F418315

General Info

Members Datasets Scaffolds Average Seq Length
350 290 277 320

Family's Representative Sequence

Representative Sequence 3300035172|Ga0373955_0034727|Ga0373955_0034727_269_1375
Length 368
Sequence MAERRKSKCGASAAGRIVGQRFKDGTNQATTKSVLGPAGMEIRETRGVFMEQRRLGSSSLYIPPLVFGGNVLGWSADEATSFRLLDMVVDSGLTAIDTADVYSRWVPGHQGGESETIIGRWLSKRGRRDDLVIMTKVGIEMPGRGKGLSPAWIKRAVEDSLKRLQTDHIDLYQAHRDDETAPLAETLAAFGDLIGAGKVRAIAASNYSAERLEEALATSRANNLPAYVSLQPHYNLMERPPFEDALEAACLRHQLGVIPYYSLAGGFLTGKYRSKADLGKSAARGGSVAKYLDGKGPTVLSALDEVAGATAATPTQVALAWLMARPGITAPIASASKPEQVGDLVKATTLKLSTGQIAVLERASARDG

Samples

Sample ID Description Type Environment
1 2547132181 Kosakonia sacchari SP1 Isolate Stem
2 2561511199 Enterobacter sp. R4-368 Isolate Nodule
3 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
4 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
5 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
6 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
7 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
8 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
9 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
10 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
11 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
12 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
13 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
14 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
15 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
16 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
17 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
18 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
19 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
20 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
21 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
22 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
23 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
24 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
25 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
26 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
27 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
28 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
29 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
30 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
31 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
32 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
33 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
34 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
35 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
36 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
37 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
38 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
39 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
40 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
41 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
42 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
43 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
44 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
45 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
46 2636415599 Klebsiella variicola DX120E Isolate Unclassified
47 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
48 2687453257 Planctomyces sp. SH-PL62 Isolate Unclassified
49 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
50 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
51 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
52 2775507074 Klebsiella sp. D5A Isolate Unclassified
53 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
54 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
55 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
56 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
57 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
58 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
59 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
60 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
61 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
62 2922554459 Rhodococcus sp. 66b Isolate Unclassified
63 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
64 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
65 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
66 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
67 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
68 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
69 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
70 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
71 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
72 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
73 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
74 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
75 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
76 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
77 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
78 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
