F418392
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 350 | 218 | 700 | 325 |
Family's Representative Sequence
| Representative Sequence | 3300048924|Ga0496121_0004284|Ga0496121_0004284_5578_6669 |
| Length | 363 |
| Sequence | MADNGTASAVGAESRASIGAATAAACSGSQPDLEAIQRAAARIQGHVVKTPLLRSAELDALAGGRVFLKAESLQRSGSFKFRGACNRILGLSQAERARGVVAYSSGNHALAVSEAGRLLDVPVAVVMPADAPAIKIQGCRARGATVLLYDRERDDREAIGQRMVEDQGMTLVPPFDDAQVMAGAGTGALEALEQMRGRAVDTALLCCSGGGLAAGWAIALRAAWPRVHIVVVEPEGFDDTGRSLRAGLPQHNARRSGSIQDALLAPMPGRLTLPVLREHAATGVAVSDDETLAAMAFAFSSLKLVLEPGGAAALAAVLAHKVVLAGRSTLVVCSGGNVDPELFVRSLQRGSASQAAAPAGVRP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 2 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 3 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 17 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 20 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 22 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 24 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 25 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 26 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 27 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 29 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 30 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 32 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 33 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 34 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 47 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 49 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 50 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 52 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 53 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 54 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 55 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 75 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 78 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 79 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 80 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 81 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 82 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 83 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 84 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 85 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 86 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 87 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 88 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 89 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 90 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 91 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 92 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 93 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 94 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 95 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 96 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 97 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 98 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 99 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 100 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 101 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 102 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 103 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 104 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 105 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 106 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 107 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 108 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 109 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 110 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 111 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 112 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 113 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 114 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 115 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 116 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 117 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 133 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 134 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 135 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 136 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 137 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 138 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 139 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 140 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 141 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 142 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 143 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 144 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 145 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 146 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 147 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 148 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 149 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 150 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 151 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 152 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 153 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 154 