F418474

General Info

Members Datasets Scaffolds Average Seq Length
351 216 334 353

Family's Representative Sequence

Representative Sequence 3300001990|JGI24737J22298_10019315|JGI24737J22298_100193152
Length 367
Sequence MPTRLGALGQNWLMQLPVMPPVPPMLAKSVSAIPPGASYEPKWDGFRSICFRDGDEVELGSRNERPMTRYFPELVAAIKAELPQRCVIDGEIVIATPGGLDFEALQQRIHPADSRVRLLAQQTPASFIAFDLLALGDDDLTKRPFAERRAALVDALAGAGPSVHLTPATADLAEAQRWFTEFEGAGLDGVVAKPLDGTYQPDKRVMFKIKHERTADCVVGGYRVHKSGPDAVGSLMLGLYRGDTLVSVGVIGAFPMQRRRELFTELQPLVTDFEGHPWDWAAHLAGERTPRKGEGSRWNAGKDLSFVPLRPELVVEVRYDHMEGERFRHTAQFNRWRPDRTPESCTYEQLEQPVTFSLGEIVPGLGT

Samples

Sample ID Description Type Environment
1 2517572101 Frankia sp. DC12 Isolate Nodule
2 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
3 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
4 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
5 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
6 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
7 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
8 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
9 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
10 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
11 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
12 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
13 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
14 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
15 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
16 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
17 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
18 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
19 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
20 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
57 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
84 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
85 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
122 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
123 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
124 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
125 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
126 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
127 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
128 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
131 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
132 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
133 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
134 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
135 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
136 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
137 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
138 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
139 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
140 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
141 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
142 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
143 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
144 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
145 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
146 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
147 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
148 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
149 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
150 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
151 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
152 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
153 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
154 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
155 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
156 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
157 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
158 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
159 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
160 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
161 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
162 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
163 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
164 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
165 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
166 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
167 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
168 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
169 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
170 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
171 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
172 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
173 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
174 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
175 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
176 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
177 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
178 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
179 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
180 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
181 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
182 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
183 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
184 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
185 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
186 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
187 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
188 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
189 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
190 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
191 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
192 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
201 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
202 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
203 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
205 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
206 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
207 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
208 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
209 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
210 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
211 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
212 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
213 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
214 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
215 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
216 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.87
Metatranscriptomes 0.28
Isolates 4.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.41
Nodule 0.28
Rhizoplane 10.54
Rhizosphere 73.22
Stem 0
Stem Tuber 0
Unclassified 10.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10019315 3300001990 Bacteria 2180
2 JGI24735J21928_10009706 3300002067 Bacteria 3083
3 Ga0055540_1004054 3300003792 Bacteria 6805
4 Ga0068869_100146229 3300005334 Bacteria 1829
5 Ga0070682_100032737 3300005337 Bacteria 3154
6 Ga0068868_100100344 3300005338 Bacteria 2342
7 Ga0070687_100027208 3300005343 Bacteria 2760
8 Ga0070661_100090697 3300005344 Bacteria 2263
9 Ga0070671_100115702 3300005355 Bacteria 2255
10 Ga0070674_100033480 3300005356 Bacteria 3421
11 Ga0070673_100081387 3300005364 Bacteria 2626
12 Ga0070688_100091048 3300005365 Bacteria 1993
13 Ga0070659_100186765 3300005366 Bacteria 1702
