375_10192292 3300013308 Bacteria 2196
117 Ga0163163_10071530 3300014325 Bacteria 3457
118 Ga0163163_10363696 3300014325 Bacteria 1503
119 Ga0182008_10065083 3300014497 Bacteria 1794
120 Ga0157377_10002705 3300014745 Bacteria 7880
121 Ga0157379_10272071 3300014968 Bacteria 1540
122 Ga0157379_10320239 3300014968 Bacteria 1416
123 Ga0163161_10063478 3300017792 Bacteria 2692
124 Ga0163161_10308030 3300017792 Bacteria 1249
125 Ga0207688_10031560 3300025901 Bacteria 2925
126 Ga0207688_10089732 3300025901 Bacteria 1764
127 Ga0207680_10218105 3300025903 Bacteria 1307
128 Ga0207647_10041079 3300025904 Bacteria 2910
129 Ga0207643_10151386 3300025908 Bacteria 1391
130 Ga0207707_10558579 3300025912 Bacteria 972
131 Ga0207660_10243338 3300025917 Bacteria 1418
132 Ga0207662_10149863 3300025918 Bacteria 1483
133 Ga0207657_10115531 3300025919 Bacteria 2212
134 Ga0207649_10061863 3300025920 Bacteria 2358
135 Ga0207694_10144999 3300025924 Bacteria 1911
136 Ga0207650_10099208 3300025925 Bacteria 2239
137 Ga0207659_10007524 3300025926 Bacteria 6706
138 Ga0207687_10007879 3300025927 Bacteria 6982
139 Ga0207687_10037273 3300025927 Bacteria 3316
140 Ga0207687_10187777 3300025927 Bacteria 1606
141 Ga0207687_10452556 3300025927 Bacteria 1065
142 Ga0207690_10164274 3300025932 Bacteria 1658
143 Ga0207690_10306161 3300025932 Bacteria 1245
144 Ga0207709_10234365 3300025935 Bacteria 1331
145 Ga0207709_10360142 3300025935 Bacteria 1101
146 Ga0207669_10103457 3300025937 Bacteria 1889
147 Ga0207704_10030181 3300025938 Bacteria 3036
148 Ga0207704_10181710 3300025938 Bacteria 1521
149 Ga0207711_10384958 3300025941 Bacteria 1302
150 Ga0207689_10024242 3300025942 Bacteria 5091
151 Ga0207661_10003562 3300025944 Bacteria 10824
152 Ga0207679_10025411 3300025945 Bacteria 4072
153 Ga0207667_10200213 3300025949 Bacteria 2049
154 Ga0207640_10091988 3300025981 Bacteria 2103
155 Ga0207640_10265965 3300025981 Bacteria 1339
156 Ga0207658_10241800 3300025986 Bacteria 1530
157 Ga0207677_10020448 3300026023 Bacteria 4020
158 Ga0207677_10190163 3300026023 Bacteria 1623
159 Ga0207678_10004538 3300026067 Bacteria 12486
160 Ga0207678_10065332 3300026067 Bacteria 3124
161 Ga0207708_10123196 3300026075 Bacteria 2021
162 Ga0207702_10057447 3300026078 Bacteria 3307
163 Ga0207702_10682048 3300026078 Bacteria 1012
164 Ga0207641_10332411 3300026088 Bacteria 1444
165 Ga0207676_10065510 3300026095 Bacteria 2893
166 Ga0207674_10009194 3300026116 Bacteria 11327
167 Ga0207674_10077976 3300026116 Bacteria 3318
168 Ga0207675_100031084 3300026118 Bacteria 4972
169 Ga0207683_10058762 3300026121 Bacteria 3377
170 Ga0207683_10332196 3300026121 Bacteria 1393
171 Ga0207683_10362235 3300026121 Bacteria 1332
172 Ga0209813_10001494 3300027866 Bacteria 5255
173 Ga0209813_10066543 3300027866 Bacteria 1163
174 Ga0207428_10035193 3300027907 Bacteria 4096
175 Ga0268266_10198328 3300028379 Bacteria 1836
176 Ga0268266_10414026 3300028379 Bacteria 1276
177 Ga0268264_10000547 3300028381 Bacteria 47223
178 Ga0268264_10321098 3300028381 Bacteria 1464
179 Ga0307513_10223849 3300031456 Bacteria 1699
180 Ga0307405_10451898 3300031731 Bacteria 1019
181 Ga0307410_10138301 3300031852 Bacteria 1798
182 Ga0307406_10239587 3300031901 Bacteria 1360
183 Ga0307406_10292902 3300031901 Bacteria 1247
