F418392

General Info

Members Datasets Scaffolds Average Seq Length
350 218 700 325

Family's Representative Sequence

Representative Sequence 3300048924|Ga0496121_0004284|Ga0496121_0004284_5578_6669
Length 363
Sequence MADNGTASAVGAESRASIGAATAAACSGSQPDLEAIQRAAARIQGHVVKTPLLRSAELDALAGGRVFLKAESLQRSGSFKFRGACNRILGLSQAERARGVVAYSSGNHALAVSEAGRLLDVPVAVVMPADAPAIKIQGCRARGATVLLYDRERDDREAIGQRMVEDQGMTLVPPFDDAQVMAGAGTGALEALEQMRGRAVDTALLCCSGGGLAAGWAIALRAAWPRVHIVVVEPEGFDDTGRSLRAGLPQHNARRSGSIQDALLAPMPGRLTLPVLREHAATGVAVSDDETLAAMAFAFSSLKLVLEPGGAAALAAVLAHKVVLAGRSTLVVCSGGNVDPELFVRSLQRGSASQAAAPAGVRP

Samples

Sample ID Description Type Environment
1 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
26 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
40 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
41 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
42 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
46 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
47 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
48 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
49 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
50 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
51 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
52 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
53 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
54 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
75 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
78 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
79 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
80 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
81 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
82 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
83 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
84 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
85 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
86 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
87 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
88 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
89 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
90 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
91 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
92 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
93 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
94 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
95 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
96 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
97 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
98 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
99 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
100 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
101 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
102 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
103 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
104 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
105 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
106 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
107 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
108 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
109 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
110 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
111 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
112 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
113 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
114 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
115 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
116 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
117 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
118 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
119 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
120 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
121 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
122 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
123 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
124 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
125 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
126 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
127 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
128 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