79 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
80 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
81 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
82 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
83 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
84 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
85 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
86 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
87 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
88 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
89 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
90 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
91 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
92 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
93 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
94 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
95 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
96 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
97 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
98 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
99 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
100 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
101 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
102 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
103 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
104 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
105 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
106 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
107 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
108 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
109 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
110 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
111 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
112 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
113 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
114 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
115 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
116 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
117 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
118 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
119 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
120 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
121 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
122 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
123 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
124 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
125 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
126 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
127 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
128 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
129 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
130 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
131 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
132 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
133 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
134 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
135 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
157 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
159 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
160 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
163 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
164 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
165 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
166 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
167 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
168 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
169 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
170 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
171 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
172 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
173 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
174 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
175 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
176 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
177 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
178 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
179 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
180 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
181 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
182 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
183 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
184 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
185 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
186 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
187 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
188 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
189 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
190 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
191 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
192 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
193 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
194 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
195 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
196 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
197 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
198 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
199 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
200 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
201 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
202 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
203 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
204 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
205 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
206 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
207 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
208 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
209 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
210 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
211 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
212 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
213 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
214 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
215 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
216 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
217 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
218 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
219 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
220 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
221 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
222 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
223 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
224 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
225 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
226 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
227 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
228 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
229 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
230 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
231 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
232 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
233 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
234 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
235 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
236 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
237 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
238 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
239 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
240 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
241 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
242 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
243 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
244 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
245 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
246 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
247 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
248 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
249 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
250 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
251 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
252 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
253 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
254 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
255 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
256 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
257 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
258 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
259 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
260 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
261 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
262 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
263 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
264 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
265 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
267 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
268 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
269 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
270 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
271 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
272 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
273 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
274 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
275 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
276 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
277 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
278 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