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 155 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 157 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 158 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 159 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 160 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 161 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 162 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 163 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 164 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 165 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 166 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 167 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 168 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 169 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 170 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 171 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 172 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 173 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 174 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 175 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 176 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 177 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 178 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 179 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 180 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 181 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 182 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 183 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 184 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 185 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 186 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 187 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 188 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 189 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 190 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 191 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 192 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 194 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 195 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 196 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 197 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 198 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 199 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 200 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 201 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 202 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 203 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 204 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 205 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 206 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 207 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 208 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 209 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 210 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 211 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 212 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 213 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 214 | 2852649853 | Stenotrophomonas sp. JAI102 | Isolate | Rhizosphere |
| 215 | 2881714928 | Pseudidiomarina mangrovi ZQ330 | Isolate | Rhizosphere |
| 216 | 2923516293 | Pseudoxanthomonas mexicana SLBN-89 | Isolate | Rhizosphere |
| 217 | 2941475908 | Stenotrophomonas rhizophila 2680 | Isolate | Rhizosphere |
| 218 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98 |
| Metatranscriptomes | 0 |
| Isolates | 2 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12 |
| Nodule | 0.57 |
| Rhizoplane | 7.14 |
| Rhizosphere | 67.71 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.14 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0496121_0004284 | 3300048924 | Bacteria | 19354 |
| 2 | JGI25153J46596_10000193 | 3300003215 | Bacteria | 58625 |
| 3 | JGI25153J46596_10004148 | 3300003215 | Bacteria | 7872 |
| 4 | Ga0065714_10003571 | 3300005288 | Bacteria | 6691 |
| 5 | Ga0070658_10012089 | 3300005327 | Bacteria | 6930 |
| 6 | Ga0070676_10060245 | 3300005328 | Bacteria | 2254 |
| 7 | Ga0070666_10000157 | 3300005335 | Bacteria | 46885 |
| 8 | Ga0070666_10031551 | 3300005335 | Bacteria | 3497 |
| 9 | Ga0070666_10169631 | 3300005335 | Bacteria | 1528 |
| 10 | Ga0068868_100135430 | 3300005338 | Bacteria | 2019 |
| 11 | Ga0070660_100050347 | 3300005339 | Bacteria | 3205 |
| 12 | Ga0070660_100078221 | 3300005339 | Bacteria | 2593 |
| 13 | Ga0070675_100108540 | 3300005354 | Bacteria | 2344 |
| 14 | Ga0070671_100015774 | 3300005355 | Bacteria | 6105 |
| 15 | Ga0070673_100129034 | 3300005364 | Bacteria | 2119 |
| 16 | Ga0070667_100016213 | 3300005367 | Bacteria | 6165 |
| 17 | Ga0070667_100172487 | 3300005367 | Bacteria | 1910 |
| 18 | Ga0070663_100063308 | 3300005455 | Bacteria | 2670 |
| 19 | Ga0070662_100116533 | 3300005457 | Bacteria | 2042 |
| 20 | Ga0070681_10021444 | 3300005458 | Bacteria | 6477 |
| 21 | Ga0068867_100131656 | 3300005459 | Bacteria | 1944 |
| 22 | Ga0070706_100179126 | 3300005467 | Bacteria | 1979 |
| 23 | Ga0070698_100204516 | 3300005471 | Bacteria | 1910 |
| 24 | Ga0068853_100042800 | 3300005539 | Bacteria | 3874 |
| 25 | Ga0068853_100059936 | 3300005539 | Bacteria | 3288 |