129 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
130 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
131 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
132 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
133 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
134 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
135 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
136 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
137 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
138 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
139 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
140 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
141 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
142 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
143 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
144 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
145 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
146 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
147 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
148 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
149 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
150 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
151 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
152 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
153 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
154 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
155 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
156 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
157 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
171 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
172 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
173 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
174 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
175 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
176 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
177 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
178 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
179 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
180 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
181 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
182 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
183 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
184 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
187 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
188 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
189 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
190 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
191 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
192 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
193 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
194 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
195 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
196 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
197 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
198 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
199 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
200 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
201 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
202 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
203 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
204 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
205 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
206 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
207 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
208 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
209 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
210 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
211 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
212 2511231004 Pseudomonas sp. GM102 Isolate Nodule
213 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
214 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
215 2881714928 Pseudidiomarina mangrovi ZQ330 Isolate Rhizosphere
216 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
217 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
218 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98
Metatranscriptomes 0
Isolates 2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12
Nodule 0.57
Rhizoplane 7.14
Rhizosphere 67.71
Stem 0
Stem Tuber 0
Unclassified 1.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496121_0004284 3300048924 Bacteria 19354
2 JGI25153J46596_10000193 3300003215 Bacteria 58625
3 JGI25153J46596_10004148 3300003215 Bacteria 7872
4 Ga0065714_10003571 3300005288 Bacteria 6691
5 Ga0070658_10012089 3300005327 Bacteria 6930
6 Ga0070676_10060245 3300005328 Bacteria 2254
7 Ga0070666_10000157 3300005335 Bacteria 46885
8 Ga0070666_10031551 3300005335 Bacteria 3497
9 Ga0070666_10169631 3300005335 Bacteria 1528
10 Ga0068868_100135430 3300005338 Bacteria 2019
11 Ga0070660_100050347 3300005339 Bacteria 3205
12 Ga0070660_100078221 3300005339 Bacteria 2593
13 Ga0070675_100108540 3300005354 Bacteria 2344
14 Ga0070671_100015774 3300005355 Bacteria 6105
15 Ga0070673_100129034 3300005364 Bacteria 2119
16 Ga0070667_100016213 3300005367 Bacteria 6165
17 Ga0070667_100172487 3300005367 Bacteria 1910
18 Ga0070663_100063308 3300005455 Bacteria 2670
19 Ga0070662_100116533 3300005457 Bacteria 2042
20 Ga0070681_10021444 3300005458 Bacteria 6477
21 Ga0068867_100131656 3300005459 Bacteria 1944
22 Ga0070706_100179126 3300005467 Bacteria 1979
23 Ga0070698_100204516 3300005471 Bacteria 1910
24 Ga0068853_100042800 3300005539 Bacteria 3874
25 Ga0068853_100059936 3300005539 Bacteria 3288
26 Ga0068853_100269019 3300005539 Bacteria 1569
27 Ga0068853_100280286 3300005539 Bacteria 1537
28 Ga0070665_100016047 3300005548 Bacteria 7519
29 Ga0070665_100042218 3300005548 Bacteria 4584
30 Ga0070665_100050324 3300005548 Bacteria 4181
31 Ga0070665_100109311 3300005548 Bacteria 2767
32 Ga0068855_100076004 3300005563 Bacteria 3899
33 Ga0070664_100107050 3300005564 Bacteria 2437
34 Ga0070664_100362503 3300005564 Bacteria 1320
35 Ga0068863_100334663 3300005841 Bacteria 1472
36 Ga0068858_100057806 3300005842 Bacteria 3585
37 Ga0068862_100009008 3300005844 Bacteria 8261
38 Ga0081540_1000003 3300005983 Bacteria 233942
39 Ga0070717_10061845 3300006028 Bacteria 3104
40 Ga0075365_10028759 3300006038 Bacteria 3546
41 Ga0075363_100152448 3300006048 Bacteria 1305
42 Ga0070712_100011336 3300006175 Bacteria 5648
43 Ga0075367_10043544 3300006178 Bacteria 2629
44 Ga0097621_100000492 3300006237 Bacteria 27684
45 Ga0068871_100097137 3300006358 Bacteria 2462
46 Ga0105240_10068288 3300009093 Unclassified 4402
47 Ga0105240_10095491 3300009093 Bacteria 3625
48 Ga0105240_10504628 3300009093 Bacteria 1344
49 Ga0105245_10015670 3300009098 Bacteria 6611
50 Ga0105245_10024690 3300009098 Bacteria 5280
51 Ga0105237_10033741 3300009545 Bacteria 5185
52 Ga0105237_10148693 3300009545 Bacteria 2338
53 Ga0105249_10158303 3300009553 Bacteria 2186
54 Ga0105239_10060818 3300010375 Bacteria 4145
55 Ga0105239_10248902 3300010375 Bacteria 1996
56 Ga0157371_10000368 3300013102 Bacteria 56863
57 Ga0157371_10005040 3300013102 Bacteria 11299
58 Ga0157370_10226328 3300013104 Bacteria 1731
59 Ga0157378_10007672 3300013297 Bacteria 9419
60 Ga0157378_10500832 3300013297 Bacteria 1213
61 Ga0163162_10000004 3300013306 Bacteria 505593
62 Ga0163162_10042602 3300013306 Bacteria 4544
63 Ga0157375_10073259 3300013308 Bacteria 3444
64 Ga0163163_10000007 3300014325 Bacteria 288439
65 Ga0163163_10373833 3300014325 Bacteria 1482
66 Ga0157380_10109950 3300014326 Bacteria 2314
67 Ga0182008_10000450 3300014497 Bacteria 31363
68 Ga0157379_10010181 3300014968 Bacteria 8192
69 Ga0157379_10028847 3300014968 Bacteria 4936
70 Ga0182007_10000019 3300015262 Bacteria 194770
71 Ga0182005_1000306 3300015265 Bacteria 29558
72 Ga0163161_10000463 3300017792 Bacteria 33681
73 Ga0163161_10143154 3300017792 Bacteria 1811
74 Ga0213876_10004697 3300021384 Bacteria 7603
75 Ga0209025_1002254 3300025294 Bacteria 21168
76 Ga0209758_1000005 3300025297 Bacteria 1368918
77 Ga0209758_1000085 3300025297 Bacteria 256191
78 Ga0209758_1002244 3300025297 Bacteria 20051
79 Ga0209758_1033649 3300025297 Bacteria 2054
80 Ga0209257_1002600 3300025304 Bacteria 17507
81 Ga0207656_10031811 3300025321 Bacteria 2188
82 Ga0207680_10000131 3300025903 Bacteria 35070
83 Ga0207680_10017882 3300025903 Bacteria 3754
84 Ga0207645_10064258 3300025907 Bacteria 2345
85 Ga0207705_10090894 3300025909 Bacteria 2235
86 Ga0207705_10378144 3300025909 Unclassified 1094
87 Ga0207695_10069191 3300025913 Bacteria 3613
88 Ga0207695_10270142 3300025913 Bacteria 1596
89 Ga0207671_10019144 3300025914 Bacteria 5240
90 Ga0207693_10133357 3300025915 Bacteria 1952