14 Ga0070667_100031980 3300005367 Bacteria 4387
15 Ga0070667_100096300 3300005367 Bacteria 2552
16 Ga0070667_100299550 3300005367 Bacteria 1447
17 Ga0070714_100000006 3300005435 Bacteria 293311
18 Ga0070701_10166004 3300005438 Bacteria 1282
19 Ga0070700_100000011 3300005441 Bacteria 173076
20 Ga0070663_100042515 3300005455 Bacteria 3193
21 Ga0070678_100016504 3300005456 Bacteria 4727
22 Ga0070706_100082344 3300005467 Bacteria 2981
23 Ga0070684_100120063 3300005535 Bacteria 2364
24 Ga0070672_100178944 3300005543 Bacteria 1766
25 Ga0070665_100022993 3300005548 Bacteria 6276
26 Ga0068855_100014820 3300005563 Bacteria 9388
27 Ga0070664_100366624 3300005564 Bacteria 1312
28 Ga0068856_100059095 3300005614 Bacteria 3787
29 Ga0068856_100078436 3300005614 Bacteria 3274
30 Ga0070702_100032304 3300005615 Bacteria 2871
31 Ga0068859_100013272 3300005617 Bacteria 8265
32 Ga0068859_100028595 3300005617 Bacteria 5589
33 Ga0068864_100109738 3300005618 Bacteria 2456
34 Ga0068870_10088672 3300005840 Bacteria 1725
35 Ga0068863_100000496 3300005841 Bacteria 39941
36 Ga0068858_100086316 3300005842 Bacteria 2919
37 Ga0068858_100104606 3300005842 Bacteria 2641
38 Ga0068860_100277985 3300005843 Bacteria 1635
39 Ga0068862_100027176 3300005844 Bacteria 4815
40 Ga0068862_100149141 3300005844 Bacteria 2081
41 Ga0081455_10001039 3300005937 Bacteria 35032
42 Ga0081455_10007057 3300005937 Bacteria 11924
43 Ga0081455_10010526 3300005937 Bacteria 9374
44 Ga0081455_10019609 3300005937 Bacteria 6390
45 Ga0081455_10070785 3300005937 Bacteria 2894
46 Ga0081455_10120076 3300005937 Bacteria 2072
47 Ga0081540_1001394 3300005983 Bacteria 20936
48 Ga0075365_10040331 3300006038 Bacteria 3045
49 Ga0075365_10048531 3300006038 Bacteria 2795
50 Ga0075365_10130257 3300006038 Bacteria 1741
51 Ga0070716_100001757 3300006173 Bacteria 9795
52 Ga0075369_10035046 3300006186 Bacteria 2132
53 Ga0075370_10015466 3300006353 Bacteria 4086
54 Ga0097620_100013272 3300006931 Bacteria 8265
55 Ga0097620_100028595 3300006931 Bacteria 5589
56 Ga0105240_10015550 3300009093 Bacteria 10342
57 Ga0105240_10277990 3300009093 Bacteria 1924
58 Ga0105245_10289439 3300009098 Bacteria 1604
59 Ga0105247_10000046 3300009101 Bacteria 151843
60 Ga0105247_10001542 3300009101 Bacteria 16439
61 Ga0105247_10011635 3300009101 Bacteria 5301
62 Ga0105247_10037551 3300009101 Bacteria 2955
63 Ga0105247_10054211 3300009101 Bacteria 2475
64 Ga0105243_10065858 3300009148 Bacteria 2912
65 Ga0105243_10102534 3300009148 Bacteria 2378
66 Ga0105241_10148371 3300009174 Bacteria 1916
67 Ga0105242_10231994 3300009176 Bacteria 1654
68 Ga0105248_10000153 3300009177 Bacteria 80607
69 Ga0105237_10005091 3300009545 Bacteria 14927
70 Ga0105237_10017843 3300009545 Bacteria 7357
71 Ga0105237_10098309 3300009545 Bacteria 2918
72 Ga0105238_10509453 3300009551 Bacteria 1205
73 Ga0105249_10009825 3300009553 Bacteria 8385
74 Ga0105249_10019476 3300009553 Bacteria 6055
75 Ga0105239_10003727 3300010375 Bacteria 18549
76 Ga0105239_10090112 3300010375 Bacteria 3383
77 Ga0105239_10091477 3300010375 Bacteria 3357
78 Ga0105246_10272037 3300011119 Bacteria 1355
79 Ga0157370_10019589 3300013104 Bacteria 6780
80 Ga0157369_10026195 3300013105 Bacteria 6470
81 Ga0157369_10054587 3300013105 Bacteria 4315
82 Ga0157374_10015545 3300013296 Bacteria 6677
83 Ga0157374_10175376 3300013296 Bacteria 2092
84 Ga0157378_10028101 3300013297 Bacteria 4961
85 Ga0157378_10061131 3300013297 Bacteria 3361
86 Ga0157378_10166330 3300013297 Bacteria 2066
87 Ga0163162_10146794 3300013306 Bacteria 2475
88 Ga0163162_10175860 3300013306 Bacteria 2266
89 Ga0157372_10000022 3300013307 Bacteria 206038
90 Ga0157372_10038611 3300013307 Bacteria 5269
91 Ga0157372_10067771 3300013307 Bacteria 4011
92 Ga0157372_10521137 3300013307 Bacteria 1386
93 Ga0157375_10025245 3300013308 Bacteria 5517
94 Ga0157375_10197092 3300013308 Bacteria 2169
95 Ga0163163_10585351 3300014325 Bacteria 1179
96 Ga0157377_10016380 3300014745 Bacteria 3813
97 Ga0157379_10012655 3300014968 Bacteria 7374
98 Ga0163161_10009471 3300017792 Bacteria 6741
99 Ga0206353_10697503 3300020082 Bacteria 3206
100 Ga0213876_10011043 3300021384 Bacteria 4834
101 Ga0213876_10040612 3300021384 Bacteria 2458
102 Ga0213876_10045291 3300021384 Bacteria 2327
103 Ga0213875_10068507 3300021388 Bacteria 1657
104 Ga0209051_1000750 3300025303 Bacteria 34899
105 Ga0209051_1015414 3300025303 Bacteria 3515
106 Ga0207710_10000071 3300025900 Bacteria 151859
107 Ga0207710_10000146 3300025900 Bacteria 80814
108 Ga0207710_10018522 3300025900 Bacteria 2962
109 Ga0207688_10001523 3300025901 Bacteria 12166
110 Ga0207688_10013099 3300025901 Bacteria 4507
111 Ga0207647_10082486 3300025904 Bacteria 1926
112 Ga0207643_10017425 3300025908 Bacteria 3928
113 Ga0207705_10213847 3300025909 Bacteria 1462
114 Ga0207695_10015740 3300025913 Bacteria 8892
115 Ga0207671_10001867 3300025914 Bacteria 23470
116 Ga0207671_10089187 3300025914 Bacteria 2321
117 Ga0207671_10115070 3300025914 Bacteria 2050
118 Ga0207693_10001955 3300025915 Bacteria 18066
119 Ga0207660_10228173 3300025917 Bacteria 1463
120 Ga0207662_10031703 3300025918 Bacteria 3071
121 Ga0207657_10020351 3300025919 Bacteria 6272
122 Ga0207652_10049228 3300025921 Bacteria 3607
123 Ga0207681_10001078 3300025923 Bacteria 17698
124 Ga0207681_10089982 3300025923 Bacteria 2190
125 Ga0207687_10097393 3300025927 Bacteria 2158
126 Ga0207700_10172219 3300025928 Bacteria 1807
127 Ga0207664_10000032 3300025929 Bacteria 179232
128 Ga0207644_10150709 3300025931 Bacteria 1799
129 Ga0207690_10118831 3300025932 Bacteria 1916
130 Ga0207706_10049286 3300025933 Bacteria 3722
131 Ga0207709_10292143 3300025935 Bacteria 1208
132 Ga0207670_10034836 3300025936 Bacteria 3259
133 Ga0207665_10082155 3300025939 Bacteria 2220
134 Ga0207691_10126170 3300025940 Bacteria 2264
135 Ga0207711_10000923 3300025941 Bacteria 28332
136 Ga0207711_10026191 3300025941 Bacteria 4892
137 Ga0207689_10005173 3300025942 Bacteria 11718
138 Ga0207689_10059598 3300025942 Bacteria 3139
139 Ga0207667_10010916 3300025949 Bacteria 10586
140 Ga0207667_10062852 3300025949 Bacteria 3881
141 Ga0207658_10047160 3300025986 Bacteria 3152
142 Ga0207703_10000036 3300026035 Bacteria 181013
143 Ga0207703_10155119 3300026035 Bacteria 2000
144 Ga0207678_10105598 3300026067 Bacteria 2403
145 Ga0207708_10000009 3300026075 Bacteria 235909
146 Ga0207708_10070871 3300026075 Bacteria 2669
147 Ga0207702_10044172 3300026078 Bacteria 3745
148 Ga0207641_10000643 3300026088 Bacteria 38084
149 Ga0207641_10015657 3300026088 Bacteria 6215
150 Ga0207648_10007446 3300026089 Bacteria 10762
151 Ga0207675_100014457 3300026118 Bacteria 7359
152 Ga0207675_100035394 3300026118 Bacteria 4658
153 Ga0207683_10030206 3300026121 Bacteria 4695
154 Ga0207683_10096459 3300026121 Bacteria 2636
155 Ga0207683_10143995 3300026121 Bacteria 2148
156 Ga0207683_10348914 3300026121 Bacteria 1358
157 Ga0307513_10007060 3300031456 Bacteria 14600
158 Ga0307408_100004469 3300031548 Bacteria 9491
159 Ga0307408_100045079 3300031548 Bacteria 3147
160 Ga0307408_100085007 3300031548 Bacteria 2374
161 Ga0307405_10009647 3300031731 Bacteria 4958
162 Ga0307405_10076439 3300031731 Bacteria 2172
163 Ga0307405_10100384 3300031731 Bacteria 1939
164 Ga0307413_10015892 3300031824 Bacteria 3871
165 Ga0307413_10058990 3300031824 Bacteria 2356
166 Ga0307410_10014348 3300031852 Bacteria 4659
167 Ga0307410_10025366 3300031852 Bacteria 3718
168 Ga0307407_10012791 3300031903 Bacteria 4049
169 Ga0307407_10097615 3300031903 Bacteria 1816
170 Ga0307412_10003312 3300031911 Bacteria 8943
171 Ga0307412_10007510 3300031911 Bacteria 6189
172 Ga0307412_10059334 3300031911 Bacteria 2563
173 Ga0307412_10064354 3300031911 Bacteria 2477