184 Ga0307407_10188447 3300031903 Bacteria 1373
185 Ga0307409_100118112 3300031995 Bacteria 2239
186 Ga0307409_100346195 3300031995 Bacteria 1401
187 Ga0307409_100509279 3300031995 Bacteria 1174
188 Ga0307416_100352173 3300032002 Bacteria 1491
189 Ga0307416_100764870 3300032002 Bacteria 1059
190 Ga0307414_10214392 3300032004 Bacteria 1576
191 Ga0307414_10459184 3300032004 Bacteria 1119
192 Ga0307411_10109150 3300032005 Bacteria 1976
193 Ga0307415_100006616 3300032126 Bacteria 6269
194 Ga0307415_100095122 3300032126 Bacteria 2168
195 Ga0307415_100164968 3300032126 Bacteria 1721
196 Ga0307415_100570928 3300032126 Unclassified 1002
197 Ga0395900_0042616 3300037418 Bacteria 4677
198 Ga0395900_0043277 3300037418 Bacteria 4641
199 Ga0395898_0031963 3300037466 Bacteria 5254
200 Ga0395901_0037614 3300038443 Bacteria 5005
201 Ga0451837_0810573 3300041494 Bacteria 1731
202 Ga0451853_1570503 3300041512 Bacteria 1818
203 Ga0451853_3404447 3300041512 Bacteria 1148
204 Ga0450907_005339 3300042146 Bacteria 2170
205 Ga0466965_0019107 3300044683 Bacteria 3290
206 Ga0466966_0005288 3300044684 Bacteria 8487
207 Ga0466961_0004447 3300044693 Bacteria 8777
208 Ga0466961_0117537 3300044693 Bacteria 1671
209 Ga0466963_0007666 3300044694 Bacteria 6444
210 Ga0466963_0048370 3300044694 Bacteria 2810
211 Ga0466963_0173025 3300044694 Bacteria 1506
212 Ga0466963_0235374 3300044694 Bacteria 1284
213 Ga0466971_0018154 3300044719 Bacteria 3115
214 Ga0466970_0007985 3300044765 Bacteria 5315
215 Ga0466957_0068341 3300044842 Bacteria 2193
216 Ga0466960_0000142 3300044901 Bacteria 24451
217 Ga0466960_0049767 3300044901 Bacteria 2018
218 Ga0466959_0004270 3300045049 Bacteria 9530
219 Ga0466958_0018751 3300045836 Bacteria 4019
220 Ga0466967_0076281 3300045976 Bacteria 3015
221 Ga0466967_0076594 3300045976 Bacteria 3009
222 Ga0466967_0099007 3300045976 Bacteria 2662
223 Ga0466967_0138331 3300045976 Bacteria 2266
224 Ga0466967_0328537 3300045976 Bacteria 1476
225 Ga0466967_0345690 3300045976 Bacteria 1439
226 Ga0495603_0079068 3300046455 Bacteria 1928
227 Ga0495658_0095607 3300046683 Bacteria 1766
228 Ga0496102_0000672 3300048905 Bacteria 34232
229 Ga0496107_0133431 3300048910 Bacteria 1834
230 Ga0496108_0007012 3300048911 Bacteria 9125
231 Ga0496108_0177877 3300048911 Bacteria 1842
232 Ga0496108_0441304 3300048911 Bacteria 1137
233 Ga0496109_0442228 3300048912 Bacteria 1228
234 Ga0496110_0000250 3300048913 Bacteria 34959
235 Ga0496110_0137204 3300048913 Bacteria 2211
236 Ga0496111_0001750 3300048914 Bacteria 12709
237 Ga0496114_0011182 3300048917 Bacteria 7166
238 Ga0496114_0012872 3300048917 Bacteria 6700
239 Ga0496114_0132529 3300048917 Bacteria 2153
240 Ga0496115_0220042 3300048918 Bacteria 1567
241 Ga0501031_0077557 3300049568 Bacteria 2164
242 Ga0501031_0157661 3300049568 Bacteria 1484
243 Ga0501032_0038166 3300049569 Bacteria 3273
244 Ga0501033_0211162 3300049570 Bacteria 1384
245 Ga0501034_0388016 3300049571 Bacteria 1321
246 Ga0501034_0689272 3300049571 Bacteria 921
247 Ga0501036_0023943 3300049572 Bacteria 5147
248 Ga0501036_0088065 3300049572 Bacteria 2624
249 Ga0501036_0096918 3300049572 Bacteria 2494
250 Ga0501036_0317626 3300049572 Bacteria 1302
251 Ga0501036_0336192 3300049572 Bacteria 1261