| 26 | Ga0068853_100269019 | 3300005539 | Bacteria | 1569 |
| 27 | Ga0068853_100280286 | 3300005539 | Bacteria | 1537 |
| 28 | Ga0070665_100016047 | 3300005548 | Bacteria | 7519 |
| 29 | Ga0070665_100042218 | 3300005548 | Bacteria | 4584 |
| 30 | Ga0070665_100050324 | 3300005548 | Bacteria | 4181 |
| 31 | Ga0070665_100109311 | 3300005548 | Bacteria | 2767 |
| 32 | Ga0068855_100076004 | 3300005563 | Bacteria | 3899 |
| 33 | Ga0070664_100107050 | 3300005564 | Bacteria | 2437 |
| 34 | Ga0070664_100362503 | 3300005564 | Bacteria | 1320 |
| 35 | Ga0068863_100334663 | 3300005841 | Bacteria | 1472 |
| 36 | Ga0068858_100057806 | 3300005842 | Bacteria | 3585 |
| 37 | Ga0068862_100009008 | 3300005844 | Bacteria | 8261 |
| 38 | Ga0081540_1000003 | 3300005983 | Bacteria | 233942 |
| 39 | Ga0070717_10061845 | 3300006028 | Bacteria | 3104 |
| 40 | Ga0075365_10028759 | 3300006038 | Bacteria | 3546 |
| 41 | Ga0075363_100152448 | 3300006048 | Bacteria | 1305 |
| 42 | Ga0070712_100011336 | 3300006175 | Bacteria | 5648 |
| 43 | Ga0075367_10043544 | 3300006178 | Bacteria | 2629 |
| 44 | Ga0097621_100000492 | 3300006237 | Bacteria | 27684 |
| 45 | Ga0068871_100097137 | 3300006358 | Bacteria | 2462 |
| 46 | Ga0105240_10068288 | 3300009093 | Unclassified | 4402 |
| 47 | Ga0105240_10095491 | 3300009093 | Bacteria | 3625 |
| 48 | Ga0105240_10504628 | 3300009093 | Bacteria | 1344 |
| 49 | Ga0105245_10015670 | 3300009098 | Bacteria | 6611 |
| 50 | Ga0105245_10024690 | 3300009098 | Bacteria | 5280 |
| 51 | Ga0105237_10033741 | 3300009545 | Bacteria | 5185 |
| 52 | Ga0105237_10148693 | 3300009545 | Bacteria | 2338 |
| 53 | Ga0105249_10158303 | 3300009553 | Bacteria | 2186 |
| 54 | Ga0105239_10060818 | 3300010375 | Bacteria | 4145 |
| 55 | Ga0105239_10248902 | 3300010375 | Bacteria | 1996 |
| 56 | Ga0157371_10000368 | 3300013102 | Bacteria | 56863 |
| 57 | Ga0157371_10005040 | 3300013102 | Bacteria | 11299 |
| 58 | Ga0157370_10226328 | 3300013104 | Bacteria | 1731 |
| 59 | Ga0157378_10007672 | 3300013297 | Bacteria | 9419 |
| 60 | Ga0157378_10500832 | 3300013297 | Bacteria | 1213 |
| 61 | Ga0163162_10000004 | 3300013306 | Bacteria | 505593 |
| 62 | Ga0163162_10042602 | 3300013306 | Bacteria | 4544 |
| 63 | Ga0157375_10073259 | 3300013308 | Bacteria | 3444 |
| 64 | Ga0163163_10000007 | 3300014325 | Bacteria | 288439 |
| 65 | Ga0163163_10373833 | 3300014325 | Bacteria | 1482 |
| 66 | Ga0157380_10109950 | 3300014326 | Bacteria | 2314 |
| 67 | Ga0182008_10000450 | 3300014497 | Bacteria | 31363 |
| 68 | Ga0157379_10010181 | 3300014968 | Bacteria | 8192 |
| 69 | Ga0157379_10028847 | 3300014968 | Bacteria | 4936 |
| 70 | Ga0182007_10000019 | 3300015262 | Bacteria | 194770 |
| 71 | Ga0182005_1000306 | 3300015265 | Bacteria | 29558 |
| 72 | Ga0163161_10000463 | 3300017792 | Bacteria | 33681 |
| 73 | Ga0163161_10143154 | 3300017792 | Bacteria | 1811 |
| 74 | Ga0213876_10004697 | 3300021384 | Bacteria | 7603 |
| 75 | Ga0209025_1002254 | 3300025294 | Bacteria | 21168 |
| 76 | Ga0209758_1000005 | 3300025297 | Bacteria | 1368918 |
| 77 | Ga0209758_1000085 | 3300025297 | Bacteria | 256191 |
| 78 | Ga0209758_1002244 | 3300025297 | Bacteria | 20051 |
| 79 | Ga0209758_1033649 | 3300025297 | Bacteria | 2054 |
| 80 | Ga0209257_1002600 | 3300025304 | Bacteria | 17507 |
| 81 | Ga0207656_10031811 | 3300025321 | Bacteria | 2188 |
| 82 | Ga0207680_10000131 | 3300025903 | Bacteria | 35070 |
| 83 | Ga0207680_10017882 | 3300025903 | Bacteria | 3754 |
| 84 | Ga0207645_10064258 | 3300025907 | Bacteria | 2345 |
| 85 | Ga0207705_10090894 | 3300025909 | Bacteria | 2235 |
| 86 | Ga0207705_10378144 | 3300025909 | Unclassified | 1094 |
| 87 | Ga0207695_10069191 | 3300025913 | Bacteria | 3613 |
| 88 | Ga0207695_10270142 | 3300025913 | Bacteria | 1596 |
| 89 | Ga0207671_10019144 | 3300025914 | Bacteria | 5240 |
| 90 | Ga0207693_10133357 | 3300025915 | Bacteria | 1952 |
| 91 | Ga0207657_10012368 | 3300025919 | Bacteria | 8430 |
| 92 | Ga0207657_10108730 | 3300025919 | Bacteria | 2292 |
| 93 | Ga0207687_10050155 | 3300025927 | Bacteria | 2904 |
| 94 | Ga0207687_10089889 | 3300025927 | Bacteria | 2237 |
| 95 | Ga0207644_10071990 | 3300025931 | Bacteria | 2530 |
| 96 | Ga0207711_10048250 | 3300025941 | Bacteria | 3643 |
| 97 | Ga0207689_10153848 | 3300025942 | Bacteria | 1896 |
| 98 | Ga0207689_10314645 | 3300025942 | Bacteria | 1299 |
| 99 | Ga0207679_10242113 | 3300025945 | Bacteria | 1529 |
| 100 | Ga0207651_10026443 | 3300025960 | Bacteria | 3626 |
| 101 | Ga0207651_10218126 | 3300025960 | Bacteria | 1540 |
| 102 | Ga0207677_10100664 | 3300026023 | Bacteria | 2125 |
| 103 | Ga0207639_10115425 | 3300026041 | Bacteria | 2196 |
| 104 | Ga0207678_10120170 | 3300026067 | Bacteria | 2242 |
| 105 | Ga0207641_10348041 | 3300026088 | Bacteria | 1412 |
| 106 | Ga0207648_10148878 | 3300026089 | Bacteria | 2065 |
| 107 | Ga0207428_10004619 | 3300027907 | Bacteria | 13055 |
| 108 | Ga0207428_10197636 | 3300027907 | Unclassified | 1514 |
| 109 | Ga0268266_10032202 | 3300028379 | Bacteria | 4455 |
| 110 | Ga0268266_10035213 | 3300028379 | Bacteria | 4259 |
| 111 | Ga0268266_10059554 | 3300028379 | Bacteria | 3290 |
| 112 | Ga0268265_10003519 | 3300028380 | Bacteria | 11212 |
| 113 | Ga0265318_10004133 | 3300028577 | Bacteria | 7104 |
| 114 | Ga0307515_10212381 | 3300028794 | Bacteria | 1776 |
| 115 | Ga0265338_10303578 | 3300028800 | Bacteria | 1160 |
| 116 | Ga0265330_10152766 | 3300031235 | Bacteria | 981 |