174 Ga0307412_10098234 3300031911 Bacteria 2064
175 Ga0307409_100019236 3300031995 Bacteria 4617
176 Ga0307409_100036618 3300031995 Bacteria 3609
177 Ga0307416_100017671 3300032002 Bacteria 4999
178 Ga0307416_100018984 3300032002 Bacteria 4861
179 Ga0307416_100106291 3300032002 Bacteria 2459
180 Ga0307416_100242790 3300032002 Bacteria 1746
181 Ga0307416_100323845 3300032002 Bacteria 1545
182 Ga0307416_100335500 3300032002 Bacteria 1522
183 Ga0307414_10002589 3300032004 Bacteria 9516
184 Ga0307414_10143092 3300032004 Bacteria 1875
185 Ga0307414_10199019 3300032004 Bacteria 1628
186 Ga0307411_10051359 3300032005 Bacteria 2689
187 Ga0307415_100010874 3300032126 Bacteria 5175
188 Ga0307415_100205420 3300032126 Bacteria 1567
189 Ga0373956_0002130 3300035119 Bacteria 8197
190 Ga0373927_0066879 3300035695 Bacteria 2325
191 Ga0373933_0116376 3300035724 Bacteria 1671
192 Ga0395900_0033940 3300037418 Bacteria 5252
193 Ga0395898_0096954 3300037466 Bacteria 2832
194 Ga0436364_1376393 3300037853 Bacteria 2426
195 Ga0395901_0038530 3300038443 Bacteria 4945
196 Ga0436365_0158682 3300039437 Bacteria 4834
197 Ga0436365_0955489 3300039437 Bacteria 8665
198 Ga0436365_1591167 3300039437 Bacteria 2296
199 Ga0436363_0523583 3300039450 Bacteria 3727
200 Ga0439466_0006026 3300041411 Bacteria 4615
201 Ga0439466_0046258 3300041411 Bacteria 1438
202 Ga0439466_0057108 3300041411 Bacteria 1265
203 Ga0439465_0022912 3300041413 Bacteria 1963
204 Ga0439433_0004524 3300041999 Bacteria 2994
205 Ga0439442_001207 3300042002 Bacteria 5143
206 Ga0439432_006810 3300042006 Bacteria 4069
207 Ga0439449_0002528 3300042007 Bacteria 7148
208 Ga0450920_000171 3300042122 Bacteria 9136
209 Ga0450907_000292 3300042146 Bacteria 16874
210 Ga0439434_0000012 3300042435 Bacteria 46644
211 Ga0466969_0031215 3300044656 Bacteria 2713
212 Ga0466972_0005580 3300044658 Bacteria 6302
213 Ga0466972_0047246 3300044658 Bacteria 2082
214 Ga0466972_0104689 3300044658 Bacteria 1338
215 Ga0466966_0009545 3300044684 Bacteria 6422
216 Ga0466966_0009627 3300044684 Bacteria 6395
217 Ga0466966_0030718 3300044684 Bacteria 3485
218 Ga0466966_0063538 3300044684 Bacteria 2326
219 Ga0466966_0103490 3300044684 Bacteria 1760
220 Ga0466966_0132603 3300044684 Bacteria 1525
221 Ga0466961_0045087 3300044693 Bacteria 2822
222 Ga0466961_0068218 3300044693 Bacteria 2258
223 Ga0466963_0011211 3300044694 Bacteria 5455
224 Ga0466963_0093846 3300044694 Bacteria 2046
225 Ga0466964_0025618 3300044706 Bacteria 2304
226 Ga0466971_0016342 3300044719 Bacteria 3274
227 Ga0466968_0008622 3300044735 Bacteria 3907
228 Ga0466970_0001924 3300044765 Bacteria 10040
229 Ga0466970_0041895 3300044765 Bacteria 2434
230 Ga0466970_0089293 3300044765 Bacteria 1672
231 Ga0466970_0095311 3300044765 Bacteria 1618
232 Ga0466957_0009300 3300044842 Bacteria 5607
233 Ga0466957_0036945 3300044842 Bacteria 2939
234 Ga0466957_0073340 3300044842 Bacteria 2121
235 Ga0466957_0123564 3300044842 Bacteria 1652
236 Ga0466960_0003094 3300044901 Bacteria 6366
237 Ga0466959_0001288 3300045049 Bacteria 15176
238 Ga0466959_0016182 3300045049 Bacteria 5445
239 Ga0466959_0088491 3300045049 Bacteria 2226
240 Ga0466958_0017996 3300045836 Bacteria 4096
241 Ga0466958_0020825 3300045836 Bacteria 3827
242 Ga0466958_0043337 3300045836 Bacteria 2710
243 Ga0466958_0164042 3300045836 Bacteria 1405
244 Ga0466967_0002940 3300045976 Bacteria 10875
245 Ga0466967_0004824 3300045976 Bacteria 9194
246 Ga0466967_0049179 3300045976 Bacteria 3686
247 Ga0466967_0077258 3300045976 Bacteria 2997
248 Ga0495580_0063511 3300046472 Bacteria 2589
249 Ga0495648_0021857 3300046524 Bacteria 4418
250 Ga0495672_0000906 3300047320 Bacteria 31047
251 Ga0495673_0000673 3300047469 Bacteria 33572
252 Ga0496100_0323628 3300048903 Bacteria 1159
253 Ga0496101_0001637 3300048904 Bacteria 13428
254 Ga0496101_0085176 3300048904 Bacteria 2341
255 Ga0496101_0090426 3300048904 Bacteria 2277
256 Ga0496101_0346015 3300048904 Bacteria 1168
257 Ga0496102_0000095 3300048905 Bacteria 124981
258 Ga0496102_0004130 3300048905 Bacteria 12310
259 Ga0496102_0007350 3300048905 Bacteria 9410
260 Ga0496102_0059949 3300048905 Bacteria 3481
261 Ga0496102_0094339 3300048905 Bacteria 2773
262 Ga0496102_0126741 3300048905 Bacteria 2387
263 Ga0496103_0000791 3300048906 Bacteria 23282
264 Ga0496104_0007259 3300048907 Bacteria 9779
265 Ga0496104_0156782 3300048907 Bacteria 2185
266 Ga0496104_0259366 3300048907 Bacteria 1651
267 Ga0496105_0006738 3300048908 Bacteria 8833
268 Ga0496106_0022212 3300048909 Bacteria 4712
269 Ga0496106_0270208 3300048909 Bacteria 1361
270 Ga0496107_0011202 3300048910 Bacteria 6242
271 Ga0496108_0074540 3300048911 Bacteria 2865
272 Ga0496108_0180191 3300048911 Bacteria 1829
273 Ga0496109_0001497 3300048912 Bacteria 19409
274 Ga0496109_0002371 3300048912 Bacteria 15734
275 Ga0496109_0085349 3300048912 Bacteria 2914
276 Ga0496110_0024970 3300048913 Bacteria 5101
277 Ga0496110_0026723 3300048913 Bacteria 4943
278 Ga0496111_0005748 3300048914 Bacteria 8002
279 Ga0496111_0146520 3300048914 Bacteria 1751
280 Ga0496112_0018897 3300048915 Bacteria 6493
281 Ga0496112_0104192 3300048915 Bacteria 2807
282 Ga0496112_0171781 3300048915 Bacteria 2133
283 Ga0496113_0012945 3300048916 Bacteria 5627
284 Ga0496113_0014882 3300048916 Bacteria 5324
285 Ga0496113_0086917 3300048916 Bacteria 2403
286 Ga0496114_0030061 3300048917 Bacteria 4467
287 Ga0496114_0276281 3300048917 Bacteria 1481
288 Ga0496115_0079353 3300048918 Bacteria 2671
289 Ga0496116_0022879 3300048919 Bacteria 4667
290 Ga0496117_0051528 3300048920 Bacteria 2909
291 Ga0496118_0003906 3300048921 Bacteria 18249
292 Ga0496118_0005741 3300048921 Bacteria 13957
293 Ga0496118_0039324 3300048921 Bacteria 3776
294 Ga0496118_0050519 3300048921 Bacteria 3190
295 Ga0496119_0013252 3300048922 Bacteria 6590
296 Ga0496119_0056578 3300048922 Bacteria 2376
297 Ga0496119_0060896 3300048922 Bacteria 2257
298 Ga0496121_0001856 3300048924 Bacteria 33927
299 Ga0496121_0079390 3300048924 Bacteria 2605
300 Ga0496121_0104246 3300048924 Bacteria 2180
301 Ga0496125_0101016 3300048928 Bacteria 2124
302 Ga0496126_0001953 3300048929 Bacteria 29245
303 Ga0496126_0039384 3300048929 Bacteria 4386
304 Ga0501032_0003545 3300049569 Bacteria 11908
305 Ga0501032_0004891 3300049569 Bacteria 10028
306 Ga0501033_0022458 3300049570 Bacteria 4760
307 Ga0501033_0023472 3300049570 Bacteria 4651
308 Ga0501033_0153896 3300049570 Bacteria 1658
309 Ga0501036_0097415 3300049572 Bacteria 2486
310 Ga0501037_0110790 3300049573 Bacteria 1977
311 Ga0501039_0026392 3300049575 Bacteria 4463
312 Ga0501042_0013637 3300049578 Bacteria 5534
313 Ga0501047_0008431 3300049581 Bacteria 9724
314 Ga0501048_0000264 3300049582 Bacteria 35134
315 Ga0501073_0138539 3300049589 Bacteria 1686
316 Ga0501075_0138928 3300049591 Bacteria 1851
317 Ga0501083_0000003 3300049744 Bacteria 235949
318 Ga0501035_0004704 3300049822 Bacteria 12963
319 Ga0501035_0047716 3300049822 Bacteria 3843
320 Ga0501044_0065163 3300049823 Bacteria 3716
321 nmdc:mga00v17_22869_c1 3300050491 Bacteria 3612
322 nmdc:mga0yw44_26285_c1 3300050492 Bacteria 3323
323 nmdc:mga0yw44_83561_c1 3300050492 Bacteria 2006
324 nmdc:mga06z11_67886_c1 3300050494 Bacteria 1878
325 nmdc:mga07m45_8741_c1 3300050496 Bacteria 5220
326 nmdc:mga0qj67_106534_c1 3300050509 Bacteria 2261
327 nmdc:mga06r32_340793_c1 3300050510 Bacteria 1484
328 Ga0500610_0095995 3300053079 Bacteria 1537
329 Ga0500643_005275 3300053087 Bacteria 5607
330 Ga0500643_020112 3300053087 Bacteria 2188
331 Ga0500642_0053039 3300053130 Bacteria 1797
332 Ga0500652_000651 3300053131 Bacteria 11825
333 Ga0500645_000004 3300053730 Bacteria 305014
334 Ga0466962_0024611 3300061719 Bacteria 2891