252 Ga0501037_0032145 3300049573 Bacteria 3874
253 Ga0501038_0066627 3300049574 Bacteria 3066
254 Ga0501038_0175206 3300049574 Bacteria 1734
255 Ga0501039_0033587 3300049575 Bacteria 3956
256 Ga0501039_0205650 3300049575 Bacteria 1548
257 Ga0501040_0010437 3300049576 Bacteria 6074
258 Ga0501040_0126597 3300049576 Bacteria 1795
259 Ga0501041_0009782 3300049577 Bacteria 5646
260 Ga0501041_0024558 3300049577 Bacteria 3619
261 Ga0501042_0103384 3300049578 Bacteria 2049
262 Ga0501042_0134345 3300049578 Bacteria 1784
263 Ga0501042_0145400 3300049578 Bacteria 1709
264 Ga0501046_0220952 3300049580 Bacteria 1402
265 Ga0501047_0137749 3300049581 Bacteria 2321
266 Ga0501048_0012865 3300049582 Bacteria 6216
267 Ga0501048_0248275 3300049582 Bacteria 1263
268 Ga0501048_0409510 3300049582 Bacteria 970
269 Ga0501067_0001074 3300049583 Bacteria 14741
270 Ga0501067_0041592 3300049583 Bacteria 2552
271 Ga0501068_0007202 3300049584 Bacteria 6160
272 Ga0501068_0008525 3300049584 Bacteria 5708
273 Ga0501068_0229500 3300049584 Bacteria 1180
274 Ga0501069_0056165 3300049585 Bacteria 2193
275 Ga0501070_0009008 3300049586 Bacteria 8445
276 Ga0501071_0023723 3300049587 Bacteria 4285
277 Ga0501071_0040776 3300049587 Bacteria 3323
278 Ga0501071_0115722 3300049587 Bacteria 1984
279 Ga0501071_0204572 3300049587 Bacteria 1484
280 Ga0501071_0233863 3300049587 Bacteria 1385
281 Ga0501072_0010886 3300049588 Bacteria 6938
282 Ga0501072_0016346 3300049588 Bacteria 5693
283 Ga0501072_0218231 3300049588 Bacteria 1520
284 Ga0501072_0282439 3300049588 Bacteria 1320
285 Ga0501072_0607001 3300049588 Bacteria 862
286 Ga0501073_0002614 3300049589 Bacteria 13483
287 Ga0501073_0067437 3300049589 Bacteria 2494
288 Ga0501074_0001216 3300049590 Bacteria 16960
289 Ga0501074_0001687 3300049590 Bacteria 15040
290 Ga0501075_0115880 3300049591 Bacteria 2037
291 Ga0501076_0161195 3300049592 Bacteria 1827
292 Ga0501076_0174049 3300049592 Bacteria 1754
293 Ga0501077_0077455 3300049593 Bacteria 2106
294 Ga0501077_0190845 3300049593 Bacteria 1302
295 Ga0501077_0350203 3300049593 Bacteria 942
296 Ga0501079_0016639 3300049741 Bacteria 5617
297 Ga0501079_0180018 3300049741 Bacteria 1649
298 Ga0501080_0027667 3300049742 Bacteria 5272
299 Ga0501080_0030422 3300049742 Bacteria 5030
300 Ga0501080_0587641 3300049742 Bacteria 989
301 Ga0501081_0148845 3300049743 Bacteria 1681
302 Ga0501083_0003650 3300049744 Bacteria 10797
303 Ga0501083_0046394 3300049744 Bacteria 2938
304 Ga0501035_0056483 3300049822 Bacteria 3502
305 Ga0501045_0005411 3300049824 Bacteria 8838
306 Ga0501045_0303013 3300049824 Bacteria 1189
307 nmdc:mga03n38_116874_c1 3300050490 Bacteria 1306
308 nmdc:mga03n38_20194_c1 3300050490 Bacteria 2661
309 nmdc:mga03n38_2673_c1 3300050490 Bacteria 5567
310 nmdc:mga03n38_54163_c1 3300050490 Bacteria 1802
311 nmdc:mga00v17_102992_c1 3300050491 Bacteria 1804
312 nmdc:mga00v17_124891_c1 3300050491 Bacteria 1641
313 nmdc:mga00v17_182775_c1 3300050491 Bacteria 1353
314 nmdc:mga0yw44_118547_c1 3300050492 Bacteria 1703
315 nmdc:mga0yw44_11862_c1 3300050492 Bacteria 4521
316 nmdc:mga0yw44_122395_c1 3300050492 Bacteria 1677
317 nmdc:mga0yw44_186689_c1 3300050492 Bacteria 1366
318 nmdc:mga0yw44_23626_c1 3300050492 Bacteria 3466