| 117 | Ga0265332_10000603 | 3300031238 | Bacteria | 23587 |
| 118 | Ga0265332_10028067 | 3300031238 | Bacteria | 2465 |
| 119 | Ga0265325_10002784 | 3300031241 | Bacteria | 11672 |
| 120 | Ga0265325_10029405 | 3300031241 | Bacteria | 2954 |
| 121 | Ga0265340_10000782 | 3300031247 | Bacteria | 18030 |
| 122 | Ga0265339_10011847 | 3300031249 | Bacteria | 5349 |
| 123 | Ga0265331_10014152 | 3300031250 | Bacteria | 4260 |
| 124 | Ga0265316_10079737 | 3300031344 | Bacteria | 2512 |
| 125 | Ga0307513_10153016 | 3300031456 | Bacteria | 2212 |
| 126 | Ga0307513_10161693 | 3300031456 | Bacteria | 2131 |
| 127 | Ga0265313_10001048 | 3300031595 | Bacteria | 26907 |
| 128 | Ga0265313_10008369 | 3300031595 | Bacteria | 6882 |
| 129 | Ga0307508_10100948 | 3300031616 | Bacteria | 2481 |
| 130 | Ga0265314_10009655 | 3300031711 | Bacteria | 8126 |
| 131 | Ga0265314_10018298 | 3300031711 | Bacteria | 5466 |
| 132 | Ga0265314_10025255 | 3300031711 | Bacteria | 4487 |
| 133 | Ga0265314_10121804 | 3300031711 | Bacteria | 1641 |
| 134 | Ga0265342_10000270 | 3300031712 | Bacteria | 58343 |
| 135 | Ga0307413_10065186 | 3300031824 | Bacteria | 2267 |
| 136 | Ga0307414_10058498 | 3300032004 | Bacteria | 2716 |
| 137 | Ga0373943_0031610 | 3300035170 | Bacteria | 2512 |
| 138 | Ga0373943_0035907 | 3300035170 | Bacteria | 2372 |
| 139 | Ga0373927_0057225 | 3300035695 | Bacteria | 2521 |
| 140 | Ga0373947_0005773 | 3300035725 | Bacteria | 7221 |
| 141 | Ga0373947_0069911 | 3300035725 | Bacteria | 2150 |
| 142 | Ga0373925_0215765 | 3300037068 | Bacteria | 1530 |
| 143 | Ga0395900_0157971 | 3300037418 | Bacteria | 2315 |
| 144 | Ga0395898_0012649 | 3300037466 | Bacteria | 8723 |
| 145 | Ga0436364_0439489 | 3300037853 | Bacteria | 3921 |
| 146 | Ga0436364_1269100 | 3300037853 | Bacteria | 2686 |
| 147 | Ga0400483_046415 | 3300039062 | Bacteria | 15733 |
| 148 | Ga0400483_182917 | 3300039062 | Bacteria | 5703 |
| 149 | Ga0436365_1168931 | 3300039437 | Bacteria | 1532 |
| 150 | Ga0436365_1243203 | 3300039437 | Bacteria | 6890 |
| 151 | Ga0436363_0099471 | 3300039450 | Bacteria | 5620 |
| 152 | Ga0439466_0000883 | 3300041411 | Bacteria | 11422 |
| 153 | Ga0439465_0000984 | 3300041413 | Bacteria | 9069 |
| 154 | Ga0451793_0552864 | 3300041452 | Bacteria | 1420 |
| 155 | Ga0451807_2323933 | 3300041486 | Bacteria | 1687 |
| 156 | Ga0439449_0000107 | 3300042007 | Bacteria | 27003 |
| 157 | Ga0439452_002121 | 3300042010 | Bacteria | 7511 |
| 158 | Ga0439462_0021866 | 3300042015 | Bacteria | 1673 |
| 159 | Ga0450922_001951 | 3300042124 | Bacteria | 1977 |
| 160 | Ga0451577_0015763 | 3300042876 | Bacteria | 7015 |
| 161 | Ga0466963_0002473 | 3300044694 | Bacteria | 10334 |
| 162 | Ga0466959_0011439 | 3300045049 | Bacteria | 6377 |
| 163 | Ga0466958_0011758 | 3300045836 | Bacteria | 4942 |
| 164 | Ga0466967_0413477 | 3300045976 | Bacteria | 1314 |
| 165 | Ga0495627_011073 | 3300046453 | Bacteria | 3250 |
| 166 | Ga0495603_0002271 | 3300046455 | Bacteria | 11290 |
| 167 | Ga0495650_0016060 | 3300046471 | Bacteria | 3810 |
| 168 | Ga0495662_0053489 | 3300046476 | Bacteria | 1950 |
| 169 | Ga0495662_0260417 | 3300046476 | Bacteria | 854 |
| 170 | Ga0495594_0011145 | 3300046499 | Bacteria | 4667 |
| 171 | Ga0495630_0099603 | 3300046517 | Bacteria | 2199 |
| 172 | Ga0495648_0109740 | 3300046524 | Bacteria | 1504 |
| 173 | Ga0495663_0040845 | 3300046525 | Bacteria | 1410 |
| 174 | Ga0495640_0031682 | 3300046533 | Bacteria | 3771 |
| 175 | Ga0495609_0104677 | 3300046538 | Bacteria | 1224 |
| 176 | Ga0495622_0002549 | 3300046557 | Bacteria | 8803 |
| 177 | Ga0495656_0010564 | 3300046615 | Bacteria | 3360 |
| 178 | Ga0495656_0016015 | 3300046615 | Bacteria | 2839 |
| 179 | Ga0495636_0024723 | 3300047318 | Bacteria | 2437 |
| 180 | Ga0495681_0107220 | 3300047470 | Bacteria | 1214 |
| 181 | Ga0495602_0200901 | 3300048088 | Bacteria | 1521 |
| 182 | Ga0496102_0001465 | 3300048905 | Bacteria | 20862 |
| 183 | Ga0496103_0073468 | 3300048906 | Bacteria | 2142 |
| 184 | Ga0496104_0022829 | 3300048907 | Bacteria | 5749 |
| 185 | Ga0496104_0450660 | 3300048907 | Bacteria | 1198 |
| 186 | Ga0496105_0040955 | 3300048908 | Bacteria | 3818 |
| 187 | Ga0496105_0062749 | 3300048908 | Bacteria | 3067 |
| 188 | Ga0496105_0166410 | 3300048908 | Bacteria | 1809 |
| 189 | Ga0496105_0178289 | 3300048908 | Bacteria | 1740 |
| 190 | Ga0496106_0002276 | 3300048909 | Bacteria | 14319 |
| 191 | Ga0496107_0019221 | 3300048910 | Bacteria | 4820 |
| 192 | Ga0496107_0039956 | 3300048910 | Bacteria | 3367 |
| 193 | Ga0496108_0079346 | 3300048911 | Bacteria | 2779 |
| 194 | Ga0496109_0000815 | 3300048912 | Bacteria | 25975 |
| 195 | Ga0496109_0003616 | 3300048912 | Bacteria | 12925 |
| 196 | Ga0496109_0298413 | 3300048912 | Bacteria | 1519 |
| 197 | Ga0496110_0000415 | 3300048913 | Bacteria | 28977 |
| 198 | Ga0496110_0000859 | 3300048913 | Bacteria | 21434 |
| 199 | Ga0496111_0083458 | 3300048914 | Bacteria | 2334 |
| 200 | Ga0496113_0058643 | 3300048916 | Bacteria | 2897 |
| 201 | Ga0496113_0213841 | 3300048916 | Bacteria | 1535 |
| 202 | Ga0496114_0075521 | 3300048917 | Bacteria | 2839 |
| 203 | Ga0496115_0016106 | 3300048918 | Bacteria | 5685 |
| 204 | Ga0496115_0418358 | 3300048918 | Bacteria | 1086 |
| 205 | Ga0496116_0032889 | 3300048919 | Bacteria | 3689 |
| 206 | Ga0496116_0081355 | 3300048919 | Bacteria | 2008 |
| 207 | Ga0496117_0021692 | 3300048920 | Bacteria | 5184 |
| 208 | Ga0496117_0077462 | 3300048920 | Bacteria | 2200 |