279 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
280 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
281 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
282 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
283 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
284 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
285 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
286 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
287 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
288 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
289 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
290 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.14
Metatranscriptomes 0
Isolates 20.86

Biome Distribution

Category Percentage (%)
Aerial Root 0.57
Bulb 0
Endosphere 5.71
Nodule 1.43
Rhizoplane 15.14
Rhizosphere 67.14
Stem 0.29
Stem Tuber 0
Unclassified 9.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10020461 3300002067 Bacteria 2027
2 JGI25407J50210_10001030 3300003373 Bacteria 6105
3 Ga0058692_1002084 3300003856 Bacteria 6899
4 Ga0058692_1010178 3300003856 Bacteria 2333
5 Ga0065704_10005155 3300005289 Bacteria 3577
6 Ga0070658_10002894 3300005327 Bacteria 14247
7 Ga0070690_100042249 3300005330 Bacteria 2887
8 Ga0070677_10001585 3300005333 Bacteria 7197
9 Ga0070666_10000020 3300005335 Bacteria 177564
10 Ga0070682_100099572 3300005337 Bacteria 1917
11 Ga0070687_100006549 3300005343 Bacteria 4780
12 Ga0070661_100016885 3300005344 Bacteria 5167
13 Ga0070661_100072260 3300005344 Bacteria 2539
14 Ga0070669_100007323 3300005353 Bacteria 7915
15 Ga0070667_100020783 3300005367 Bacteria 5453
16 Ga0070709_10018791 3300005434 Bacteria 3988
17 Ga0070713_100071272 3300005436 Bacteria 2936
18 Ga0070701_10106908 3300005438 Bacteria 1558
19 Ga0070700_100048846 3300005441 Bacteria 2624
20 Ga0070685_10000869 3300005466 Bacteria 16396
21 Ga0070706_100367061 3300005467 Bacteria 1341
22 Ga0070707_100503173 3300005468 Bacteria 1173
23 Ga0070699_100010728 3300005518 Bacteria 7927
24 Ga0068853_100003642 3300005539 Bacteria 11812
25 Ga0070696_100128872 3300005546 Bacteria 1839
26 Ga0068857_100039104 3300005577 Bacteria 4201
27 Ga0068856_100387723 3300005614 Bacteria 1417
28 Ga0068852_100037707 3300005616 Bacteria 4055
29 Ga0068859_100006981 3300005617 Bacteria 11465
30 Ga0068870_10001292 3300005840 Bacteria 10074
31 Ga0068863_100059539 3300005841 Bacteria 3613
32 Ga0068860_100014134 3300005843 Bacteria 7829
33 Ga0068860_100049883 3300005843 Bacteria 3986
34 Ga0068862_100017748 3300005844 Bacteria 5922
35 Ga0081455_10002662 3300005937 Bacteria 21123
36 Ga0081538_10001211 3300005981 Bacteria 27089
37 Ga0081539_10007994 3300005985 Bacteria 9396
38 Ga0075368_10056048 3300006042 Bacteria 1572
39 Ga0075363_100004077 3300006048 Bacteria 6328
40 Ga0075364_10084092 3300006051 Bacteria 2107
41 Ga0070715_10072231 3300006163 Bacteria 1544
42 Ga0075362_10069885 3300006177 Bacteria 1602
43 Ga0075367_10011141 3300006178 Bacteria 4745
44 Ga0075366_10071561 3300006195 Bacteria 2066
45 Ga0097621_100299917 3300006237 Bacteria 1419
46 Ga0075370_10010823 3300006353 Bacteria 4781
47 Ga0075370_10029397 3300006353 Bacteria 3061
48 Ga0075370_10088561 3300006353 Bacteria 1784
49 Ga0075431_100257935 3300006847 Bacteria 1770
50 Ga0075434_100013639 3300006871 Bacteria 7745
51 Ga0075434_100144322 3300006871 Bacteria 2401
52 Ga0075434_100292648 3300006871 Bacteria 1648
53 Ga0075429_100264937 3300006880 Bacteria 1505
54 Ga0075436_100076257 3300006914 Bacteria 2321
55 Ga0097620_100006982 3300006931 Bacteria 11465
56 Ga0079104_1000157 3300006946 Bacteria 96925
57 Ga0079104_1001269 3300006946 Bacteria 17510
58 Ga0075435_100052809 3300007076 Bacteria 3275
59 Ga0105251_10000827 3300009011 Bacteria 27696
60 Ga0105251_10021192 3300009011 Bacteria 3398
61 Ga0105244_10000105 3300009036 Bacteria 86528
62 Ga0105250_10000052 3300009092 Bacteria 116382
63 Ga0111539_10006982 3300009094 Bacteria 14489
64 Ga0105245_10155900 3300009098 Bacteria 2163
65 Ga0105245_10518215 3300009098 Bacteria 1210
66 Ga0114129_10117699 3300009147 Bacteria 3660
67 Ga0105241_10052187 3300009174 Bacteria 3121
68 Ga0105241_10144863 3300009174 Bacteria 1938
69 Ga0105238_10002840 3300009551 Bacteria 17279
70 Ga0105239_10289455 3300010375 Bacteria 1845
71 Ga0157369_10001308 3300013105 Bacteria 30944
72 Ga0163162_10001110 3300013306 Bacteria 24973
73 Ga0163162_10003262 3300013306 Bacteria 15526
74 Ga0157379_10036798 3300014968 Bacteria 4364
75 Ga0213876_10000025 3300021384 Bacteria 236747
76 Ga0213876_10000754 3300021384 Bacteria 22379
77 Ga0213871_10000116 3300021441 Bacteria 7696
78 Ga0207696_1000003 3300025711 Bacteria 860639
79 Ga0207655_1000226 3300025728 Bacteria 94688
80 Ga0207692_10106181 3300025898 Bacteria 1550
81 Ga0207680_10000001 3300025903 Bacteria 1091453
82 Ga0207699_10193657 3300025906 Bacteria 1373
83 Ga0207643_10000684 3300025908 Bacteria 21175
84 Ga0207705_10002523 3300025909 Bacteria 14103
85 Ga0207684_10024247 3300025910 Bacteria 5174
86 Ga0207684_10312684 3300025910 Bacteria 1354