319 nmdc:mga0yw44_262580_c1 3300050492 Bacteria 1151
320 nmdc:mga0yw44_416995_c1 3300050492 Bacteria 909
321 nmdc:mga0yw44_74252_c1 3300050492 Bacteria 1653
322 nmdc:mga0yw44_83660_c1 3300050492 Bacteria 2005
323 nmdc:mga06z11_154641_c1 3300050494 Bacteria 1307
324 nmdc:mga06z11_2943_c1 3300050494 Bacteria 6556
325 nmdc:mga06z11_43085_c1 3300050494 Bacteria 2268
326 nmdc:mga06z11_77689_c1 3300050494 Bacteria 1773
327 nmdc:mga04h51_30943_c1 3300050495 Bacteria 1688
328 nmdc:mga04h51_699_c1 3300050495 Bacteria 7782
329 nmdc:mga07m45_198784_c1 3300050496 Bacteria 1166
330 nmdc:mga07m45_23078_c1 3300050496 Bacteria 3399
331 nmdc:mga07m45_28398_c1 3300050496 Bacteria 3088
332 nmdc:mga07m45_39937_c1 3300050496 Bacteria 2625
333 nmdc:mga07m45_70627_c1 3300050496 Bacteria 1986
334 nmdc:mga05p37_3158_c1 3300050507 Bacteria 19174
335 nmdc:mga09592_1107_c1 3300050508 Bacteria 21433
336 nmdc:mga0qj67_3097_c1 3300050509 Bacteria 11960
337 nmdc:mga06r32_1079_c1 3300050510 Bacteria 24501
338 nmdc:mga08y16_12232_c1 3300050511 Bacteria 9018
339 nmdc:mga08y16_9702_c1 3300050511 Bacteria 10108
340 nmdc:mga0n895_557465_c1 3300050512 Bacteria 1151
341 Ga0500556_0003218 3300053104 Bacteria 4860
342 Ga0501084_0008408 3300054114 Bacteria 8527
343 Ga0501084_0011904 3300054114 Bacteria 7203
344 Ga0501082_0069885 3300060353 Bacteria 3024
345 Ga0501082_0252042 3300060353 Bacteria 1536
346 2643825149 2643221561 Bacteria 4984412
347 2644092197 2643221615 Bacteria 5487866
348 2644229761 2643221641 Bacteria 4490190
349 2644322000 2643221657 Bacteria 5490246
350 2644534547 2643221696 Bacteria 5431823
351 2812333357 2811994874 Bacteria 5367947
352 Ga0501031_0089046
353 LJQas_1000875
354 Ga0070683_100003756
355 Ga0070683_100062058
356 Ga0070683_100796085
357 Ga0070670_100104185
358 Ga0068869_100130639
359 Ga0070666_10396971
360 Ga0070680_100093651
361 Ga0068868_100027321
362 Ga0068868_100367370
363 Ga0070660_100114577
364 Ga0070661_100062855
365 Ga0070661_100075877
366 Ga0070692_10046626
367 Ga0070669_100452787
368 Ga0070675_100001126
369 Ga0070659_100073068
370 Ga0070667_100025323
371 Ga0070667_100201398
372 Ga0070663_100073837
373 Ga0070663_100381048
374 Ga0070678_100064573
375 Ga0070678_100229833
376 Ga0070678_100432341
377 Ga0070662_100168353
378 Ga0070681_10692269
379 Ga0070685_10112876
380 Ga0070685_10182986
381 Ga0070684_100039812
382 Ga0070684_100046869
383 Ga0070672_100059714
384 Ga0070693_100195669
385 Ga0070665_100220596
386 Ga0070665_100291403
387 Ga0070665_100404123
388 Ga0070665_100477334
389 Ga0068855_100070484
390 Ga0070664_100000864
391 Ga0068857_100009635
392 Ga0068857_100028886
393 Ga0068854_100216272
394 Ga0068856_100043011
395 Ga0068856_100546840
396 Ga0070702_100165135
397 Ga0068852_100032530
398 Ga0068852_100188366
399 Ga0068852_100331850
400 Ga0068859_100270392
401 Ga0068864_100073768
402 Ga0068864_100241817
403 Ga0068866_10146897
404 Ga0068861_100026228
405 Ga0068870_10162385
406 Ga0068863_100128530
407 Ga0068858_100083101
408 Ga0068860_100000504
409 Ga0081455_10000310
410 Ga0081455_10004204
411 Ga0081539_10013544
412 Ga0075365_10022778
413 Ga0075365_10078470
414 Ga0075365_10087582
415 Ga0075365_10090318
416 Ga0075365_10134072
417 Ga0075365_10204775
418 Ga0075365_10204827
419 Ga0075368_10022232
420 Ga0075368_10063053