91 Ga0207657_10012368 3300025919 Bacteria 8430
92 Ga0207657_10108730 3300025919 Bacteria 2292
93 Ga0207687_10050155 3300025927 Bacteria 2904
94 Ga0207687_10089889 3300025927 Bacteria 2237
95 Ga0207644_10071990 3300025931 Bacteria 2530
96 Ga0207711_10048250 3300025941 Bacteria 3643
97 Ga0207689_10153848 3300025942 Bacteria 1896
98 Ga0207689_10314645 3300025942 Bacteria 1299
99 Ga0207679_10242113 3300025945 Bacteria 1529
100 Ga0207651_10026443 3300025960 Bacteria 3626
101 Ga0207651_10218126 3300025960 Bacteria 1540
102 Ga0207677_10100664 3300026023 Bacteria 2125
103 Ga0207639_10115425 3300026041 Bacteria 2196
104 Ga0207678_10120170 3300026067 Bacteria 2242
105 Ga0207641_10348041 3300026088 Bacteria 1412
106 Ga0207648_10148878 3300026089 Bacteria 2065
107 Ga0207428_10004619 3300027907 Bacteria 13055
108 Ga0207428_10197636 3300027907 Unclassified 1514
109 Ga0268266_10032202 3300028379 Bacteria 4455
110 Ga0268266_10035213 3300028379 Bacteria 4259
111 Ga0268266_10059554 3300028379 Bacteria 3290
112 Ga0268265_10003519 3300028380 Bacteria 11212
113 Ga0265318_10004133 3300028577 Bacteria 7104
114 Ga0307515_10212381 3300028794 Bacteria 1776
115 Ga0265338_10303578 3300028800 Bacteria 1160
116 Ga0265330_10152766 3300031235 Bacteria 981
117 Ga0265332_10000603 3300031238 Bacteria 23587
118 Ga0265332_10028067 3300031238 Bacteria 2465
119 Ga0265325_10002784 3300031241 Bacteria 11672
120 Ga0265325_10029405 3300031241 Bacteria 2954
121 Ga0265340_10000782 3300031247 Bacteria 18030
122 Ga0265339_10011847 3300031249 Bacteria 5349
123 Ga0265331_10014152 3300031250 Bacteria 4260
124 Ga0265316_10079737 3300031344 Bacteria 2512
125 Ga0307513_10153016 3300031456 Bacteria 2212
126 Ga0307513_10161693 3300031456 Bacteria 2131
127 Ga0265313_10001048 3300031595 Bacteria 26907
128 Ga0265313_10008369 3300031595 Bacteria 6882
129 Ga0307508_10100948 3300031616 Bacteria 2481
130 Ga0265314_10009655 3300031711 Bacteria 8126
131 Ga0265314_10018298 3300031711 Bacteria 5466
132 Ga0265314_10025255 3300031711 Bacteria 4487
133 Ga0265314_10121804 3300031711 Bacteria 1641
134 Ga0265342_10000270 3300031712 Bacteria 58343
135 Ga0307413_10065186 3300031824 Bacteria 2267
136 Ga0307414_10058498 3300032004 Bacteria 2716
137 Ga0373943_0031610 3300035170 Bacteria 2512
138 Ga0373943_0035907 3300035170 Bacteria 2372
139 Ga0373927_0057225 3300035695 Bacteria 2521
140 Ga0373947_0005773 3300035725 Bacteria 7221
141 Ga0373947_0069911 3300035725 Bacteria 2150
142 Ga0373925_0215765 3300037068 Bacteria 1530
143 Ga0395900_0157971 3300037418 Bacteria 2315
144 Ga0395898_0012649 3300037466 Bacteria 8723
145 Ga0436364_0439489 3300037853 Bacteria 3921
146 Ga0436364_1269100 3300037853 Bacteria 2686
147 Ga0400483_046415 3300039062 Bacteria 15733
148 Ga0400483_182917 3300039062 Bacteria 5703
149 Ga0436365_1168931 3300039437 Bacteria 1532
150 Ga0436365_1243203 3300039437 Bacteria 6890
151 Ga0436363_0099471 3300039450 Bacteria 5620
152 Ga0439466_0000883 3300041411 Bacteria 11422
153 Ga0439465_0000984 3300041413 Bacteria 9069
154 Ga0451793_0552864 3300041452 Bacteria 1420
155 Ga0451807_2323933 3300041486 Bacteria 1687
156 Ga0439449_0000107 3300042007 Bacteria 27003
157 Ga0439452_002121 3300042010 Bacteria 7511
158 Ga0439462_0021866 3300042015 Bacteria 1673
159 Ga0450922_001951 3300042124 Bacteria 1977
160 Ga0451577_0015763 3300042876 Bacteria 7015
161 Ga0466963_0002473 3300044694 Bacteria 10334
162 Ga0466959_0011439 3300045049 Bacteria 6377
163 Ga0466958_0011758 3300045836 Bacteria 4942
164 Ga0466967_0413477 3300045976 Bacteria 1314
165 Ga0495627_011073 3300046453 Bacteria 3250
166 Ga0495603_0002271 3300046455 Bacteria 11290
167 Ga0495650_0016060 3300046471 Bacteria 3810
168 Ga0495662_0053489 3300046476 Bacteria 1950
169 Ga0495662_0260417 3300046476 Bacteria 854
170 Ga0495594_0011145 3300046499 Bacteria 4667
171 Ga0495630_0099603 3300046517 Bacteria 2199
172 Ga0495648_0109740 3300046524 Bacteria 1504
173 Ga0495663_0040845 3300046525 Bacteria 1410
174 Ga0495640_0031682 3300046533 Bacteria 3771
175 Ga0495609_0104677 3300046538 Bacteria 1224
176 Ga0495622_0002549 3300046557 Bacteria 8803
177 Ga0495656_0010564 3300046615 Bacteria 3360
178 Ga0495656_0016015 3300046615 Bacteria 2839
179 Ga0495636_0024723 3300047318 Bacteria 2437
180 Ga0495681_0107220 3300047470 Bacteria 1214
181 Ga0495602_0200901 3300048088 Bacteria 1521
182 Ga0496102_0001465 3300048905 Bacteria 20862
183 Ga0496103_0073468 3300048906 Bacteria 2142