87 Ga0207693_10030165 3300025915 Bacteria 4282
88 Ga0207663_10005791 3300025916 Bacteria 6260
89 Ga0207694_10000598 3300025924 Bacteria 32619
90 Ga0207700_10004087 3300025928 Bacteria 8556
91 Ga0207700_10168976 3300025928 Bacteria 1823
92 Ga0207664_10248301 3300025929 Bacteria 1552
93 Ga0207706_10036720 3300025933 Bacteria 4352
94 Ga0207665_10043938 3300025939 Bacteria 2989
95 Ga0207658_10014582 3300025986 Bacteria 5382
96 Ga0207639_10008338 3300026041 Bacteria 7102
97 Ga0207708_10004710 3300026075 Bacteria 10032
98 Ga0207674_10031182 3300026116 Bacteria 5602
99 Ga0207675_100004869 3300026118 Bacteria 12940
100 Ga0207698_10173414 3300026142 Bacteria 1902
101 Ga0209281_1000093 3300027111 Bacteria 240724
102 Ga0209281_1000254 3300027111 Bacteria 105570
103 Ga0209371_1000026 3300027312 Bacteria 449205
104 Ga0209371_1000104 3300027312 Bacteria 148080
105 Ga0209371_1000705 3300027312 Bacteria 28306
106 Ga0209371_1002182 3300027312 Bacteria 11413
107 Ga0209371_1003832 3300027312 Bacteria 6975
108 Ga0209371_1010276 3300027312 Bacteria 2894
109 Ga0209813_10033029 3300027866 Bacteria 1536
110 Ga0207428_10085934 3300027907 Bacteria 2449
111 Ga0268266_10000067 3300028379 Bacteria 241577
112 Ga0268266_10127771 3300028379 Bacteria 2270
113 Ga0268264_10033868 3300028381 Bacteria 4199
114 Ga0268264_10392619 3300028381 Bacteria 1331
115 Ga0265318_10012569 3300028577 Bacteria 3598
116 Ga0265338_10200834 3300028800 Bacteria 1503
117 Ga0268256_1000003 3300030500 Bacteria 1289401
118 Ga0268256_1000017 3300030500 Bacteria 600718
119 Ga0268256_1000604 3300030500 Bacteria 28306
120 Ga0268256_1011026 3300030500 Bacteria 2894
121 Ga0268256_1011065 3300030500 Bacteria 2886
122 Ga0265328_10003103 3300031239 Bacteria 7413
123 Ga0265327_10001733 3300031251 Bacteria 25841
124 Ga0265316_10316839 3300031344 Bacteria 1134
125 Ga0307408_100052693 3300031548 Bacteria 2936
126 Ga0316575_10001995 3300031665 Bacteria 6772
127 Ga0316576_10046060 3300031727 Bacteria 3156
128 Ga0307405_10000574 3300031731 Bacteria 14045
129 Ga0316577_10008206 3300031733 Bacteria 5591
130 Ga0307413_10023685 3300031824 Bacteria 3331
131 Ga0307410_10022180 3300031852 Bacteria 3919
132 Ga0307406_10004275 3300031901 Bacteria 7772
133 Ga0307412_10029251 3300031911 Bacteria 3457
134 Ga0307409_100000170 3300031995 Bacteria 25398
135 Ga0307415_100000136 3300032126 Bacteria 32234
136 Ga0316585_10001040 3300032137 Bacteria 7196
137 Ga0307510_10004002 3300033180 Bacteria 17272
138 Ga0307510_10015076 3300033180 Bacteria 9137
139 Ga0307510_10172045 3300033180 Bacteria 1743
140 Ga0373926_0045337 3300035083 Bacteria 1576
141 Ga0373923_0066265 3300035111 Bacteria 1543
142 Ga0373923_0081423 3300035111 Bacteria 1405
143 Ga0373936_0039021 3300035113 Bacteria 1900
144 Ga0373945_0018696 3300035116 Bacteria 2359
145 Ga0373954_0069133 3300035118 Bacteria 1676
146 Ga0373955_0034727 3300035172 Bacteria 2666
147 Ga0373942_0008417 3300035207 Bacteria 2405
148 Ga0373961_0002587 3300035241 Bacteria 4656
149 Ga0373962_0017905 3300035242 Bacteria 1839
150 Ga0373924_0053118 3300035410 Bacteria 1683
151 Ga0373931_0003421 3300035691 Bacteria 7122
152 Ga0373931_0013626 3300035691 Bacteria 3963
153 Ga0373935_0094832 3300035692 Bacteria 1959
154 Ga0373927_0021327 3300035695 Bacteria 4246
155 Ga0373927_0039354 3300035695 Bacteria 3069
156 Ga0373947_0042393 3300035725 Bacteria 2716
157 Ga0316584_0065578 3300036712 Unclassified 2720
158 Ga0373925_0164970 3300037068 Bacteria 1746
159 Ga0373925_0320036 3300037068 Bacteria 1255
160 Ga0316581_0049079 3300037588 Unclassified 1292
161 Ga0436364_1452345 3300037853 Bacteria 4486
162 Ga0436365_1279401 3300039437 Bacteria 294819
163 Ga0436360_1338344 3300039438 Bacteria 21044
164 Ga0436361_0141542 3300039447 Bacteria 1636
165 Ga0439438_002353 3300041405 Bacteria 8066
166 Ga0439452_000027 3300042010 Bacteria 206086
167 Ga0451577_0027202 3300042876 Bacteria 5176
168 Ga0453683_0124192 3300044673 Bacteria 1625
169 Ga0466963_0003733 3300044694 Bacteria 8764
170 Ga0466963_0052969 3300044694 Bacteria 2694
171 Ga0466963_0089245 3300044694 Bacteria 2097
172 Ga0453684_0048015 3300044712 Bacteria 5652
173 Ga0466971_0017348 3300044719 Bacteria 3184
174 Ga0466957_0030986 3300044842 Bacteria 3195
175 Ga0451576_0313389 3300045051 Bacteria 1641
176 Ga0466967_0002882 3300045976 Bacteria 10944
177 Ga0466967_0022873 3300045976 Bacteria 5111
178 Ga0466967_0023986 3300045976 Bacteria 5008
179 Ga0466967_0221736 3300045976 Bacteria 1797
180 Ga0466967_0325326 3300045976 Bacteria 1484
181 Ga0495629_0002303 3300046459 Bacteria 14729
182 Ga0495629_0132418 3300046459 Bacteria 1737
183 Ga0495641_0013560 3300046461 Bacteria 4467
184 Ga0495651_0122101 3300046462 Bacteria 1912
185 Ga0495651_0211434 3300046462 Bacteria 1349
186 Ga0495653_0044473 3300046463 Bacteria 3446
187 Ga0495653_0058210 3300046463 Bacteria 2938
188 Ga0495650_0000465 3300046471 Bacteria 62638
189 Ga0495580_0049860 3300046472 Bacteria 2961
190 Ga0495582_0009049 3300046473 Bacteria 5494
191 Ga0495582_0184550 3300046473 Bacteria 1189
192 Ga0495662_0170290 3300046476 Bacteria 1073