| 209 | Ga0496117_0121562 | 3300048920 | Bacteria | 1603 |
| 210 | Ga0496118_0030471 | 3300048921 | Bacteria | 4501 |
| 211 | Ga0496118_0053933 | 3300048921 | Bacteria | 3050 |
| 212 | Ga0496118_0096630 | 3300048921 | Bacteria | 2013 |
| 213 | Ga0496119_0000338 | 3300048922 | Bacteria | 65446 |
| 214 | Ga0496119_0029161 | 3300048922 | Bacteria | 3749 |
| 215 | Ga0496120_0000707 | 3300048923 | Bacteria | 48949 |
| 216 | Ga0496121_0001934 | 3300048924 | Bacteria | 33033 |
| 217 | Ga0496121_0252203 | 3300048924 | Bacteria | 1223 |
| 218 | Ga0496121_0267615 | 3300048924 | Bacteria | 1176 |
| 219 | Ga0496122_0035809 | 3300048925 | Bacteria | 4029 |
| 220 | Ga0496123_0050470 | 3300048926 | Bacteria | 2779 |
| 221 | Ga0496123_0070584 | 3300048926 | Bacteria | 2185 |
| 222 | Ga0496124_0008443 | 3300048927 | Bacteria | 10773 |
| 223 | Ga0496124_0144231 | 3300048927 | Bacteria | 1875 |
| 224 | Ga0496124_0206058 | 3300048927 | Bacteria | 1491 |
| 225 | Ga0496125_0001351 | 3300048928 | Bacteria | 36185 |
| 226 | Ga0496125_0002400 | 3300048928 | Bacteria | 24387 |
| 227 | Ga0496125_0014694 | 3300048928 | Bacteria | 7609 |
| 228 | Ga0496125_0046143 | 3300048928 | Bacteria | 3658 |
| 229 | Ga0496125_0048041 | 3300048928 | Bacteria | 3562 |
| 230 | Ga0496125_0091890 | 3300048928 | Bacteria | 2271 |
| 231 | Ga0496125_0100145 | 3300048928 | Bacteria | 2137 |
| 232 | Ga0496126_0000532 | 3300048929 | Bacteria | 73699 |
| 233 | Ga0496126_0089412 | 3300048929 | Bacteria | 2711 |
| 234 | Ga0496126_0144723 | 3300048929 | Bacteria | 2043 |
| 235 | Ga0495682_0050526 | 3300049460 | Unclassified | 1513 |
| 236 | Ga0501300_008473 | 3300049523 | Bacteria | 1507 |
| 237 | Ga0501031_0010845 | 3300049568 | Bacteria | 5934 |
| 238 | Ga0501032_0005636 | 3300049569 | Bacteria | 9277 |
| 239 | Ga0501032_0007561 | 3300049569 | Bacteria | 7935 |
| 240 | Ga0501033_0019930 | 3300049570 | Bacteria | 5069 |
| 241 | Ga0501033_0040821 | 3300049570 | Bacteria | 3464 |
| 242 | Ga0501034_0000632 | 3300049571 | Bacteria | 54605 |
| 243 | Ga0501034_0020052 | 3300049571 | Bacteria | 6828 |
| 244 | Ga0501034_0120306 | 3300049571 | Bacteria | 2612 |
| 245 | Ga0501036_0000888 | 3300049572 | Bacteria | 22365 |
| 246 | Ga0501036_0032515 | 3300049572 | Bacteria | 4408 |
| 247 | Ga0501036_0213296 | 3300049572 | Bacteria | 1622 |
| 248 | Ga0501037_0036575 | 3300049573 | Bacteria | 3618 |
| 249 | Ga0501037_0108676 | 3300049573 | Bacteria | 1998 |
| 250 | Ga0501038_0010037 | 3300049574 | Bacteria | 8671 |
| 251 | Ga0501038_0068144 | 3300049574 | Bacteria | 3026 |
| 252 | Ga0501038_0068657 | 3300049574 | Bacteria | 3012 |
| 253 | Ga0501039_0004710 | 3300049575 | Bacteria | 10327 |
| 254 | Ga0501042_0017294 | 3300049578 | Bacteria | 4971 |
| 255 | Ga0501043_0005312 | 3300049579 | Bacteria | 10408 |
| 256 | Ga0501043_0015766 | 3300049579 | Bacteria | 5925 |
| 257 | Ga0501043_0049373 | 3300049579 | Bacteria | 3308 |
| 258 | Ga0501046_0002393 | 3300049580 | Bacteria | 17631 |
| 259 | Ga0501046_0006623 | 3300049580 | Bacteria | 10227 |
| 260 | Ga0501046_0024284 | 3300049580 | Bacteria | 4974 |
| 261 | Ga0501046_0039142 | 3300049580 | Bacteria | 3799 |
| 262 | Ga0501047_0000479 | 3300049581 | Bacteria | 43519 |
| 263 | Ga0501047_0006301 | 3300049581 | Bacteria | 11159 |
| 264 | Ga0501047_0008181 | 3300049581 | Bacteria | 9878 |
| 265 | Ga0501047_0036049 | 3300049581 | Bacteria | 4779 |
| 266 | Ga0501047_0243841 | 3300049581 | Bacteria | 1647 |
| 267 | Ga0501048_0001062 | 3300049582 | Bacteria | 20570 |
| 268 | Ga0501048_0056780 | 3300049582 | Bacteria | 2777 |
| 269 | Ga0501048_0060828 | 3300049582 | Bacteria | 2676 |
| 270 | Ga0501048_0114165 | 3300049582 | Bacteria | 1908 |
| 271 | Ga0501067_0019674 | 3300049583 | Bacteria | 3737 |
| 272 | Ga0501068_0009937 | 3300049584 | Bacteria | 5333 |
| 273 | Ga0501068_0022017 | 3300049584 | Bacteria | 3725 |
| 274 | Ga0501069_0002144 | 3300049585 | Bacteria | 9938 |
| 275 | Ga0501069_0019353 | 3300049585 | Bacteria | 3680 |
| 276 | Ga0501070_0003897 | 3300049586 | Bacteria | 12874 |
| 277 | Ga0501070_0023144 | 3300049586 | Bacteria | 5204 |
| 278 | Ga0501070_0053589 | 3300049586 | Bacteria | 3345 |
| 279 | Ga0501070_0083046 | 3300049586 | Bacteria | 2652 |
| 280 | Ga0501071_0026610 | 3300049587 | Bacteria | 4062 |
| 281 | Ga0501072_0317337 | 3300049588 | Bacteria | 1238 |
| 282 | Ga0501073_0004505 | 3300049589 | Bacteria | 10467 |
| 283 | Ga0501073_0010808 | 3300049589 | Bacteria | 6686 |
| 284 | Ga0501073_0130309 | 3300049589 | Bacteria | 1743 |
| 285 | Ga0501073_0242820 | 3300049589 | Bacteria | 1244 |
| 286 | Ga0501074_0005128 | 3300049590 | Bacteria | 9413 |
| 287 | Ga0501076_0280866 | 3300049592 | Bacteria | 1364 |
| 288 | Ga0501079_0028552 | 3300049741 | Bacteria | 4282 |
| 289 | Ga0501080_0021740 | 3300049742 | Bacteria | 5943 |
| 290 | Ga0501080_0027040 | 3300049742 | Bacteria | 5334 |
| 291 | Ga0501083_0026739 | 3300049744 | Bacteria | 3986 |
| 292 | Ga0501083_0038036 | 3300049744 | Bacteria | 3272 |
| 293 | Ga0501083_0042006 | 3300049744 | Bacteria | 3100 |
| 294 | Ga0501265_000892 | 3300049762 | Bacteria | 3337 |
| 295 | Ga0501275_000032 | 3300049772 | Bacteria | 14501 |
| 296 | Ga0501035_0007010 | 3300049822 | Bacteria | 10529 |
| 297 | Ga0501035_0238372 | 3300049822 | Bacteria | 1548 |
| 298 | Ga0501035_0243380 | 3300049822 | Bacteria | 1529 |
| 299 | Ga0501035_0256127 | 3300049822 | Bacteria | 1485 |
| 300 | Ga0501044_0009780 | 3300049823 | Bacteria | 10429 |