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026121 Ga0207683_10143995 Ga0207683_101439951 296
2 3300048904 Ga0496101_0001637 Ga0496101_0001637_9556_10467 301
3 3300049578 Ga0501042_0013637 Ga0501042_0013637_2687_3667 313
4 3300049744 Ga0501083_0000003 Ga0501083_0000003_225025_226008 314
5 3300013105 Ga0157369_10026195 Ga0157369_100261955 318
6 3300037418 Ga0395900_0033940 Ga0395900_0033940_441_1529 319
7 3300032002 Ga0307416_100335500 Ga0307416_1003355001 326
8 3300049569 Ga0501032_0003545 Ga0501032_0003545_7981_9033 326
9 3300049575 Ga0501039_0026392 Ga0501039_0026392_641_1693 326
10 3300042002 Ga0439442_001207 Ga0439442_001207_310_1365 327
11 3300049573 Ga0501037_0110790 Ga0501037_0110790_900_1955 327
12 3300044656 Ga0466969_0031215 Ga0466969_0031215_60_1124 332
13 3300044735 Ga0466968_0008622 Ga0466968_0008622_1138_2202 332
14 3300044765 Ga0466970_0041895 Ga0466970_0041895_1241_2305 332
15 3300044842 Ga0466957_0073340 Ga0466957_0073340_543_1595 332
16 3300045049 Ga0466959_0001288 Ga0466959_0001288_8587_9651 332
17 3300045836 Ga0466958_0043337 Ga0466958_0043337_1083_2147 332
18 3300032004 Ga0307414_10143092 Ga0307414_101430922 333
19 3300039437 Ga0436365_1591167 Ga0436365_1591167_894_1967 333
20 3300044658 Ga0466972_0104689 Ga0466972_0104689_86_1162 333
21 3300044684 Ga0466966_0009627 Ga0466966_0009627_3623_4687 333
22 3300048917 Ga0496114_0276281 Ga0496114_0276281_231_1301 333
23 3300049570 Ga0501033_0023472 Ga0501033_0023472_1400_2476 333
24 3300061719 Ga0466962_0024611 Ga0466962_0024611_1198_2274 333
25 3300005467 Ga0070706_100082344 Ga0070706_1000823442 334
26 3300041411 Ga0439466_0057108 Ga0439466_0057108_63_1151 334
27 3300041999 Ga0439433_0004524 Ga0439433_0004524_931_2019 334
28 3300037466 Ga0395898_0096954 Ga0395898_0096954_143_1231 335
29 3300038443 Ga0395901_0038530 Ga0395901_0038530_2679_3767 335
30 3300044719 Ga0466971_0016342 Ga0466971_0016342_209_1246 335
31 3300045836 Ga0466958_0017996 Ga0466958_0017996_1521_2558 335
32 3300048905 Ga0496102_0007350 Ga0496102_0007350_1347_2384 336
33 3300048921 Ga0496118_0003906 Ga0496118_0003906_6058_7095 336
34 3300049591 Ga0501075_0138928 Ga0501075_0138928_203_1252 336
35 3300005435 Ga0070714_100000006 Ga0070714_100000006170 339
36 3300025929 Ga0207664_10000032 Ga0207664_1000003265 339
37 3300053131 Ga0500652_000651 Ga0500652_000651_188_1264 339
38 iso_pu_bacteria 2643221687 2644488453 339
39 3300031548 Ga0307408_100085007 Ga0307408_1000850072 340
40 iso_pu_bacteria 2808606447 2809226652 341
41 iso_pu_bacteria 2852632344 2852632861 341
42 3300003792 Ga0055540_1004054 Ga0055540_10040543 342
43 3300005367 Ga0070667_100299550 Ga0070667_1002995501 342
44 3300025303 Ga0209051_1015414 Ga0209051_10154143 342
45 3300005937 Ga0081455_10001039 Ga0081455_1000103922 343
46 3300005983 Ga0081540_1001394 Ga0081540_100139416 343
47 3300006353 Ga0075370_10015466 Ga0075370_100154664 343
48 3300009545 Ga0105237_10005091 Ga0105237_1000509113 343
49 3300010375 Ga0105239_10003727 Ga0105239_100037274 343
50 3300013296 Ga0157374_10175376 Ga0157374_101753763 343
51 3300025939 Ga0207665_10082155 Ga0207665_100821552 343
52 3300031548 Ga0307408_100004469 Ga0307408_1000044693 343
53 3300031731 Ga0307405_10100384 Ga0307405_101003841 343
54 3300031852 Ga0307410_10014348 Ga0307410_100143482 343
55 3300031903 Ga0307407_10097615 Ga0307407_100976151 343
56 3300031911 Ga0307412_10064354 Ga0307412_100643542 343
57 3300032002 Ga0307416_100017671 Ga0307416_1000176712 343
58 3300032004 Ga0307414_10199019 Ga0307414_101990191 343
59 3300039437 Ga0436365_0158682 Ga0436365_0158682_3628_4665 343
60 3300041411 Ga0439466_0006026 Ga0439466_0006026_2292_3338 343
61 3300044842 Ga0466957_0123564 Ga0466957_0123564_572_1612 343
62 3300046472 Ga0495580_0063511 Ga0495580_0063511_136_1179 343
63 3300048903 Ga0496100_0323628 Ga0496100_0323628_102_1145 343
64 3300048905 Ga0496102_0059949 Ga0496102_0059949_1044_2087 343
65 3300048905 Ga0496102_0126741 Ga0496102_0126741_1028_2074 343
66 3300048915 Ga0496112_0104192 Ga0496112_0104192_72_1115 343
67 3300048922 Ga0496119_0060896 Ga0496119_0060896_754_1800 343
68 3300050494 nmdc:mga06z11_67886_c1 nmdc:mga06z11_67886_c1_204_1244 343
69 3300050496 nmdc:mga07m45_8741_c1 nmdc:mga07m45_8741_c1_3089_4129 343
70 3300050509 nmdc:mga0qj67_106534_c1 nmdc:mga0qj67_106534_c1_91_1137 343
71 3300050510 nmdc:mga06r32_340793_c1 nmdc:mga06r32_340793_c1_14_1060 343
72 iso_pu_bacteria 2795385470 2795783012 343
73 3300044765 Ga0466970_0095311 Ga0466970_0095311_179_1264 344
74 iso_pu_bacteria 2808606371 2808898583 344
75 3300006038 Ga0075365_10130257 Ga0075365_101302572 345
76 3300026121 Ga0207683_10348914 Ga0207683_103489142 345
77 3300048914 Ga0496111_0005748 Ga0496111_0005748_2553_3626 345
78 iso_pu_bacteria 2775506735 2775657151 345
79 iso_pu_bacteria 2808606360 2808850327 345
80 3300010375 Ga0105239_10090112 Ga0105239_100901122 346
81 3300020082 Ga0206353_10697503 Ga0206353_106975034 346
82 3300025914 Ga0207671_10089187 Ga0207671_100891872 346
83 3300025949 Ga0207667_10062852 Ga0207667_100628523 346
84 3300005334 Ga0068869_100146229 Ga0068869_1001462292 347
85 3300005338 Ga0068868_100100344 Ga0068868_1001003443 347
86 3300005344 Ga0070661_100090697 Ga0070661_1000906972 347
87 3300005355 Ga0070671_100115702 Ga0070671_1001157022 347
88 3300005356 Ga0070674_100033480 Ga0070674_1000334802 347