193 Ga0495630_0018627 3300046517 Bacteria 5102
194 Ga0495648_0091200 3300046524 Bacteria 1705
195 Ga0495652_0129967 3300046529 Bacteria 1995
196 Ga0495652_0140166 3300046529 Bacteria 1902
197 Ga0495654_0075912 3300046530 Bacteria 1584
198 Ga0495665_0003725 3300046531 Bacteria 8266
199 Ga0495640_0069967 3300046533 Bacteria 2359
200 Ga0495640_0148702 3300046533 Bacteria 1506
201 Ga0495587_0099067 3300046536 Bacteria 1680
202 Ga0495667_0108873 3300046559 Bacteria 1790
203 Ga0495668_0000293 3300046616 Bacteria 68641
204 Ga0495634_0037061 3300046642 Bacteria 3333
205 Ga0495625_0003471 3300046660 Bacteria 15661
206 Ga0495635_0301944 3300046663 Bacteria 1073
207 Ga0495658_0005186 3300046683 Bacteria 6407
208 Ga0495613_0018283 3300046689 Bacteria 5226
209 Ga0495649_0000586 3300046694 Bacteria 30569
210 Ga0495600_0117934 3300046809 Bacteria 1727
211 Ga0495600_0206377 3300046809 Bacteria 1260
212 Ga0495581_0005082 3300047315 Bacteria 7619
213 Ga0495604_0051877 3300047317 Bacteria 3178
214 Ga0495604_0098279 3300047317 Bacteria 2157
215 Ga0495676_0038287 3300047321 Bacteria 3983
216 Ga0495676_0214960 3300047321 Bacteria 1328
217 Ga0495680_0071189 3300047322 Bacteria 2648
218 Ga0495680_0177664 3300047322 Bacteria 1538
219 Ga0495679_000019 3300047446 Bacteria 231072
220 Ga0495684_0021135 3300047471 Bacteria 5014
221 Ga0495684_0206581 3300047471 Bacteria 1446
222 Ga0495593_0006627 3300047673 Bacteria 6776
223 Ga0495593_0088917 3300047673 Bacteria 1592
224 Ga0496100_0189992 3300048903 Bacteria 1490
225 Ga0496101_0219717 3300048904 Bacteria 1474
226 Ga0496102_0317205 3300048905 Bacteria 1468
227 Ga0496103_0206927 3300048906 Bacteria 1262
228 Ga0496105_0160090 3300048908 Bacteria 1848
229 Ga0496106_0048615 3300048909 Bacteria 3194
230 Ga0496108_0013651 3300048911 Bacteria 6632
231 Ga0496109_0078058 3300048912 Bacteria 3048
232 Ga0496112_0168233 3300048915 Bacteria 2158
233 Ga0496113_0073959 3300048916 Bacteria 2597
234 Ga0496115_0001767 3300048918 Bacteria 15470
235 Ga0496116_0126659 3300048919 Bacteria 1465
236 Ga0496117_0000672 3300048920 Bacteria 54622
237 Ga0496117_0055907 3300048920 Bacteria 2753
238 Ga0496118_0062276 3300048921 Bacteria 2755
239 Ga0496119_0000062 3300048922 Bacteria 171150
240 Ga0496120_0013526 3300048923 Bacteria 5490
241 Ga0496121_0049091 3300048924 Bacteria 3583
242 Ga0496122_0002833 3300048925 Bacteria 23772
243 Ga0496122_0040585 3300048925 Bacteria 3695
244 Ga0496123_0002705 3300048926 Bacteria 21301
245 Ga0496124_0000971 3300048927 Bacteria 45679
246 Ga0496125_0000413 3300048928 Bacteria 79797
247 Ga0496125_0028919 3300048928 Bacteria 4991
248 Ga0496126_0003059 3300048929 Bacteria 21675
249 Ga0496126_0054790 3300048929 Bacteria 3610
250 Ga0496126_0293409 3300048929 Bacteria 1344
251 Ga0501034_0000555 3300049571 Bacteria 59252
252 Ga0501034_0051817 3300049571 Bacteria 4137
253 Ga0501034_0150648 3300049571 Bacteria 2302
254 Ga0501068_0005363 3300049584 Bacteria 7009
255 Ga0501204_003639 3300049850 Bacteria 1631
256 nmdc:mga03683_62710_c1 3300050489 Bacteria 1575
257 nmdc:mga03n38_12519_c1 3300050490 Bacteria 3195
258 nmdc:mga00v17_28558_c1 3300050491 Bacteria 3267
259 nmdc:mga0k408_75902_c1 3300050493 Bacteria 1964
260 nmdc:mga06z11_6721_c1 3300050494 Bacteria 4700
261 nmdc:mga04h51_39205_c1 3300050495 Bacteria 1538
262 nmdc:mga07m45_11166_c1 3300050496 Bacteria 4713
263 nmdc:mga07m45_88507_c1 3300050496 Bacteria 1772
264 nmdc:mga05p37_147018_c1 3300050507 Bacteria 2884
265 nmdc:mga09592_99151_c1 3300050508 Bacteria 2494
266 nmdc:mga08y16_32173_c1 3300050511 Bacteria 5516
267 nmdc:mga0n895_27397_c1 3300050512 Bacteria 5414
268 nmdc:mga0n895_7878_c1 3300050512 Bacteria 9184
269 nmdc:mga0rr50_94560_c1 3300050513 Bacteria 2334
270 nmdc:mga08x19_63640_c1 3300050514 Bacteria 2393
271 nmdc:mga0a205_36296_c1 3300050515 Bacteria 4735
272 Ga0495601_0062337 3300053077 Bacteria 2368
273 Ga0495612_0109352 3300053078 Bacteria 1182
274 Ga0495619_0080410 3300053085 Bacteria 2193
275 Ga0500573_0021225 3300053140 Bacteria 3721
276 Ga0500616_0020913 3300053153 Bacteria 3674
277 Ga0466962_0073366 3300061719 Bacteria 1635

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037588 Ga0316581_0049079 Ga0316581_0049079_93_1004 272
2 iso_pu_bacteria 2974435778 2974437315 280
3 3300009011 Ga0105251_10021192 Ga0105251_100211922 286
4 3300009036 Ga0105244_10000105 Ga0105244_1000010563 286
5 3300041405 Ga0439438_002353 Ga0439438_002353_3327_4241 286
6 iso_pu_bacteria 2547132181 2547697597 302
7 iso_pu_bacteria 2561511199 2562466242 302
8 iso_pu_bacteria 2599185169 2599412049 302
9 iso_pu_bacteria 2600255254 2601525227 302
10 iso_pu_bacteria 2600255255 2601530414 302
11 iso_pu_bacteria 2600255256 2601531702 302
12 iso_pu_bacteria 2600255257 2601537074 302
13 iso_pu_bacteria 2600255280 2601616982 302
14 iso_pu_bacteria 2600255281 2601621671 302
15 iso_pu_bacteria 2600255287 2601644917 302
16 iso_pu_bacteria 2600255288 2601650605 302
17 iso_pu_bacteria 2600255289 2601654995 302
18 iso_pu_bacteria 2600255290 2601660338 302
19 iso_pu_bacteria 2600255291 2601665113 302