421 Ga0075363_100011275
422 Ga0075363_100083911
423 Ga0075363_100084205
424 Ga0075363_100120907
425 Ga0075364_10019559
426 Ga0075364_10039976
427 Ga0075364_10064446
428 Ga0075364_10119071
429 Ga0075364_10175928
430 Ga0075367_10009063
431 Ga0075367_10050290
432 Ga0075367_10120573
433 Ga0075367_10130252
434 Ga0075367_10200243
435 Ga0075367_10200875
436 Ga0075370_10014335
437 Ga0075370_10026880
438 Ga0075370_10183367
439 Ga0075428_100115779
440 Ga0075430_100047588
441 Ga0075433_10263079
442 Ga0075434_100221250
443 Ga0075429_100000350
444 Ga0068865_100101935
445 Ga0097620_100270413
446 Ga0111539_10010317
447 Ga0111539_10028353
448 Ga0111539_10533353
449 Ga0105245_10014458
450 Ga0105245_10423141
451 Ga0114129_10004273
452 Ga0105243_10212014
453 Ga0105248_10286765
454 Ga0105237_10240132
455 Ga0105238_10217405
456 Ga0105249_10212159
457 Ga0105239_10001009
458 Ga0105239_10179158
459 Ga0105246_10007628
460 Ga0105246_10096889
461 Ga0105246_10174321
462 Ga0157371_10094943
463 Ga0163162_10107750
464 Ga0157372_10001821
465 Ga0157375_10007566
466 Ga0157375_10144822
467 Ga0157375_10192292
468 Ga0163163_10071530
469 Ga0163163_10363696
470 Ga0182008_10065083
471 Ga0157377_10002705
472 Ga0157379_10272071
473 Ga0157379_10320239
474 Ga0163161_10063478
475 Ga0163161_10308030
476 Ga0207688_10031560
477 Ga0207688_10089732
478 Ga0207680_10218105
479 Ga0207647_10041079
480 Ga0207643_10151386
481 Ga0207707_10558579
482 Ga0207660_10243338
483 Ga0207662_10149863
484 Ga0207657_10115531
485 Ga0207649_10061863
486 Ga0207694_10144999
487 Ga0207650_10099208
488 Ga0207659_10007524
489 Ga0207687_10007879
490 Ga0207687_10037273
491 Ga0207687_10187777
492 Ga0207687_10452556
493 Ga0207690_10164274
494 Ga0207690_10306161
495 Ga0207709_10234365
496 Ga0207709_10360142
497 Ga0207669_10103457
498 Ga0207704_10030181
499 Ga0207704_10181710
500 Ga0207711_10384958
501 Ga0207689_10024242
502 Ga0207661_10003562
503 Ga0207679_10025411
504 Ga0207667_10200213
505 Ga0207640_10091988
506 Ga0207640_10265965
507 Ga0207658_10241800
508 Ga0207677_10020448
509 Ga0207677_10190163
510 Ga0207678_10004538
511 Ga0207678_10065332
512 Ga0207708_10123196
513 Ga0207702_10057447
514 Ga0207702_10682048
515 Ga0207641_10332411
516 Ga0207676_10065510
517 Ga0207674_10009194
518 Ga0207674_10077976
519 Ga0207675_100031084
520 Ga0207683_10058762
521 Ga0207683_10332196
522 Ga0207683_10362235
523 Ga0209813_10001494
524 Ga0209813_10066543
525 Ga0207428_10035193
526 Ga0268266_10198328
527 Ga0268266_10414026
528 Ga0268264_10000547
529 Ga0268264_10321098
530 Ga0307513_10223849
531 Ga0307405_10451898
532 Ga0307410_10138301
533 Ga0307406_10239587
534 Ga0307406_10292902
535 Ga0307407_10188447
536 Ga0307409_100118112
537 Ga0307409_100346195
538 Ga0307409_100509279
539 Ga0307416_100352173
540 Ga0307416_100764870
541 Ga0307414_10214392
542 Ga0307414_10459184
543 Ga0307411_10109150
544 Ga0307415_100006616
545 Ga0307415_100095122
546 Ga0307415_100164968
547 Ga0307415_100570928
548 Ga0395900_0042616
549 Ga0395900_0043277
550 Ga0395898_0031963
551 Ga0395901_0037614
552 Ga0451837_0810573
553 Ga0451853_1570503
554 Ga0451853_3404447
555 Ga0450907_005339
556 Ga0466965_0019107
557 Ga0466966_0005288
558 Ga0466961_0004447
559 Ga0466961_0117537
560 Ga0466963_0007666
561 Ga0466963_0048370