89 3300005366 Ga0070659_100186765 Ga0070659_1001867652 347
90 3300005535 Ga0070684_100120063 Ga0070684_1001200632 347
91 3300005543 Ga0070672_100178944 Ga0070672_1001789442 347
92 3300005564 Ga0070664_100366624 Ga0070664_1003666241 347
93 3300005615 Ga0070702_100032304 Ga0070702_1000323044 347
94 3300005618 Ga0068864_100109738 Ga0068864_1001097382 347
95 3300005844 Ga0068862_100149141 Ga0068862_1001491413 347
96 3300009553 Ga0105249_10019476 Ga0105249_100194764 347
97 3300021384 Ga0213876_10011043 Ga0213876_100110431 347
98 3300025901 Ga0207688_10013099 Ga0207688_100130992 347
99 3300025908 Ga0207643_10017425 Ga0207643_100174254 347
100 3300025918 Ga0207662_10031703 Ga0207662_100317034 347
101 3300025919 Ga0207657_10020351 Ga0207657_100203516 347
102 3300025923 Ga0207681_10089982 Ga0207681_100899822 347
103 3300025931 Ga0207644_10150709 Ga0207644_101507092 347
104 3300025932 Ga0207690_10118831 Ga0207690_101188312 347
105 3300025936 Ga0207670_10034836 Ga0207670_100348364 347
106 3300025940 Ga0207691_10126170 Ga0207691_101261702 347
107 3300025941 Ga0207711_10000923 Ga0207711_1000092325 347
108 3300025942 Ga0207689_10059598 Ga0207689_100595982 347
109 3300025986 Ga0207658_10047160 Ga0207658_100471602 347
110 3300026088 Ga0207641_10015657 Ga0207641_100156572 347
111 3300026118 Ga0207675_100035394 Ga0207675_1000353943 347
112 3300026121 Ga0207683_10096459 Ga0207683_100964592 347
113 3300048914 Ga0496111_0146520 Ga0496111_0146520_110_1168 347
114 3300048915 Ga0496112_0018897 Ga0496112_0018897_2075_3133 347
115 3300005343 Ga0070687_100027208 Ga0070687_1000272084 348
116 3300005364 Ga0070673_100081387 Ga0070673_1000813873 348
117 3300005438 Ga0070701_10166004 Ga0070701_101660042 348
118 3300005548 Ga0070665_100022993 Ga0070665_1000229935 348
119 3300005617 Ga0068859_100028595 Ga0068859_1000285952 348
120 3300005937 Ga0081455_10120076 Ga0081455_101200762 348
121 3300006931 Ga0097620_100028595 Ga0097620_1000285956 348
122 3300009553 Ga0105249_10009825 Ga0105249_100098257 348
123 3300010375 Ga0105239_10091477 Ga0105239_100914774 348
124 3300013297 Ga0157378_10061131 Ga0157378_100611314 348
125 3300013307 Ga0157372_10038611 Ga0157372_100386113 348
126 3300013308 Ga0157375_10025245 Ga0157375_100252454 348
127 3300017792 Ga0163161_10009471 Ga0163161_100094717 348
128 3300025915 Ga0207693_10001955 Ga0207693_1000195520 348
129 3300025917 Ga0207660_10228173 Ga0207660_102281731 348
130 3300025933 Ga0207706_10049286 Ga0207706_100492863 348
131 3300044658 Ga0466972_0005580 Ga0466972_0005580_322_1371 348
132 iso_pu_bacteria 2517572101 2517763826 348
133 3300005614 Ga0068856_100059095 Ga0068856_1000590953 349
134 3300005937 Ga0081455_10010526 Ga0081455_100105262 349
135 3300005937 Ga0081455_10070785 Ga0081455_100707854 349
136 3300006038 Ga0075365_10048531 Ga0075365_100485312 349
137 3300009545 Ga0105237_10017843 Ga0105237_100178434 349
138 3300013306 Ga0163162_10175860 Ga0163162_101758603 349
139 3300021384 Ga0213876_10040612 Ga0213876_100406122 349
140 3300021388 Ga0213875_10068507 Ga0213875_100685072 349
141 3300025914 Ga0207671_10115070 Ga0207671_101150702 349
142 3300025935 Ga0207709_10292143 Ga0207709_102921431 349
143 3300026078 Ga0207702_10044172 Ga0207702_100441722 349
144 3300031548 Ga0307408_100045079 Ga0307408_1000450792 349
145 3300031731 Ga0307405_10009647 Ga0307405_100096472 349
146 3300031731 Ga0307405_10076439 Ga0307405_100764392 349
147 3300031824 Ga0307413_10058990 Ga0307413_100589902 349
148 3300031911 Ga0307412_10003312 Ga0307412_100033124 349
149 3300031911 Ga0307412_10059334 Ga0307412_100593342 349
150 3300031911 Ga0307412_10098234 Ga0307412_100982342 349
151 3300031995 Ga0307409_100036618 Ga0307409_1000366182 349
152 3300032002 Ga0307416_100106291 Ga0307416_1001062912 349
153 3300032002 Ga0307416_100323845 Ga0307416_1003238451 349
154 3300032126 Ga0307415_100205420 Ga0307415_1002054202 349
155 3300039450 Ga0436363_0523583 Ga0436363_0523583_1202_2257 349
156 3300044684 Ga0466966_0063538 Ga0466966_0063538_853_1923 349
157 3300044842 Ga0466957_0009300 Ga0466957_0009300_3155_4225 349
158 3300044842 Ga0466957_0036945 Ga0466957_0036945_136_1200 349
159 3300045049 Ga0466959_0088491 Ga0466959_0088491_1123_2178 349
160 3300045836 Ga0466958_0020825 Ga0466958_0020825_2668_3738 349
161 3300050492 nmdc:mga0yw44_26285_c1 nmdc:mga0yw44_26285_c1_128_1192 349
162 iso_pu_bacteria 2902792274 2902795374 349
163 iso_pu_bacteria 2902799365 2902800308 349
164 iso_pu_bacteria 2929212328 2929218337 349
165 3300044765 Ga0466970_0089293 Ga0466970_0089293_95_1210 350
166 iso_pu_bacteria 2738541274 2738703307 350
167 iso_pu_bacteria 2738543028 2739329232 350
168 3300005563 Ga0068855_100014820 Ga0068855_1000148204 351
169 3300005614 Ga0068856_100078436 Ga0068856_1000784362 351
170 3300005937 Ga0081455_10007057 Ga0081455_100070573 351
171 3300009093 Ga0105240_10277990 Ga0105240_102779901 351
172 3300009545 Ga0105237_10098309 Ga0105237_100983092 351
173 3300025928 Ga0207700_10172219 Ga0207700_101722192 351
174 3300025949 Ga0207667_10010916 Ga0207667_100109167 351
175 3300035724 Ga0373933_0116376 Ga0373933_0116376_448_1530 351
176 3300044684 Ga0466966_0103490 Ga0466966_0103490_140_1228 351
177 3300048929 Ga0496126_0039384 Ga0496126_0039384_362_1441 351
178 3300002067 JGI24735J21928_10009706 JGI24735J21928_100097062 352