20 iso_pu_bacteria 2600255298 2601697728 302
21 iso_pu_bacteria 2600255299 2601703116 302
22 iso_pu_bacteria 2600255300 2601708185 302
23 iso_pu_bacteria 2600255301 2601713278 302
24 iso_pu_bacteria 2600255302 2601718554 302
25 iso_pu_bacteria 2600255303 2601723277 302
26 iso_pu_bacteria 2600255304 2601728213 302
27 iso_pu_bacteria 2600255305 2601733502 302
28 iso_pu_bacteria 2600255306 2601738197 302
29 iso_pu_bacteria 2600255307 2601742320 302
30 iso_pu_bacteria 2600255309 2601753534 302
31 iso_pu_bacteria 2600255310 2601755420 302
32 iso_pu_bacteria 2600255311 2601760787 302
33 iso_pu_bacteria 2600255392 2602020079 302
34 iso_pu_bacteria 2602042046 2603639169 302
35 iso_pu_bacteria 2602042052 2603661909 302
36 iso_pu_bacteria 2602042053 2603666807 302
37 iso_pu_bacteria 2602042103 2603840615 302
38 iso_pu_bacteria 2602042104 2603845723 302
39 iso_pu_bacteria 2602042105 2603850796 302
40 iso_pu_bacteria 2602042106 2603855832 302
41 iso_pu_bacteria 2602042109 2603866361 302
42 iso_pu_bacteria 2602042110 2603873413 302
43 iso_pu_bacteria 2602042111 2603877537 302
44 iso_pu_bacteria 2603880178 2606050625 302
45 iso_pu_bacteria 2603880184 2606071239 302
46 iso_pu_bacteria 2603880202 2606148309 302
47 iso_pu_bacteria 2603880211 2606178482 302
48 iso_pu_bacteria 2609459761 2609912527 302
49 iso_pu_bacteria 2636415599 2637226797 302
50 iso_pu_bacteria 2675903046 2676407051 302
51 iso_pu_bacteria 2775507074 2777022521 302
52 iso_pu_bacteria 2791355010 2792313662 302
53 iso_pu_bacteria 2811995292 2813730212 302
54 iso_pu_bacteria 2814123068 2814697803 302
55 iso_pu_bacteria 2884086401 2884090110 302
56 iso_pu_bacteria 2904513164 2904515063 302
57 iso_pu_bacteria 2935625433 2935629678 302
58 iso_pu_bacteria 2939607340 2939610834 302
59 iso_pu_bacteria 2939617950 2939622296 302
60 iso_pu_bacteria 2945874760 2945879388 302
61 iso_pu_bacteria 2969079654 2969083780 302
62 iso_pu_bacteria 2984559226 2984560882 302
63 iso_pu_bacteria 2984595703 2984598957 302
64 iso_pu_bacteria 8019504834 8019508655 302
65 iso_pu_bacteria 8055092621 8055096433 302
66 iso_pu_bacteria 8055097453 8055101393 302
67 3300031665 Ga0316575_10001995 Ga0316575_100019958 303
68 3300031733 Ga0316577_10008206 Ga0316577_100082062 303
69 3300032137 Ga0316585_10001040 Ga0316585_100010408 303
70 3300036712 Ga0316584_0065578 Ga0316584_0065578_1040_2053 303
71 3300003856 Ga0058692_1002084 Ga0058692_10020848 306
72 3300003856 Ga0058692_1010178 Ga0058692_10101782 306
73 3300005289 Ga0065704_10005155 Ga0065704_100051553 306
74 3300005614 Ga0068856_100387723 Ga0068856_1003877232 306
75 3300006946 Ga0079104_1000157 Ga0079104_100015789 306
76 3300006946 Ga0079104_1001269 Ga0079104_100126912 306
77 3300009011 Ga0105251_10000827 Ga0105251_1000082710 306
78 3300009092 Ga0105250_10000052 Ga0105250_1000005297 306
79 3300009098 Ga0105245_10518215 Ga0105245_105182151 306
80 3300013105 Ga0157369_10001308 Ga0157369_100013087 306
81 3300021384 Ga0213876_10000025 Ga0213876_10000025148 306
82 3300025711 Ga0207696_1000003 Ga0207696_1000003238 306
83 3300025728 Ga0207655_1000226 Ga0207655_100022662 306
84 3300027111 Ga0209281_1000093 Ga0209281_100009386 306
85 3300027111 Ga0209281_1000254 Ga0209281_100025496 306
86 3300027312 Ga0209371_1000026 Ga0209371_1000026168 306
87 3300027312 Ga0209371_1000104 Ga0209371_100010411 306
88 3300027312 Ga0209371_1000705 Ga0209371_100070525 306
89 3300027312 Ga0209371_1002182 Ga0209371_10021827 306
90 3300027312 Ga0209371_1003832 Ga0209371_10038329 306
91 3300027312 Ga0209371_1010276 Ga0209371_10102762 306
92 3300028577 Ga0265318_10012569 Ga0265318_100125695 306
93 3300030500 Ga0268256_1000003 Ga0268256_1000003168 306
94 3300030500 Ga0268256_1000017 Ga0268256_1000017253 306
95 3300030500 Ga0268256_1000604 Ga0268256_10006046 306
96 3300030500 Ga0268256_1011026 Ga0268256_10110262 306
97 3300030500 Ga0268256_1011065 Ga0268256_10110653 306
98 3300031344 Ga0265316_10316839 Ga0265316_103168392 306
99 3300039437 Ga0436365_1279401 Ga0436365_1279401_209252_210226 306
100 3300042010 Ga0439452_000027 Ga0439452_000027_155135_156109 306
101 3300046530 Ga0495654_0075912 Ga0495654_0075912_212_1186 306
102 3300046660 Ga0495625_0003471 Ga0495625_0003471_10507_11481 306
103 3300047446 Ga0495679_000019 Ga0495679_000019_5992_6966 306
104 3300048908 Ga0496105_0160090 Ga0496105_0160090_226_1200 306
105 3300048919 Ga0496116_0126659 Ga0496116_0126659_225_1199 306
106 3300048920 Ga0496117_0055907 Ga0496117_0055907_1025_1999 306
107 3300048921 Ga0496118_0062276 Ga0496118_0062276_1025_1999 306
108 3300048922 Ga0496119_0000062 Ga0496119_0000062_77550_78524 306
109 3300048923 Ga0496120_0013526 Ga0496120_0013526_778_1752 306
110 3300048925 Ga0496122_0002833 Ga0496122_0002833_11307_12281 306
111 3300048925 Ga0496122_0040585 Ga0496122_0040585_332_1306 306
112 3300048926 Ga0496123_0002705 Ga0496123_0002705_11320_12294 306
113 3300048927 Ga0496124_0000971 Ga0496124_0000971_37795_38769 306
114 3300048928 Ga0496125_0000413 Ga0496125_0000413_11830_12804 306
115 3300048929 Ga0496126_0003059 Ga0496126_0003059_7271_8245 306