184 Ga0496104_0022829 3300048907 Bacteria 5749
185 Ga0496104_0450660 3300048907 Bacteria 1198
186 Ga0496105_0040955 3300048908 Bacteria 3818
187 Ga0496105_0062749 3300048908 Bacteria 3067
188 Ga0496105_0166410 3300048908 Bacteria 1809
189 Ga0496105_0178289 3300048908 Bacteria 1740
190 Ga0496106_0002276 3300048909 Bacteria 14319
191 Ga0496107_0019221 3300048910 Bacteria 4820
192 Ga0496107_0039956 3300048910 Bacteria 3367
193 Ga0496108_0079346 3300048911 Bacteria 2779
194 Ga0496109_0000815 3300048912 Bacteria 25975
195 Ga0496109_0003616 3300048912 Bacteria 12925
196 Ga0496109_0298413 3300048912 Bacteria 1519
197 Ga0496110_0000415 3300048913 Bacteria 28977
198 Ga0496110_0000859 3300048913 Bacteria 21434
199 Ga0496111_0083458 3300048914 Bacteria 2334
200 Ga0496113_0058643 3300048916 Bacteria 2897
201 Ga0496113_0213841 3300048916 Bacteria 1535
202 Ga0496114_0075521 3300048917 Bacteria 2839
203 Ga0496115_0016106 3300048918 Bacteria 5685
204 Ga0496115_0418358 3300048918 Bacteria 1086
205 Ga0496116_0032889 3300048919 Bacteria 3689
206 Ga0496116_0081355 3300048919 Bacteria 2008
207 Ga0496117_0021692 3300048920 Bacteria 5184
208 Ga0496117_0077462 3300048920 Bacteria 2200
209 Ga0496117_0121562 3300048920 Bacteria 1603
210 Ga0496118_0030471 3300048921 Bacteria 4501
211 Ga0496118_0053933 3300048921 Bacteria 3050
212 Ga0496118_0096630 3300048921 Bacteria 2013
213 Ga0496119_0000338 3300048922 Bacteria 65446
214 Ga0496119_0029161 3300048922 Bacteria 3749
215 Ga0496120_0000707 3300048923 Bacteria 48949
216 Ga0496121_0001934 3300048924 Bacteria 33033
217 Ga0496121_0252203 3300048924 Bacteria 1223
218 Ga0496121_0267615 3300048924 Bacteria 1176
219 Ga0496122_0035809 3300048925 Bacteria 4029
220 Ga0496123_0050470 3300048926 Bacteria 2779
221 Ga0496123_0070584 3300048926 Bacteria 2185
222 Ga0496124_0008443 3300048927 Bacteria 10773
223 Ga0496124_0144231 3300048927 Bacteria 1875
224 Ga0496124_0206058 3300048927 Bacteria 1491
225 Ga0496125_0001351 3300048928 Bacteria 36185
226 Ga0496125_0002400 3300048928 Bacteria 24387
227 Ga0496125_0014694 3300048928 Bacteria 7609
228 Ga0496125_0046143 3300048928 Bacteria 3658
229 Ga0496125_0048041 3300048928 Bacteria 3562
230 Ga0496125_0091890 3300048928 Bacteria 2271
231 Ga0496125_0100145 3300048928 Bacteria 2137
232 Ga0496126_0000532 3300048929 Bacteria 73699
233 Ga0496126_0089412 3300048929 Bacteria 2711
234 Ga0496126_0144723 3300048929 Bacteria 2043
235 Ga0495682_0050526 3300049460 Unclassified 1513
236 Ga0501300_008473 3300049523 Bacteria 1507
237 Ga0501031_0010845 3300049568 Bacteria 5934
238 Ga0501032_0005636 3300049569 Bacteria 9277
239 Ga0501032_0007561 3300049569 Bacteria 7935
240 Ga0501033_0019930 3300049570 Bacteria 5069
241 Ga0501033_0040821 3300049570 Bacteria 3464
242 Ga0501034_0000632 3300049571 Bacteria 54605
243 Ga0501034_0020052 3300049571 Bacteria 6828
244 Ga0501034_0120306 3300049571 Bacteria 2612
245 Ga0501036_0000888 3300049572 Bacteria 22365
246 Ga0501036_0032515 3300049572 Bacteria 4408
247 Ga0501036_0213296 3300049572 Bacteria 1622
248 Ga0501037_0036575 3300049573 Bacteria 3618
249 Ga0501037_0108676 3300049573 Bacteria 1998
250 Ga0501038_0010037 3300049574 Bacteria 8671
251 Ga0501038_0068144 3300049574 Bacteria 3026
252 Ga0501038_0068657 3300049574 Bacteria 3012
253 Ga0501039_0004710 3300049575 Bacteria 10327
254 Ga0501042_0017294 3300049578 Bacteria 4971
255 Ga0501043_0005312 3300049579 Bacteria 10408
256 Ga0501043_0015766 3300049579 Bacteria 5925
257 Ga0501043_0049373 3300049579 Bacteria 3308
258 Ga0501046_0002393 3300049580 Bacteria 17631
259 Ga0501046_0006623 3300049580 Bacteria 10227
260 Ga0501046_0024284 3300049580 Bacteria 4974
261 Ga0501046_0039142 3300049580 Bacteria 3799
262 Ga0501047_0000479 3300049581 Bacteria 43519
263 Ga0501047_0006301 3300049581 Bacteria 11159
264 Ga0501047_0008181 3300049581 Bacteria 9878
265 Ga0501047_0036049 3300049581 Bacteria 4779
266 Ga0501047_0243841 3300049581 Bacteria 1647
267 Ga0501048_0001062 3300049582 Bacteria 20570
268 Ga0501048_0056780 3300049582 Bacteria 2777
269 Ga0501048_0060828 3300049582 Bacteria 2676
270 Ga0501048_0114165 3300049582 Bacteria 1908
271 Ga0501067_0019674 3300049583 Bacteria 3737
272 Ga0501068_0009937 3300049584 Bacteria 5333
273 Ga0501068_0022017 3300049584 Bacteria 3725
274 Ga0501069_0002144 3300049585 Bacteria 9938
275 Ga0501069_0019353 3300049585 Bacteria 3680
276 Ga0501070_0003897 3300049586 Bacteria 12874