562 Ga0466963_0173025
563 Ga0466963_0235374
564 Ga0466971_0018154
565 Ga0466970_0007985
566 Ga0466957_0068341
567 Ga0466960_0000142
568 Ga0466960_0049767
569 Ga0466959_0004270
570 Ga0466958_0018751
571 Ga0466967_0076281
572 Ga0466967_0076594
573 Ga0466967_0099007
574 Ga0466967_0138331
575 Ga0466967_0328537
576 Ga0466967_0345690
577 Ga0495603_0079068
578 Ga0495658_0095607
579 Ga0496102_0000672
580 Ga0496107_0133431
581 Ga0496108_0007012
582 Ga0496108_0177877
583 Ga0496108_0441304
584 Ga0496109_0442228
585 Ga0496110_0000250
586 Ga0496110_0137204
587 Ga0496111_0001750
588 Ga0496114_0011182
589 Ga0496114_0012872
590 Ga0496114_0132529
591 Ga0496115_0220042
592 Ga0501031_0077557
593 Ga0501031_0157661
594 Ga0501032_0038166
595 Ga0501033_0211162
596 Ga0501034_0388016
597 Ga0501034_0689272
598 Ga0501036_0023943
599 Ga0501036_0088065
600 Ga0501036_0096918
601 Ga0501036_0317626
602 Ga0501036_0336192
603 Ga0501037_0032145
604 Ga0501038_0066627
605 Ga0501038_0175206
606 Ga0501039_0033587
607 Ga0501039_0205650
608 Ga0501040_0010437
609 Ga0501040_0126597
610 Ga0501041_0009782
611 Ga0501041_0024558
612 Ga0501042_0103384
613 Ga0501042_0134345
614 Ga0501042_0145400
615 Ga0501046_0220952
616 Ga0501047_0137749
617 Ga0501048_0012865
618 Ga0501048_0248275
619 Ga0501048_0409510
620 Ga0501067_0001074
621 Ga0501067_0041592
622 Ga0501068_0007202
623 Ga0501068_0008525
624 Ga0501068_0229500
625 Ga0501069_0056165
626 Ga0501070_0009008
627 Ga0501071_0023723
628 Ga0501071_0040776
629 Ga0501071_0115722
630 Ga0501071_0204572
631 Ga0501071_0233863
632 Ga0501072_0010886
633 Ga0501072_0016346
634 Ga0501072_0218231
635 Ga0501072_0282439
636 Ga0501072_0607001
637 Ga0501073_0002614
638 Ga0501073_0067437
639 Ga0501074_0001216
640 Ga0501074_0001687
641 Ga0501075_0115880
642 Ga0501076_0161195
643 Ga0501076_0174049
644 Ga0501077_0077455
645 Ga0501077_0190845
646 Ga0501077_0350203
647 Ga0501079_0016639
648 Ga0501079_0180018
649 Ga0501080_0027667
650 Ga0501080_0030422
651 Ga0501080_0587641
652 Ga0501081_0148845
653 Ga0501083_0003650
654 Ga0501083_0046394
655 Ga0501035_0056483
656 Ga0501045_0005411
657 Ga0501045_0303013
658 nmdc:mga03n38_116874_c1
659 nmdc:mga03n38_20194_c1
660 nmdc:mga03n38_2673_c1
661 nmdc:mga03n38_54163_c1
662 nmdc:mga00v17_102992_c1
663 nmdc:mga00v17_124891_c1
664 nmdc:mga00v17_182775_c1
665 nmdc:mga0yw44_118547_c1
666 nmdc:mga0yw44_11862_c1
667 nmdc:mga0yw44_122395_c1
668 nmdc:mga0yw44_186689_c1
669 nmdc:mga0yw44_23626_c1
670 nmdc:mga0yw44_262580_c1
671 nmdc:mga0yw44_416995_c1
672 nmdc:mga0yw44_74252_c1
673 nmdc:mga0yw44_83660_c1
674 nmdc:mga06z11_154641_c1
675 nmdc:mga06z11_2943_c1
676 nmdc:mga06z11_43085_c1
677 nmdc:mga06z11_77689_c1
678 nmdc:mga04h51_30943_c1
679 nmdc:mga04h51_699_c1
680 nmdc:mga07m45_198784_c1
681 nmdc:mga07m45_23078_c1
682 nmdc:mga07m45_28398_c1
683 nmdc:mga07m45_39937_c1
684 nmdc:mga07m45_70627_c1
685 nmdc:mga05p37_3158_c1
686 nmdc:mga09592_1107_c1
687 nmdc:mga0qj67_3097_c1
688 nmdc:mga06r32_1079_c1
689 nmdc:mga08y16_12232_c1
690 nmdc:mga08y16_9702_c1
691 nmdc:mga0n895_557465_c1
692 Ga0500556_0003218
693 Ga0501084_0008408
694 Ga0501084_0011904
695 Ga0501082_0069885
696 Ga0501082_0252042
697 2643825149
698 2644092197
699 2644229761
700 2644322000
701 2644534547
702 2812333357