| 301 | Ga0501044_0013102 | 3300049823 | Bacteria | 8975 |
| 302 | Ga0501044_0030576 | 3300049823 | Bacteria | 5674 |
| 303 | Ga0501044_0147434 | 3300049823 | Bacteria | 2337 |
| 304 | Ga0501044_0209316 | 3300049823 | Bacteria | 1905 |
| 305 | Ga0501044_0212835 | 3300049823 | Bacteria | 1886 |
| 306 | Ga0501045_0026003 | 3300049824 | Bacteria | 4208 |
| 307 | nmdc:mga0yw44_108058_c1 | 3300050492 | Bacteria | 1780 |
| 308 | nmdc:mga0yw44_4158_c1 | 3300050492 | Bacteria | 6577 |
| 309 | nmdc:mga0k408_13735_c1 | 3300050493 | Bacteria | 4447 |
| 310 | nmdc:mga06z11_32308_c1 | 3300050494 | Bacteria | 2551 |
| 311 | nmdc:mga08y16_235084_c1 | 3300050511 | Bacteria | 1895 |
| 312 | nmdc:mga0sz30_33457_c1 | 3300050516 | Bacteria | 2137 |
| 313 | Ga0495619_0024530 | 3300053085 | Bacteria | 3868 |
| 314 | Ga0500578_0020798 | 3300053086 | Bacteria | 4219 |
| 315 | Ga0500578_0123415 | 3300053086 | Bacteria | 1627 |
| 316 | Ga0500644_0009573 | 3300053088 | Bacteria | 2597 |
| 317 | Ga0500651_0007613 | 3300053093 | Bacteria | 6334 |
| 318 | Ga0500651_0012611 | 3300053093 | Bacteria | 5125 |
| 319 | Ga0500651_0132784 | 3300053093 | Bacteria | 1505 |
| 320 | Ga0500641_0005289 | 3300053096 | Bacteria | 4570 |
| 321 | Ga0500641_0026627 | 3300053096 | Bacteria | 2246 |
| 322 | Ga0500572_065346 | 3300053111 | Bacteria | 1114 |
| 323 | Ga0500594_0017291 | 3300053118 | Bacteria | 1764 |
| 324 | Ga0500595_000382 | 3300053119 | Bacteria | 28614 |
| 325 | Ga0500595_000409 | 3300053119 | Bacteria | 27453 |
| 326 | Ga0500595_003722 | 3300053119 | Bacteria | 7033 |
| 327 | Ga0500595_010342 | 3300053119 | Bacteria | 3713 |
| 328 | Ga0500595_028853 | 3300053119 | Bacteria | 1888 |
| 329 | Ga0500642_0004649 | 3300053130 | Bacteria | 4326 |
| 330 | Ga0500652_000006 | 3300053131 | Bacteria | 167437 |
| 331 | Ga0500568_0033164 | 3300053139 | Bacteria | 2120 |
| 332 | Ga0500573_0000004 | 3300053140 | Bacteria | 341236 |
| 333 | Ga0500588_0002294 | 3300053146 | Bacteria | 3860 |
| 334 | Ga0500588_0084834 | 3300053146 | Bacteria | 1066 |
| 335 | Ga0500600_0005308 | 3300053149 | Bacteria | 7604 |
| 336 | Ga0500604_0015120 | 3300053151 | Bacteria | 2109 |
| 337 | Ga0500616_0002303 | 3300053153 | Bacteria | 16147 |
| 338 | Ga0500622_0002891 | 3300053156 | Bacteria | 11989 |
| 339 | Ga0501084_0003714 | 3300054114 | Bacteria | 12396 |
| 340 | Ga0501084_0009978 | 3300054114 | Bacteria | 7848 |
| 341 | Ga0500661_019839 | 3300055283 | Bacteria | 1196 |
| 342 | Ga0501082_0046482 | 3300060353 | Bacteria | 3741 |
| 343 | Ga0501082_0271384 | 3300060353 | Bacteria | 1476 |
| 344 | 2511253448 | 2511231004 | Bacteria | 6669789 |
| 345 | 2739256973 | 2738543015 | Bacteria | 6750701 |
| 346 | 2852651767 | 2852649853 | Bacteria | 4036942 |
| 347 | 2881716965 | 2881714928 | Bacteria | 2469486 |
| 348 | 2923516833 | 2923516293 | Bacteria | 3716336 |
| 349 | 2941479488 | 2941475908 | Bacteria | 4145589 |
| 350 | 3005477875 | 3005474847 | Bacteria | 9259049 |
| 351 | Ga0496121_0004284 | |||
| 352 | JGI25153J46596_10000193 | |||
| 353 | JGI25153J46596_10004148 | |||
| 354 | Ga0065714_10003571 | |||
| 355 | Ga0070658_10012089 | |||
| 356 | Ga0070676_10060245 | |||
| 357 | Ga0070666_10000157 | |||
| 358 | Ga0070666_10031551 | |||
| 359 | Ga0070666_10169631 | |||
| 360 | Ga0068868_100135430 | |||
| 361 | Ga0070660_100050347 | |||
| 362 | Ga0070660_100078221 | |||
| 363 | Ga0070675_100108540 | |||
| 364 | Ga0070671_100015774 | |||
| 365 | Ga0070673_100129034 | |||
| 366 | Ga0070667_100016213 | |||
| 367 | Ga0070667_100172487 | |||
| 368 | Ga0070663_100063308 | |||
| 369 | Ga0070662_100116533 | |||
| 370 | Ga0070681_10021444 | |||
| 371 | Ga0068867_100131656 | |||
| 372 | Ga0070706_100179126 | |||
| 373 | Ga0070698_100204516 | |||
| 374 | Ga0068853_100042800 | |||
| 375 | Ga0068853_100059936 | |||
| 376 | Ga0068853_100269019 | |||
| 377 | Ga0068853_100280286 | |||
| 378 | Ga0070665_100016047 | |||
| 379 | Ga0070665_100042218 | |||
| 380 | Ga0070665_100050324 | |||
| 381 | Ga0070665_100109311 | |||
| 382 | Ga0068855_100076004 | |||
| 383 | Ga0070664_100107050 | |||
| 384 | Ga0070664_100362503 | |||
| 385 | Ga0068863_100334663 | |||
| 386 | Ga0068858_100057806 | |||
| 387 | Ga0068862_100009008 | |||
| 388 | Ga0081540_1000003 | |||
| 389 | Ga0070717_10061845 | |||
| 390 | Ga0075365_10028759 | |||
| 391 | Ga0075363_100152448 | |||
| 392 | Ga0070712_100011336 | |||
| 393 | Ga0075367_10043544 | |||
| 394 | Ga0097621_100000492 | |||
| 395 | Ga0068871_100097137 | |||
| 396 | Ga0105240_10068288 | |||
| 397 | Ga0105240_10095491 | |||
| 398 | Ga0105240_10504628 | |||
| 399 | Ga0105245_10015670 | |||
| 400 | Ga0105245_10024690 | |||
| 401 | Ga0105237_10033741 | |||
| 402 | Ga0105237_10148693 | |||
| 403 | Ga0105249_10158303 | |||
| 404 | Ga0105239_10060818 | |||
| 405 | Ga0105239_10248902 | |||
| 406 | Ga0157371_10000368 | |||
| 407 | Ga0157371_10005040 | |||
| 408 | Ga0157370_10226328 | |||
| 409 | Ga0157378_10007672 | |||
| 410 | Ga0157378_10500832 | |||
| 411 | Ga0163162_10000004 | |||
| 412 | Ga0163162_10042602 | |||
| 413 | Ga0157375_10073259 | |||
| 414 | Ga0163163_10000007 | |||
| 415 | Ga0163163_10373833 | |||
| 416 | Ga0157380_10109950 | |||
| 417 | Ga0182008_10000450 | |||
| 418 | Ga0157379_10010181 | |||
| 419 | Ga0157379_10028847 | |||
| 420 | Ga0182007_10000019 | |||
| 421 | Ga0182005_1000306 | |||
| 422 | Ga0163161_10000463 | |||
| 423 | Ga0163161_10143154 | |||
| 424 | Ga0213876_10004697 | |||