277 Ga0501070_0023144 3300049586 Bacteria 5204
278 Ga0501070_0053589 3300049586 Bacteria 3345
279 Ga0501070_0083046 3300049586 Bacteria 2652
280 Ga0501071_0026610 3300049587 Bacteria 4062
281 Ga0501072_0317337 3300049588 Bacteria 1238
282 Ga0501073_0004505 3300049589 Bacteria 10467
283 Ga0501073_0010808 3300049589 Bacteria 6686
284 Ga0501073_0130309 3300049589 Bacteria 1743
285 Ga0501073_0242820 3300049589 Bacteria 1244
286 Ga0501074_0005128 3300049590 Bacteria 9413
287 Ga0501076_0280866 3300049592 Bacteria 1364
288 Ga0501079_0028552 3300049741 Bacteria 4282
289 Ga0501080_0021740 3300049742 Bacteria 5943
290 Ga0501080_0027040 3300049742 Bacteria 5334
291 Ga0501083_0026739 3300049744 Bacteria 3986
292 Ga0501083_0038036 3300049744 Bacteria 3272
293 Ga0501083_0042006 3300049744 Bacteria 3100
294 Ga0501265_000892 3300049762 Bacteria 3337
295 Ga0501275_000032 3300049772 Bacteria 14501
296 Ga0501035_0007010 3300049822 Bacteria 10529
297 Ga0501035_0238372 3300049822 Bacteria 1548
298 Ga0501035_0243380 3300049822 Bacteria 1529
299 Ga0501035_0256127 3300049822 Bacteria 1485
300 Ga0501044_0009780 3300049823 Bacteria 10429
301 Ga0501044_0013102 3300049823 Bacteria 8975
302 Ga0501044_0030576 3300049823 Bacteria 5674
303 Ga0501044_0147434 3300049823 Bacteria 2337
304 Ga0501044_0209316 3300049823 Bacteria 1905
305 Ga0501044_0212835 3300049823 Bacteria 1886
306 Ga0501045_0026003 3300049824 Bacteria 4208
307 nmdc:mga0yw44_108058_c1 3300050492 Bacteria 1780
308 nmdc:mga0yw44_4158_c1 3300050492 Bacteria 6577
309 nmdc:mga0k408_13735_c1 3300050493 Bacteria 4447
310 nmdc:mga06z11_32308_c1 3300050494 Bacteria 2551
311 nmdc:mga08y16_235084_c1 3300050511 Bacteria 1895
312 nmdc:mga0sz30_33457_c1 3300050516 Bacteria 2137
313 Ga0495619_0024530 3300053085 Bacteria 3868
314 Ga0500578_0020798 3300053086 Bacteria 4219
315 Ga0500578_0123415 3300053086 Bacteria 1627
316 Ga0500644_0009573 3300053088 Bacteria 2597
317 Ga0500651_0007613 3300053093 Bacteria 6334
318 Ga0500651_0012611 3300053093 Bacteria 5125
319 Ga0500651_0132784 3300053093 Bacteria 1505
320 Ga0500641_0005289 3300053096 Bacteria 4570
321 Ga0500641_0026627 3300053096 Bacteria 2246
322 Ga0500572_065346 3300053111 Bacteria 1114
323 Ga0500594_0017291 3300053118 Bacteria 1764
324 Ga0500595_000382 3300053119 Bacteria 28614
325 Ga0500595_000409 3300053119 Bacteria 27453
326 Ga0500595_003722 3300053119 Bacteria 7033
327 Ga0500595_010342 3300053119 Bacteria 3713
328 Ga0500595_028853 3300053119 Bacteria 1888
329 Ga0500642_0004649 3300053130 Bacteria 4326
330 Ga0500652_000006 3300053131 Bacteria 167437
331 Ga0500568_0033164 3300053139 Bacteria 2120
332 Ga0500573_0000004 3300053140 Bacteria 341236
333 Ga0500588_0002294 3300053146 Bacteria 3860
334 Ga0500588_0084834 3300053146 Bacteria 1066
335 Ga0500600_0005308 3300053149 Bacteria 7604
336 Ga0500604_0015120 3300053151 Bacteria 2109
337 Ga0500616_0002303 3300053153 Bacteria 16147
338 Ga0500622_0002891 3300053156 Bacteria 11989
339 Ga0501084_0003714 3300054114 Bacteria 12396
340 Ga0501084_0009978 3300054114 Bacteria 7848
341 Ga0500661_019839 3300055283 Bacteria 1196
342 Ga0501082_0046482 3300060353 Bacteria 3741
343 Ga0501082_0271384 3300060353 Bacteria 1476
344 2511253448 2511231004 Bacteria 6669789
345 2739256973 2738543015 Bacteria 6750701
346 2852651767 2852649853 Bacteria 4036942
347 2881716965 2881714928 Bacteria 2469486
348 2923516833 2923516293 Bacteria 3716336
349 2941479488 2941475908 Bacteria 4145589
350 3005477875 3005474847 Bacteria 9259049
351 Ga0496121_0004284
352 JGI25153J46596_10000193
353 JGI25153J46596_10004148
354 Ga0065714_10003571
355 Ga0070658_10012089
356 Ga0070676_10060245
357 Ga0070666_10000157
358 Ga0070666_10031551
359 Ga0070666_10169631
360 Ga0068868_100135430
361 Ga0070660_100050347
362 Ga0070660_100078221
363 Ga0070675_100108540
364 Ga0070671_100015774
365 Ga0070673_100129034
366 Ga0070667_100016213
367 Ga0070667_100172487
368 Ga0070663_100063308
369 Ga0070662_100116533
370 Ga0070681_10021444
371 Ga0068867_100131656
372 Ga0070706_100179126
373 Ga0070698_100204516
374 Ga0068853_100042800
375 Ga0068853_100059936
376 Ga0068853_100269019
377 Ga0068853_100280286
378 Ga0070665_100016047
379 Ga0070665_100042218
380 Ga0070665_100050324
381 Ga0070665_100109311
382 Ga0068855_100076004
383 Ga0070664_100107050
384 Ga0070664_100362503
385 Ga0068863_100334663
386 Ga0068858_100057806
387 Ga0068862_100009008
388 Ga0081540_1000003
389 Ga0070717_10061845
390 Ga0075365_10028759