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09339

HTH_IclR

IclR helix-turn-helix domain

39

90

0.98

PF01047

MarR

MarR family

49

89

0.94

PF01614

IclR

Bacterial transcriptional regulator

110

272

0.94

PF13412

HTH_24

Winged helix-turn-helix DNA-binding

49

87

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bp8-assembly2.cif.gz_B crystal structure of mlc/eiib complex 0.9146 17 71
7dh8-assembly1.cif.gz_A-2 crystal structure of holo xczur 0.9121 17 73
1z6r-assembly1.cif.gz_A crystal structure of mlc from escherichia coli 0.9117 17 71
3bp8-assembly2.cif.gz_A crystal structure of mlc/eiib complex 0.9085 17 71
1tf1-assembly2.cif.gz_B crystal structure of the e. coli glyoxylate regulatory protein ligand binding domain 0.908 86 250
ID Description Score Start End Superfamily
af_A0A1D6NJX1_369_456_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9539 17 64 1.10.10.10
af_A0A144A2J0_58_142_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9375 16 64 1.10.10.10
af_Q59048_168_225_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9321 18 71 1.10.10.10
af_O06806_1_76_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9295 1 72 1.10.10.10
2xrnA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9294 15 72 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2V9QTZ5-F1-model_v4 IclR-ED domain-containing protein 0.9476 88 250 GO:0003677
GO:0003700
GO:0045892
AF-A0A3D6BJA3-F1-model_v4 IclR-ED domain-containing protein 0.921 86 248 GO:0003677
GO:0003700
GO:0045892
AF-A0A7C4CTT0-F1-model_v4 IclR family transcriptional regulator 0.9208 116 249 GO:0003677
GO:0003700
GO:0045892
AF-A0A1L3L9Y9-F1-model_v4 deleted 0.9204 158 250
AF-A0A558A1F3-F1-model_v4 IclR family transcriptional regulator 0.9156 161 254 GO:0003677
GO:0003700
GO:0045892

Map