179 3300005367 Ga0070667_100096300 Ga0070667_1000963002 352
180 3300005937 Ga0081455_10019609 Ga0081455_100196092 352
181 3300009098 Ga0105245_10289439 Ga0105245_102894392 352
182 3300009101 Ga0105247_10037551 Ga0105247_100375512 352
183 3300009101 Ga0105247_10054211 Ga0105247_100542111 352
184 3300009148 Ga0105243_10102534 Ga0105243_101025342 352
185 3300009174 Ga0105241_10148371 Ga0105241_101483712 352
186 3300009176 Ga0105242_10231994 Ga0105242_102319941 352
187 3300009177 Ga0105248_10000153 Ga0105248_100001538 352
188 3300009551 Ga0105238_10509453 Ga0105238_105094531 352
189 3300013297 Ga0157378_10166330 Ga0157378_101663302 352
190 3300013306 Ga0163162_10146794 Ga0163162_101467943 352
191 3300013307 Ga0157372_10067771 Ga0157372_100677715 352
192 3300013307 Ga0157372_10521137 Ga0157372_105211371 352
193 3300025909 Ga0207705_10213847 Ga0207705_102138472 352
194 3300025921 Ga0207652_10049228 Ga0207652_100492282 352
195 3300031456 Ga0307513_10007060 Ga0307513_100070606 352
196 3300035119 Ga0373956_0002130 Ga0373956_0002130_3211_4293 352
197 3300048907 Ga0496104_0156782 Ga0496104_0156782_278_1345 352
198 3300048912 Ga0496109_0085349 Ga0496109_0085349_888_1961 352
199 3300048921 Ga0496118_0005741 Ga0496118_0005741_4051_5133 352
200 3300005337 Ga0070682_100032737 Ga0070682_1000327371 353
201 3300005365 Ga0070688_100091048 Ga0070688_1000910483 353
202 3300005367 Ga0070667_100031980 Ga0070667_1000319804 353
203 3300005455 Ga0070663_100042515 Ga0070663_1000425153 353
204 3300005456 Ga0070678_100016504 Ga0070678_1000165043 353
205 3300005840 Ga0068870_10088672 Ga0068870_100886723 353
206 3300005842 Ga0068858_100104606 Ga0068858_1001046063 353
207 3300005843 Ga0068860_100277985 Ga0068860_1002779852 353
208 3300005844 Ga0068862_100027176 Ga0068862_1000271766 353
209 3300006186 Ga0075369_10035046 Ga0075369_100350463 353
210 3300009093 Ga0105240_10015550 Ga0105240_100155506 353
211 3300009148 Ga0105243_10065858 Ga0105243_100658582 353
212 3300011119 Ga0105246_10272037 Ga0105246_102720372 353
213 3300013104 Ga0157370_10019589 Ga0157370_100195892 353
214 3300013296 Ga0157374_10015545 Ga0157374_100155453 353
215 3300013297 Ga0157378_10028101 Ga0157378_100281015 353
216 3300013307 Ga0157372_10000022 Ga0157372_1000002299 353
217 3300013308 Ga0157375_10197092 Ga0157375_101970923 353
218 3300014745 Ga0157377_10016380 Ga0157377_100163804 353
219 3300025900 Ga0207710_10018522 Ga0207710_100185222 353
220 3300025901 Ga0207688_10001523 Ga0207688_100015236 353
221 3300025913 Ga0207695_10015740 Ga0207695_100157403 353
222 3300025914 Ga0207671_10001867 Ga0207671_1000186723 353
223 3300025927 Ga0207687_10097393 Ga0207687_100973932 353
224 3300025942 Ga0207689_10005173 Ga0207689_100051737 353
225 3300026067 Ga0207678_10105598 Ga0207678_101055983 353
226 3300026075 Ga0207708_10070871 Ga0207708_100708713 353
227 3300026089 Ga0207648_10007446 Ga0207648_100074466 353
228 3300026118 Ga0207675_100014457 Ga0207675_1000144576 353
229 3300026121 Ga0207683_10030206 Ga0207683_100302065 353
230 3300031824 Ga0307413_10015892 Ga0307413_100158923 353
231 3300044684 Ga0466966_0009545 Ga0466966_0009545_2238_3302 353
232 3300044693 Ga0466961_0045087 Ga0466961_0045087_567_1631 353
233 3300048904 Ga0496101_0090426 Ga0496101_0090426_960_2024 353
234 3300048911 Ga0496108_0074540 Ga0496108_0074540_442_1506 353
235 3300048912 Ga0496109_0002371 Ga0496109_0002371_6029_7093 353
236 3300048915 Ga0496112_0171781 Ga0496112_0171781_455_1519 353
237 3300048916 Ga0496113_0012945 Ga0496113_0012945_4514_5578 353
238 3300048916 Ga0496113_0014882 Ga0496113_0014882_1099_2166 353
239 3300049589 Ga0501073_0138539 Ga0501073_0138539_602_1675 353
240 3300053730 Ga0500645_000004 Ga0500645_000004_291747_292811 353
241 iso_pu_bacteria 2808606357 2808829102 353
242 iso_pu_bacteria 2811994871 2812319153 353
243 iso_pu_bacteria 2953998280 2954002672 353
244 3300005441 Ga0070700_100000011 Ga0070700_10000001162 354
245 3300005617 Ga0068859_100013272 Ga0068859_1000132726 354
246 3300005841 Ga0068863_100000496 Ga0068863_10000049617 354
247 3300005842 Ga0068858_100086316 Ga0068858_1000863164 354
248 3300006038 Ga0075365_10040331 Ga0075365_100403313 354
249 3300006173 Ga0070716_100001757 Ga0070716_1000017572 354
250 3300006931 Ga0097620_100013272 Ga0097620_1000132723 354
251 3300009101 Ga0105247_10000046 Ga0105247_1000004681 354
252 3300009101 Ga0105247_10001542 Ga0105247_100015426 354
253 3300009101 Ga0105247_10011635 Ga0105247_100116353 354
254 3300013105 Ga0157369_10054587 Ga0157369_100545875 354
255 3300014325 Ga0163163_10585351 Ga0163163_105853512 354
256 3300014968 Ga0157379_10012655 Ga0157379_100126552 354
257 3300021384 Ga0213876_10045291 Ga0213876_100452912 354
258 3300025303 Ga0209051_1000750 Ga0209051_10007503 354
259 3300025900 Ga0207710_10000071 Ga0207710_1000007180 354
260 3300025900 Ga0207710_10000146 Ga0207710_1000014627 354
261 3300025923 Ga0207681_10001078 Ga0207681_100010782 354
262 3300025941 Ga0207711_10026191 Ga0207711_100261912 354
263 3300026035 Ga0207703_10000036 Ga0207703_1000003655 354
264 3300026035 Ga0207703_10155119 Ga0207703_101551192 354
265 3300026075 Ga0207708_10000009 Ga0207708_10000009211 354
266 3300026088 Ga0207641_10000643 Ga0207641_1000064325 354
267 3300031852 Ga0307410_10025366 Ga0307410_100253662 354
268 3300031903 Ga0307407_10012791 Ga0307407_100127911 354