391 Ga0075363_100152448
392 Ga0070712_100011336
393 Ga0075367_10043544
394 Ga0097621_100000492
395 Ga0068871_100097137
396 Ga0105240_10068288
397 Ga0105240_10095491
398 Ga0105240_10504628
399 Ga0105245_10015670
400 Ga0105245_10024690
401 Ga0105237_10033741
402 Ga0105237_10148693
403 Ga0105249_10158303
404 Ga0105239_10060818
405 Ga0105239_10248902
406 Ga0157371_10000368
407 Ga0157371_10005040
408 Ga0157370_10226328
409 Ga0157378_10007672
410 Ga0157378_10500832
411 Ga0163162_10000004
412 Ga0163162_10042602
413 Ga0157375_10073259
414 Ga0163163_10000007
415 Ga0163163_10373833
416 Ga0157380_10109950
417 Ga0182008_10000450
418 Ga0157379_10010181
419 Ga0157379_10028847
420 Ga0182007_10000019
421 Ga0182005_1000306
422 Ga0163161_10000463
423 Ga0163161_10143154
424 Ga0213876_10004697
425 Ga0209025_1002254
426 Ga0209758_1000005
427 Ga0209758_1000085
428 Ga0209758_1002244
429 Ga0209758_1033649
430 Ga0209257_1002600
431 Ga0207656_10031811
432 Ga0207680_10000131
433 Ga0207680_10017882
434 Ga0207645_10064258
435 Ga0207705_10090894
436 Ga0207705_10378144
437 Ga0207695_10069191
438 Ga0207695_10270142
439 Ga0207671_10019144
440 Ga0207693_10133357
441 Ga0207657_10012368
442 Ga0207657_10108730
443 Ga0207687_10050155
444 Ga0207687_10089889
445 Ga0207644_10071990
446 Ga0207711_10048250
447 Ga0207689_10153848
448 Ga0207689_10314645
449 Ga0207679_10242113
450 Ga0207651_10026443
451 Ga0207651_10218126
452 Ga0207677_10100664
453 Ga0207639_10115425
454 Ga0207678_10120170
455 Ga0207641_10348041
456 Ga0207648_10148878
457 Ga0207428_10004619
458 Ga0207428_10197636
459 Ga0268266_10032202
460 Ga0268266_10035213
461 Ga0268266_10059554
462 Ga0268265_10003519
463 Ga0265318_10004133
464 Ga0307515_10212381
465 Ga0265338_10303578
466 Ga0265330_10152766
467 Ga0265332_10000603
468 Ga0265332_10028067
469 Ga0265325_10002784
470 Ga0265325_10029405
471 Ga0265340_10000782
472 Ga0265339_10011847
473 Ga0265331_10014152
474 Ga0265316_10079737
475 Ga0307513_10153016
476 Ga0307513_10161693
477 Ga0265313_10001048
478 Ga0265313_10008369
479 Ga0307508_10100948
480 Ga0265314_10009655
481 Ga0265314_10018298
482 Ga0265314_10025255
483 Ga0265314_10121804
484 Ga0265342_10000270
485 Ga0307413_10065186
486 Ga0307414_10058498
487 Ga0373943_0031610
488 Ga0373943_0035907
489 Ga0373927_0057225
490 Ga0373947_0005773
491 Ga0373947_0069911
492 Ga0373925_0215765
493 Ga0395900_0157971
494 Ga0395898_0012649
495 Ga0436364_0439489
496 Ga0436364_1269100
497 Ga0400483_046415
498 Ga0400483_182917
499 Ga0436365_1168931
500 Ga0436365_1243203
501 Ga0436363_0099471
502 Ga0439466_0000883
503 Ga0439465_0000984
504 Ga0451793_0552864
505 Ga0451807_2323933
506 Ga0439449_0000107
507 Ga0439452_002121
508 Ga0439462_0021866
509 Ga0450922_001951
510 Ga0451577_0015763
511 Ga0466963_0002473
512 Ga0466959_0011439
513 Ga0466958_0011758
514 Ga0466967_0413477
515 Ga0495627_011073
516 Ga0495603_0002271
517 Ga0495650_0016060
518 Ga0495662_0053489
519 Ga0495662_0260417
520 Ga0495594_0011145
521 Ga0495630_0099603
522 Ga0495648_0109740
523 Ga0495663_0040845
524 Ga0495640_0031682
525 Ga0495609_0104677
526 Ga0495622_0002549
527 Ga0495656_0010564
528 Ga0495656_0016015
529 Ga0495636_0024723
530 Ga0495681_0107220
531 Ga0495602_0200901
532 Ga0496102_0001465
533 Ga0496103_0073468
534 Ga0496104_0022829
535 Ga0496104_0450660
536 Ga0496105_0040955
537 Ga0496105_0062749
538 Ga0496105_0166410
539 Ga0496105_0178289
540 Ga0496106_0002276
541 Ga0496107_0019221
542 Ga0496107_0039956
543 Ga0496108_0079346
544 Ga0496109_0000815
545 Ga0496109_0003616
546 Ga0496109_0298413
547 Ga0496110_0000415
548 Ga0496110_0000859
549 Ga0496111_0083458
550 Ga0496113_0058643
551 Ga0496113_0213841
552 Ga0496114_0075521
553 Ga0496115_0016106
554 Ga0496115_0418358
555 Ga0496116_0032889
556 Ga0496116_0081355
557 Ga0496117_0021692
558 Ga0496117_0077462
559 Ga0496117_0121562
560 Ga0496118_0030471
561 Ga0496118_0053933
562 Ga0496118_0096630
563 Ga0496119_0000338
564 Ga0496119_0029161
565 Ga0496120_0000707
566 Ga0496121_0001934
567 Ga0496121_0252203
568 Ga0496121_0267615
569 Ga0496122_0035809
570 Ga0496123_0050470
571 Ga0496123_0070584
572 Ga0496124_0008443
573 Ga0496124_0144231
574 Ga0496124_0206058
575 Ga0496125_0001351
576 Ga0496125_0002400
577 Ga0496125_0014694
578 Ga0496125_0046143
579 Ga0496125_0048041
580 Ga0496125_0091890
581 Ga0496125_0100145
582 Ga0496126_0000532
583 Ga0496126_0089412
584 Ga0496126_0144723
585 Ga0495682_0050526
586 Ga0501300_008473
587 Ga0501031_0010845