| 425 | Ga0209025_1002254 | |||
| 426 | Ga0209758_1000005 | |||
| 427 | Ga0209758_1000085 | |||
| 428 | Ga0209758_1002244 | |||
| 429 | Ga0209758_1033649 | |||
| 430 | Ga0209257_1002600 | |||
| 431 | Ga0207656_10031811 | |||
| 432 | Ga0207680_10000131 | |||
| 433 | Ga0207680_10017882 | |||
| 434 | Ga0207645_10064258 | |||
| 435 | Ga0207705_10090894 | |||
| 436 | Ga0207705_10378144 | |||
| 437 | Ga0207695_10069191 | |||
| 438 | Ga0207695_10270142 | |||
| 439 | Ga0207671_10019144 | |||
| 440 | Ga0207693_10133357 | |||
| 441 | Ga0207657_10012368 | |||
| 442 | Ga0207657_10108730 | |||
| 443 | Ga0207687_10050155 | |||
| 444 | Ga0207687_10089889 | |||
| 445 | Ga0207644_10071990 | |||
| 446 | Ga0207711_10048250 | |||
| 447 | Ga0207689_10153848 | |||
| 448 | Ga0207689_10314645 | |||
| 449 | Ga0207679_10242113 | |||
| 450 | Ga0207651_10026443 | |||
| 451 | Ga0207651_10218126 | |||
| 452 | Ga0207677_10100664 | |||
| 453 | Ga0207639_10115425 | |||
| 454 | Ga0207678_10120170 | |||
| 455 | Ga0207641_10348041 | |||
| 456 | Ga0207648_10148878 | |||
| 457 | Ga0207428_10004619 | |||
| 458 | Ga0207428_10197636 | |||
| 459 | Ga0268266_10032202 | |||
| 460 | Ga0268266_10035213 | |||
| 461 | Ga0268266_10059554 | |||
| 462 | Ga0268265_10003519 | |||
| 463 | Ga0265318_10004133 | |||
| 464 | Ga0307515_10212381 | |||
| 465 | Ga0265338_10303578 | |||
| 466 | Ga0265330_10152766 | |||
| 467 | Ga0265332_10000603 | |||
| 468 | Ga0265332_10028067 | |||
| 469 | Ga0265325_10002784 | |||
| 470 | Ga0265325_10029405 | |||
| 471 | Ga0265340_10000782 | |||
| 472 | Ga0265339_10011847 | |||
| 473 | Ga0265331_10014152 | |||
| 474 | Ga0265316_10079737 | |||
| 475 | Ga0307513_10153016 | |||
| 476 | Ga0307513_10161693 | |||
| 477 | Ga0265313_10001048 | |||
| 478 | Ga0265313_10008369 | |||
| 479 | Ga0307508_10100948 | |||
| 480 | Ga0265314_10009655 | |||
| 481 | Ga0265314_10018298 | |||
| 482 | Ga0265314_10025255 | |||
| 483 | Ga0265314_10121804 | |||
| 484 | Ga0265342_10000270 | |||
| 485 | Ga0307413_10065186 | |||
| 486 | Ga0307414_10058498 | |||
| 487 | Ga0373943_0031610 | |||
| 488 | Ga0373943_0035907 | |||
| 489 | Ga0373927_0057225 | |||
| 490 | Ga0373947_0005773 | |||
| 491 | Ga0373947_0069911 | |||
| 492 | Ga0373925_0215765 | |||
| 493 | Ga0395900_0157971 | |||
| 494 | Ga0395898_0012649 | |||
| 495 | Ga0436364_0439489 | |||
| 496 | Ga0436364_1269100 | |||
| 497 | Ga0400483_046415 | |||
| 498 | Ga0400483_182917 | |||
| 499 | Ga0436365_1168931 | |||
| 500 | Ga0436365_1243203 | |||
| 501 | Ga0436363_0099471 | |||
| 502 | Ga0439466_0000883 | |||
| 503 | Ga0439465_0000984 | |||
| 504 | Ga0451793_0552864 | |||
| 505 | Ga0451807_2323933 | |||
| 506 | Ga0439449_0000107 | |||
| 507 | Ga0439452_002121 | |||
| 508 | Ga0439462_0021866 | |||
| 509 | Ga0450922_001951 | |||
| 510 | Ga0451577_0015763 | |||
| 511 | Ga0466963_0002473 | |||
| 512 | Ga0466959_0011439 | |||
| 513 | Ga0466958_0011758 | |||
| 514 | Ga0466967_0413477 | |||
| 515 | Ga0495627_011073 | |||
| 516 | Ga0495603_0002271 | |||
| 517 | Ga0495650_0016060 | |||
| 518 | Ga0495662_0053489 | |||
| 519 | Ga0495662_0260417 | |||
| 520 | Ga0495594_0011145 | |||
| 521 | Ga0495630_0099603 | |||
| 522 | Ga0495648_0109740 | |||
| 523 | Ga0495663_0040845 | |||
| 524 | Ga0495640_0031682 | |||
| 525 | Ga0495609_0104677 | |||
| 526 | Ga0495622_0002549 | |||
| 527 | Ga0495656_0010564 | |||
| 528 | Ga0495656_0016015 | |||
| 529 | Ga0495636_0024723 | |||
| 530 | Ga0495681_0107220 | |||
| 531 | Ga0495602_0200901 | |||
| 532 | Ga0496102_0001465 | |||
| 533 | Ga0496103_0073468 | |||
| 534 | Ga0496104_0022829 | |||
| 535 | Ga0496104_0450660 | |||
| 536 | Ga0496105_0040955 | |||
| 537 | Ga0496105_0062749 | |||
| 538 | Ga0496105_0166410 | |||
| 539 | Ga0496105_0178289 | |||
| 540 | Ga0496106_0002276 | |||
| 541 | Ga0496107_0019221 | |||
| 542 | Ga0496107_0039956 | |||
| 543 | Ga0496108_0079346 | |||
| 544 | Ga0496109_0000815 | |||
| 545 | Ga0496109_0003616 | |||
| 546 | Ga0496109_0298413 | |||
| 547 | Ga0496110_0000415 | |||
| 548 | Ga0496110_0000859 | |||
| 549 | Ga0496111_0083458 | |||
| 550 | Ga0496113_0058643 | |||
| 551 | Ga0496113_0213841 | |||
| 552 | Ga0496114_0075521 | |||
| 553 | Ga0496115_0016106 | |||
| 554 | Ga0496115_0418358 | |||
| 555 | Ga0496116_0032889 | |||
| 556 | Ga0496116_0081355 | |||
| 557 | Ga0496117_0021692 | |||
| 558 | Ga0496117_0077462 | |||
| 559 | Ga0496117_0121562 | |||
| 560 | Ga0496118_0030471 | |||
| 561 | Ga0496118_0053933 | |||
| 562 | Ga0496118_0096630 | |||
| 563 | Ga0496119_0000338 | |||
| 564 | Ga0496119_0029161 | |||
| 565 | Ga0496120_0000707 | |||
| 566 | Ga0496121_0001934 | |||
| 567 | Ga0496121_0252203 | |||
| 568 | Ga0496121_0267615 | |||
| 569 | Ga0496122_0035809 | |||
| 570 | Ga0496123_0050470 | |||
| 571 | Ga0496123_0070584 | |||
| 572 | Ga0496124_0008443 | |||
| 573 | Ga0496124_0144231 | |||
| 574 | Ga0496124_0206058 | |||
| 575 | Ga0496125_0001351 | |||
| 576 | Ga0496125_0002400 | |||
| 577 | Ga0496125_0014694 | |||
| 578 | Ga0496125_0046143 | |||
| 579 | Ga0496125_0048041 | |||
| 580 | Ga0496125_0091890 | |||
| 581 | Ga0496125_0100145 | |||
| 582 | Ga0496126_0000532 | |||
| 583 | Ga0496126_0089412 | |||
| 584 | Ga0496126_0144723 | |||
| 585 | Ga0495682_0050526 | |||
| 586 | Ga0501300_008473 | |||
| 587 | Ga0501031_0010845 | |||
| 588 | Ga0501032_0005636 | |||
| 589 | Ga0501032_0007561 | |||
| 590 | Ga0501033_0019930 | |||
| 591 | Ga0501033_0040821 | |||
| 592 | Ga0501034_0000632 | |||