269 3300031911 Ga0307412_10007510 Ga0307412_100075105 354
270 3300031995 Ga0307409_100019236 Ga0307409_1000192362 354
271 3300032002 Ga0307416_100018984 Ga0307416_1000189843 354
272 3300032002 Ga0307416_100242790 Ga0307416_1002427902 354
273 3300032004 Ga0307414_10002589 Ga0307414_100025892 354
274 3300032005 Ga0307411_10051359 Ga0307411_100513592 354
275 3300032126 Ga0307415_100010874 Ga0307415_1000108741 354
276 3300037853 Ga0436364_1376393 Ga0436364_1376393_826_1899 354
277 3300039437 Ga0436365_0955489 Ga0436365_0955489_2857_3930 354
278 3300041411 Ga0439466_0046258 Ga0439466_0046258_64_1143 354
279 3300041413 Ga0439465_0022912 Ga0439465_0022912_216_1295 354
280 3300042006 Ga0439432_006810 Ga0439432_006810_265_1353 354
281 3300042007 Ga0439449_0002528 Ga0439449_0002528_1428_2516 354
282 3300042122 Ga0450920_000171 Ga0450920_000171_6399_7487 354
283 3300042146 Ga0450907_000292 Ga0450907_000292_1650_2738 354
284 3300042435 Ga0439434_0000012 Ga0439434_0000012_20921_22009 354
285 3300044658 Ga0466972_0047246 Ga0466972_0047246_255_1331 354
286 3300044693 Ga0466961_0068218 Ga0466961_0068218_650_1726 354
287 3300044694 Ga0466963_0011211 Ga0466963_0011211_3295_4374 354
288 3300044694 Ga0466963_0093846 Ga0466963_0093846_210_1280 354
289 3300044901 Ga0466960_0003094 Ga0466960_0003094_4926_6005 354
290 3300045836 Ga0466958_0164042 Ga0466958_0164042_32_1111 354
291 3300045976 Ga0466967_0002940 Ga0466967_0002940_9629_10708 354
292 3300045976 Ga0466967_0077258 Ga0466967_0077258_89_1168 354
293 3300046524 Ga0495648_0021857 Ga0495648_0021857_2019_3098 354
294 3300047320 Ga0495672_0000906 Ga0495672_0000906_8914_9993 354
295 3300047469 Ga0495673_0000673 Ga0495673_0000673_1740_2819 354
296 3300048904 Ga0496101_0085176 Ga0496101_0085176_170_1246 354
297 3300048904 Ga0496101_0346015 Ga0496101_0346015_82_1149 354
298 3300048905 Ga0496102_0000095 Ga0496102_0000095_58607_59674 354
299 3300048905 Ga0496102_0094339 Ga0496102_0094339_1686_2762 354
300 3300048906 Ga0496103_0000791 Ga0496103_0000791_9867_10934 354
301 3300048907 Ga0496104_0007259 Ga0496104_0007259_5104_6180 354
302 3300048907 Ga0496104_0259366 Ga0496104_0259366_404_1471 354
303 3300048908 Ga0496105_0006738 Ga0496105_0006738_4244_5320 354
304 3300048909 Ga0496106_0022212 Ga0496106_0022212_3502_4578 354
305 3300048909 Ga0496106_0270208 Ga0496106_0270208_255_1340 354
306 3300048910 Ga0496107_0011202 Ga0496107_0011202_3780_4856 354
307 3300048911 Ga0496108_0180191 Ga0496108_0180191_220_1287 354
308 3300048912 Ga0496109_0001497 Ga0496109_0001497_17789_18856 354
309 3300048913 Ga0496110_0024970 Ga0496110_0024970_3525_4592 354
310 3300048913 Ga0496110_0026723 Ga0496110_0026723_873_1943 354
311 3300048916 Ga0496113_0086917 Ga0496113_0086917_1199_2266 354
312 3300048917 Ga0496114_0030061 Ga0496114_0030061_195_1271 354
313 3300048918 Ga0496115_0079353 Ga0496115_0079353_270_1346 354
314 3300048919 Ga0496116_0022879 Ga0496116_0022879_534_1610 354
315 3300048920 Ga0496117_0051528 Ga0496117_0051528_483_1550 354
316 3300048921 Ga0496118_0039324 Ga0496118_0039324_455_1531 354
317 3300048921 Ga0496118_0050519 Ga0496118_0050519_515_1582 354
318 3300048922 Ga0496119_0013252 Ga0496119_0013252_240_1325 354
319 3300048922 Ga0496119_0056578 Ga0496119_0056578_1253_2329 354
320 3300048924 Ga0496121_0001856 Ga0496121_0001856_29057_30133 354
321 3300048924 Ga0496121_0079390 Ga0496121_0079390_927_2012 354
322 3300048924 Ga0496121_0104246 Ga0496121_0104246_37_1107 354
323 3300048928 Ga0496125_0101016 Ga0496125_0101016_616_1692 354
324 3300048929 Ga0496126_0001953 Ga0496126_0001953_623_1699 354
325 3300049569 Ga0501032_0004891 Ga0501032_0004891_2072_3172 354
326 3300049570 Ga0501033_0022458 Ga0501033_0022458_3334_4434 354
327 3300049570 Ga0501033_0153896 Ga0501033_0153896_230_1324 354
328 3300049572 Ga0501036_0097415 Ga0501036_0097415_861_1961 354
329 3300049581 Ga0501047_0008431 Ga0501047_0008431_8058_9158 354
330 3300049582 Ga0501048_0000264 Ga0501048_0000264_20801_21901 354
331 3300049822 Ga0501035_0004704 Ga0501035_0004704_9249_10349 354
332 3300049822 Ga0501035_0047716 Ga0501035_0047716_1147_2253 354
333 3300049823 Ga0501044_0065163 Ga0501044_0065163_2255_3355 354
334 3300050491 nmdc:mga00v17_22869_c1 nmdc:mga00v17_22869_c1_1067_2155 354
335 3300050492 nmdc:mga0yw44_83561_c1 nmdc:mga0yw44_83561_c1_588_1658 354
336 3300053087 Ga0500643_005275 Ga0500643_005275_48_1127 354
337 3300053087 Ga0500643_020112 Ga0500643_020112_728_1798 354
338 3300053130 Ga0500642_0053039 Ga0500642_0053039_380_1450 354
339 3300044684 Ga0466966_0132603 Ga0466966_0132603_215_1288 356
340 3300044765 Ga0466970_0001924 Ga0466970_0001924_1886_2959 356
341 3300045049 Ga0466959_0016182 Ga0466959_0016182_2788_3861 356
342 3300048905 Ga0496102_0004130 Ga0496102_0004130_7266_8339 356
343 iso_pu_bacteria 2939582691 2939583826 356
344 3300044706 Ga0466964_0025618 Ga0466964_0025618_527_1603 357
345 3300045976 Ga0466967_0004824 Ga0466967_0004824_5661_6737 357
346 3300045976 Ga0466967_0049179 Ga0466967_0049179_333_1409 357
347 3300053079 Ga0500610_0095995 Ga0500610_0095995_414_1520 359
348 3300044684 Ga0466966_0030718 Ga0466966_0030718_1783_2934 365
349 3300001990 JGI24737J22298_10019315 JGI24737J22298_100193152 367
350 3300025904 Ga0207647_10082486 Ga0207647_100824861 367
351 3300035695 Ga0373927_0066879 Ga0373927_0066879_249_1427 367