588 Ga0501032_0005636
589 Ga0501032_0007561
590 Ga0501033_0019930
591 Ga0501033_0040821
592 Ga0501034_0000632
593 Ga0501034_0020052
594 Ga0501034_0120306
595 Ga0501036_0000888
596 Ga0501036_0032515
597 Ga0501036_0213296
598 Ga0501037_0036575
599 Ga0501037_0108676
600 Ga0501038_0010037
601 Ga0501038_0068144
602 Ga0501038_0068657
603 Ga0501039_0004710
604 Ga0501042_0017294
605 Ga0501043_0005312
606 Ga0501043_0015766
607 Ga0501043_0049373
608 Ga0501046_0002393
609 Ga0501046_0006623
610 Ga0501046_0024284
611 Ga0501046_0039142
612 Ga0501047_0000479
613 Ga0501047_0006301
614 Ga0501047_0008181
615 Ga0501047_0036049
616 Ga0501047_0243841
617 Ga0501048_0001062
618 Ga0501048_0056780
619 Ga0501048_0060828
620 Ga0501048_0114165
621 Ga0501067_0019674
622 Ga0501068_0009937
623 Ga0501068_0022017
624 Ga0501069_0002144
625 Ga0501069_0019353
626 Ga0501070_0003897
627 Ga0501070_0023144
628 Ga0501070_0053589
629 Ga0501070_0083046
630 Ga0501071_0026610
631 Ga0501072_0317337
632 Ga0501073_0004505
633 Ga0501073_0010808
634 Ga0501073_0130309
635 Ga0501073_0242820
636 Ga0501074_0005128
637 Ga0501076_0280866
638 Ga0501079_0028552
639 Ga0501080_0021740
640 Ga0501080_0027040
641 Ga0501083_0026739
642 Ga0501083_0038036
643 Ga0501083_0042006
644 Ga0501265_000892
645 Ga0501275_000032
646 Ga0501035_0007010
647 Ga0501035_0238372
648 Ga0501035_0243380
649 Ga0501035_0256127
650 Ga0501044_0009780
651 Ga0501044_0013102
652 Ga0501044_0030576
653 Ga0501044_0147434
654 Ga0501044_0209316
655 Ga0501044_0212835
656 Ga0501045_0026003
657 nmdc:mga0yw44_108058_c1
658 nmdc:mga0yw44_4158_c1
659 nmdc:mga0k408_13735_c1
660 nmdc:mga06z11_32308_c1
661 nmdc:mga08y16_235084_c1
662 nmdc:mga0sz30_33457_c1
663 Ga0495619_0024530
664 Ga0500578_0020798
665 Ga0500578_0123415
666 Ga0500644_0009573
667 Ga0500651_0007613
668 Ga0500651_0012611
669 Ga0500651_0132784
670 Ga0500641_0005289
671 Ga0500641_0026627
672 Ga0500572_065346
673 Ga0500594_0017291
674 Ga0500595_000382
675 Ga0500595_000409
676 Ga0500595_003722
677 Ga0500595_010342
678 Ga0500595_028853
679 Ga0500642_0004649
680 Ga0500652_000006
681 Ga0500568_0033164
682 Ga0500573_0000004
683 Ga0500588_0002294
684 Ga0500588_0084834
685 Ga0500600_0005308
686 Ga0500604_0015120
687 Ga0500616_0002303
688 Ga0500622_0002891
689 Ga0501084_0003714
690 Ga0501084_0009978
691 Ga0500661_019839
692 Ga0501082_0046482
693 Ga0501082_0271384
694 2511253448
695 2739256973
696 2852651767
697 2881716965
698 2923516833
699 2941479488
700 3005477875

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00291

PALP

Pyridoxal-phosphate dependent enzyme

43

335

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ve5-assembly1.cif.gz_B crystal structure of t.th. hb8 threonine deaminase 0.9723 13 323
1ve5-assembly1.cif.gz_A crystal structure of t.th. hb8 threonine deaminase 0.9588 13 323
2gn2-assembly1.cif.gz_A crystal structure of tetrameric biodegradative threonine deaminase (tdcb) from salmonella typhimurium in complex with cmp at 2.5a resolution (hexagonal form) 0.9568 10 330
1ve5-assembly1.cif.gz_B crystal structure of t.th. hb8 threonine deaminase 0.9563 13 323
2zpu-assembly1.cif.gz_A crystal structure of modified serine racemase from s.pombe. 0.9445 12 333
ID Description Score Start End Superfamily
1wtcA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9662 12 333 3.40.50.1100
5ybwB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9628 62 154 3.40.50.1100
1ve5C01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9616 13 320 3.40.50.1100
1ve5B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9562 61 157 3.40.50.1100
af_P36007_52_148_3.40.50.1100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9535 61 157 3.40.50.1100
ID Description Score Start End GO Terms
AF-A0A2E9E2U5-F1-model_v4 Pyridoxal-5'-phosphate-dependent protein 0.9846 12 333 GO:0000287
GO:0003941
GO:0005524
GO:0018114
GO:0030170
GO:0030378
GO:0070179
AF-A0A1Z9FA77-F1-model_v4 deleted 0.9781 12 330
AF-A0A7Y2XZN8-F1-model_v4 Threonine/serine dehydratase 0.9725 79 332 GO:0000287
GO:0003941
GO:0005524
GO:0016846
GO:0018114
GO:0030170
GO:0030378
GO:0070179
AF-A0A3M5DCC1-F1-model_v4 Tryptophan synthase beta chain-like PALP domain-containing protein 0.9713 12 331 GO:0000287
GO:0003941
GO:0005524
GO:0008721
GO:0018114
GO:0030170
GO:0030378
AF-A0A2E9E2U5-F1-model_v4 Pyridoxal-5'-phosphate-dependent protein 0.9697 12 333 GO:0000287
GO:0003941
GO:0005524
GO:0018114
GO:0030170
GO:0030378
GO:0070179

Map