| 593 | Ga0501034_0020052 | |||
| 594 | Ga0501034_0120306 | |||
| 595 | Ga0501036_0000888 | |||
| 596 | Ga0501036_0032515 | |||
| 597 | Ga0501036_0213296 | |||
| 598 | Ga0501037_0036575 | |||
| 599 | Ga0501037_0108676 | |||
| 600 | Ga0501038_0010037 | |||
| 601 | Ga0501038_0068144 | |||
| 602 | Ga0501038_0068657 | |||
| 603 | Ga0501039_0004710 | |||
| 604 | Ga0501042_0017294 | |||
| 605 | Ga0501043_0005312 | |||
| 606 | Ga0501043_0015766 | |||
| 607 | Ga0501043_0049373 | |||
| 608 | Ga0501046_0002393 | |||
| 609 | Ga0501046_0006623 | |||
| 610 | Ga0501046_0024284 | |||
| 611 | Ga0501046_0039142 | |||
| 612 | Ga0501047_0000479 | |||
| 613 | Ga0501047_0006301 | |||
| 614 | Ga0501047_0008181 | |||
| 615 | Ga0501047_0036049 | |||
| 616 | Ga0501047_0243841 | |||
| 617 | Ga0501048_0001062 | |||
| 618 | Ga0501048_0056780 | |||
| 619 | Ga0501048_0060828 | |||
| 620 | Ga0501048_0114165 | |||
| 621 | Ga0501067_0019674 | |||
| 622 | Ga0501068_0009937 | |||
| 623 | Ga0501068_0022017 | |||
| 624 | Ga0501069_0002144 | |||
| 625 | Ga0501069_0019353 | |||
| 626 | Ga0501070_0003897 | |||
| 627 | Ga0501070_0023144 | |||
| 628 | Ga0501070_0053589 | |||
| 629 | Ga0501070_0083046 | |||
| 630 | Ga0501071_0026610 | |||
| 631 | Ga0501072_0317337 | |||
| 632 | Ga0501073_0004505 | |||
| 633 | Ga0501073_0010808 | |||
| 634 | Ga0501073_0130309 | |||
| 635 | Ga0501073_0242820 | |||
| 636 | Ga0501074_0005128 | |||
| 637 | Ga0501076_0280866 | |||
| 638 | Ga0501079_0028552 | |||
| 639 | Ga0501080_0021740 | |||
| 640 | Ga0501080_0027040 | |||
| 641 | Ga0501083_0026739 | |||
| 642 | Ga0501083_0038036 | |||
| 643 | Ga0501083_0042006 | |||
| 644 | Ga0501265_000892 | |||
| 645 | Ga0501275_000032 | |||
| 646 | Ga0501035_0007010 | |||
| 647 | Ga0501035_0238372 | |||
| 648 | Ga0501035_0243380 | |||
| 649 | Ga0501035_0256127 | |||
| 650 | Ga0501044_0009780 | |||
| 651 | Ga0501044_0013102 | |||
| 652 | Ga0501044_0030576 | |||
| 653 | Ga0501044_0147434 | |||
| 654 | Ga0501044_0209316 | |||
| 655 | Ga0501044_0212835 | |||
| 656 | Ga0501045_0026003 | |||
| 657 | nmdc:mga0yw44_108058_c1 | |||
| 658 | nmdc:mga0yw44_4158_c1 | |||
| 659 | nmdc:mga0k408_13735_c1 | |||
| 660 | nmdc:mga06z11_32308_c1 | |||
| 661 | nmdc:mga08y16_235084_c1 | |||
| 662 | nmdc:mga0sz30_33457_c1 | |||
| 663 | Ga0495619_0024530 | |||
| 664 | Ga0500578_0020798 | |||
| 665 | Ga0500578_0123415 | |||
| 666 | Ga0500644_0009573 | |||
| 667 | Ga0500651_0007613 | |||
| 668 | Ga0500651_0012611 | |||
| 669 | Ga0500651_0132784 | |||
| 670 | Ga0500641_0005289 | |||
| 671 | Ga0500641_0026627 | |||
| 672 | Ga0500572_065346 | |||
| 673 | Ga0500594_0017291 | |||
| 674 | Ga0500595_000382 | |||
| 675 | Ga0500595_000409 | |||
| 676 | Ga0500595_003722 | |||
| 677 | Ga0500595_010342 | |||
| 678 | Ga0500595_028853 | |||
| 679 | Ga0500642_0004649 | |||
| 680 | Ga0500652_000006 | |||
| 681 | Ga0500568_0033164 | |||
| 682 | Ga0500573_0000004 | |||
| 683 | Ga0500588_0002294 | |||
| 684 | Ga0500588_0084834 | |||
| 685 | Ga0500600_0005308 | |||
| 686 | Ga0500604_0015120 | |||
| 687 | Ga0500616_0002303 | |||
| 688 | Ga0500622_0002891 | |||
| 689 | Ga0501084_0003714 | |||
| 690 | Ga0501084_0009978 | |||
| 691 | Ga0500661_019839 | |||
| 692 | Ga0501082_0046482 | |||
| 693 | Ga0501082_0271384 | |||
| 694 | 2511253448 | |||
| 695 | 2739256973 | |||
| 696 | 2852651767 | |||
| 697 | 2881716965 | |||
| 698 | 2923516833 | |||
| 699 | 2941479488 | |||
| 700 | 3005477875 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1ve5-assembly1.cif.gz_B | crystal structure of t.th. hb8 threonine deaminase | 0.9723 | 13 | 323 |
| 1ve5-assembly1.cif.gz_A | crystal structure of t.th. hb8 threonine deaminase | 0.9588 | 13 | 323 |
| 2gn2-assembly1.cif.gz_A | crystal structure of tetrameric biodegradative threonine deaminase (tdcb) from salmonella typhimurium in complex with cmp at 2.5a resolution (hexagonal form) | 0.9568 | 10 | 330 |
| 1ve5-assembly1.cif.gz_B | crystal structure of t.th. hb8 threonine deaminase | 0.9563 | 13 | 323 |
| 2zpu-assembly1.cif.gz_A | crystal structure of modified serine racemase from s.pombe. | 0.9445 | 12 | 333 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1wtcA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9662 | 12 | 333 | 3.40.50.1100 |
| 5ybwB02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9628 | 62 | 154 | 3.40.50.1100 |
| 1ve5C01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9616 | 13 | 320 | 3.40.50.1100 |
| 1ve5B02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9562 | 61 | 157 | 3.40.50.1100 |
| af_P36007_52_148_3.40.50.1100 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9535 | 61 | 157 | 3.40.50.1100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2E9E2U5-F1-model_v4 | Pyridoxal-5'-phosphate-dependent protein | 0.9846 | 12 | 333 |
GO:0000287
GO:0003941 GO:0005524 GO:0018114 GO:0030170 GO:0030378 GO:0070179 |
| AF-A0A1Z9FA77-F1-model_v4 | deleted | 0.9781 | 12 | 330 |
|
| AF-A0A7Y2XZN8-F1-model_v4 | Threonine/serine dehydratase | 0.9725 | 79 | 332 |
GO:0000287
GO:0003941 GO:0005524 GO:0016846 GO:0018114 GO:0030170 GO:0030378 GO:0070179 |
| AF-A0A3M5DCC1-F1-model_v4 | Tryptophan synthase beta chain-like PALP domain-containing protein | 0.9713 | 12 | 331 |
GO:0000287
GO:0003941 GO:0005524 GO:0008721 GO:0018114 GO:0030170 GO:0030378 |
| AF-A0A2E9E2U5-F1-model_v4 | Pyridoxal-5'-phosphate-dependent protein | 0.9697 | 12 | 333 |
GO:0000287
GO:0003941 GO:0005524 GO:0018114 GO:0030170 GO:0030378 GO:0070179 |