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01068

DNA_ligase_A_M

ATP dependent DNA ligase domain

24

210

0.95

PF04679

DNA_ligase_A_C

ATP dependent DNA ligase C terminal region

228

340

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
7rpw-assembly1.cif.gz_E archaeal dna ligase and heterotrimeric pcna in complex with adenylated dna 0.7927 4 211
6p0d-assembly1.cif.gz_A human dna ligase 1 (e346a/e592a) bound to an adenylated, hydroxyl terminated dna nick 0.763 21 346
6p0a-assembly1.cif.gz_A human dna ligase 1 bound to an adenylated, dideoxy terminated dna nick with 2 mm mg2+ 0.7621 21 346
7sx5-assembly1.cif.gz_A crystal structure of ligase i with nick duplexes containing mismatch a:c 0.7614 21 346
6gdr-assembly1.cif.gz_A dna binding with a minimal scaffold: structure-function analysis of lig e dna ligases 0.7581 23 337
ID Description Score Start End Superfamily
af_L0TDE1_8_201_3.30.470.30 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;DNA ligase/mRNA capping enzyme 0.9882 21 210 3.30.470.30
af_L0TDE1_8_201_3.30.470.30 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;DNA ligase/mRNA capping enzyme 0.963 21 210 3.30.470.30
af_L0TDE1_203_339_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9126 213 347 2.40.50.140
af_P9WNV5_183_380_3.30.470.30 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;DNA ligase/mRNA capping enzyme 0.9007 21 210 3.30.470.30
4eq5A02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;DNA ligase/mRNA capping enzyme 0.8982 21 209 3.30.470.30
ID Description Score Start End GO Terms
AF-A0A7Y5P5M4-F1-model_v4 deleted 0.9872 14 201
AF-A0A7Y5P5M4-F1-model_v4 deleted 0.982 14 201
AF-A0A2V8CDT1-F1-model_v4 ATP-dependent DNA ligase 0.9718 13 171 GO:0003910
GO:0005524
GO:0006281
GO:0006310
AF-A0A351EUR7-F1-model_v4 ATP-dependent DNA ligase 0.9712 25 136 GO:0003910
GO:0005524
GO:0006281
GO:0006310
AF-A0A534R9J8-F1-model_v4 ATP-dependent DNA ligase 0.9706 40 156 GO:0003910
GO:0005524
GO:0006281
GO:0006310

Feature Viewer

pLDDT pTM Quality
86.75 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map