116 3300049571 Ga0501034_0051817 Ga0501034_0051817_766_1692 306
117 3300053153 Ga0500616_0020913 Ga0500616_0020913_1545_2471 306
118 iso_pu_bacteria 2775506925 2776374366 306
119 iso_pu_bacteria 2863067949 2863069303 306
120 3300035118 Ga0373954_0069133 Ga0373954_0069133_560_1522 308
121 3300048929 Ga0496126_0293409 Ga0496126_0293409_92_1075 308
122 3300046524 Ga0495648_0091200 Ga0495648_0091200_103_1095 310
123 3300049571 Ga0501034_0000555 Ga0501034_0000555_26404_27381 310
124 3300049584 Ga0501068_0005363 Ga0501068_0005363_4037_5014 310
125 iso_pu_bacteria 2565956761 2566994844 310
126 iso_pu_bacteria 2687453257 2688067036 310
127 iso_pu_bacteria 2738541308 2738892574 310
128 iso_pu_bacteria 2884298095 2884300386 310
129 iso_pu_bacteria 2904535858 2904538366 310
130 iso_pu_bacteria 2922554459 2922557557 310
131 3300003373 JGI25407J50210_10001030 JGI25407J50210_100010307 311
132 3300005330 Ga0070690_100042249 Ga0070690_1000422493 311
133 3300005333 Ga0070677_10001585 Ga0070677_100015853 311
134 3300005343 Ga0070687_100006549 Ga0070687_1000065494 311
135 3300005344 Ga0070661_100072260 Ga0070661_1000722603 311
136 3300005353 Ga0070669_100007323 Ga0070669_1000073236 311
137 3300005438 Ga0070701_10106908 Ga0070701_101069082 311
138 3300005441 Ga0070700_100048846 Ga0070700_1000488462 311
139 3300005466 Ga0070685_10000869 Ga0070685_1000086912 311
140 3300005617 Ga0068859_100006981 Ga0068859_10000698112 311
141 3300005840 Ga0068870_10001292 Ga0068870_100012926 311
142 3300005843 Ga0068860_100014134 Ga0068860_1000141344 311
143 3300005844 Ga0068862_100017748 Ga0068862_1000177482 311
144 3300005981 Ga0081538_10001211 Ga0081538_1000121124 311
145 3300006931 Ga0097620_100006982 Ga0097620_10000698212 311
146 3300009094 Ga0111539_10006982 Ga0111539_100069826 311
147 3300009098 Ga0105245_10155900 Ga0105245_101559002 311
148 3300013306 Ga0163162_10003262 Ga0163162_100032629 311
149 3300014968 Ga0157379_10036798 Ga0157379_100367982 311
150 3300025908 Ga0207643_10000684 Ga0207643_1000068414 311
151 3300025933 Ga0207706_10036720 Ga0207706_100367202 311
152 3300026075 Ga0207708_10004710 Ga0207708_100047109 311
153 3300026118 Ga0207675_100004869 Ga0207675_1000048692 311
154 3300026142 Ga0207698_10173414 Ga0207698_101734142 311
155 3300027907 Ga0207428_10085934 Ga0207428_100859342 311
156 3300028379 Ga0268266_10127771 Ga0268266_101277712 311
157 3300028381 Ga0268264_10392619 Ga0268264_103926191 311
158 3300031251 Ga0265327_10001733 Ga0265327_100017333 311
159 3300031548 Ga0307408_100052693 Ga0307408_1000526933 311
160 3300031731 Ga0307405_10000574 Ga0307405_100005743 311
161 3300031824 Ga0307413_10023685 Ga0307413_100236853 311
162 3300031852 Ga0307410_10022180 Ga0307410_100221802 311
163 3300031901 Ga0307406_10004275 Ga0307406_100042752 311
164 3300031911 Ga0307412_10029251 Ga0307412_100292512 311
165 3300031995 Ga0307409_100000170 Ga0307409_10000017016 311
166 3300032126 Ga0307415_100000136 Ga0307415_10000013615 311
167 3300035691 Ga0373931_0013626 Ga0373931_0013626_2288_3226 311
168 3300045051 Ga0451576_0313389 Ga0451576_0313389_564_1502 311
169 3300047471 Ga0495684_0206581 Ga0495684_0206581_48_1028 311
170 3300050508 nmdc:mga09592_99151_c1 nmdc:mga09592_99151_c1_1170_2108 311
171 3300050511 nmdc:mga08y16_32173_c1 nmdc:mga08y16_32173_c1_2310_3248 311
172 3300050513 nmdc:mga0rr50_94560_c1 nmdc:mga0rr50_94560_c1_592_1530 311
173 iso_pu_bacteria 2622736626 2623586324 311
174 3300005434 Ga0070709_10018791 Ga0070709_100187912 312
175 3300005436 Ga0070713_100071272 Ga0070713_1000712723 312
176 3300005539 Ga0068853_100003642 Ga0068853_1000036428 312
177 3300005577 Ga0068857_100039104 Ga0068857_1000391043 312
178 3300005616 Ga0068852_100037707 Ga0068852_1000377074 312
179 3300025928 Ga0207700_10168976 Ga0207700_101689762 312
180 3300026041 Ga0207639_10008338 Ga0207639_100083383 312
181 3300026116 Ga0207674_10031182 Ga0207674_100311825 312
182 3300033180 Ga0307510_10172045 Ga0307510_101720452 312
183 3300037853 Ga0436364_1452345 Ga0436364_1452345_1557_2504 312
184 3300045976 Ga0466967_0325326 Ga0466967_0325326_131_1075 312
185 3300005467 Ga0070706_100367061 Ga0070706_1003670612 313
186 3300005468 Ga0070707_100503173 Ga0070707_1005031731 313
187 3300006177 Ga0075362_10069885 Ga0075362_100698852 313
188 3300006195 Ga0075366_10071561 Ga0075366_100715613 313
189 3300006353 Ga0075370_10088561 Ga0075370_100885612 313
190 3300006871 Ga0075434_100013639 Ga0075434_1000136394 313
191 3300006871 Ga0075434_100144322 Ga0075434_1001443223 313
192 3300006880 Ga0075429_100264937 Ga0075429_1002649372 313
193 3300009147 Ga0114129_10117699 Ga0114129_101176993 313
194 3300025910 Ga0207684_10024247 Ga0207684_100242472 313
195 3300025910 Ga0207684_10312684 Ga0207684_103126842 313
196 3300031239 Ga0265328_10003103 Ga0265328_100031036 313
197 3300031727 Ga0316576_10046060 Ga0316576_100460601 313
198 3300035695 Ga0373927_0039354 Ga0373927_0039354_1016_1966 313
199 3300045976 Ga0466967_0221736 Ga0466967_0221736_437_1381 313
200 3300046472 Ga0495580_0049860 Ga0495580_0049860_960_1907 313
201 3300049571 Ga0501034_0150648 Ga0501034_0150648_1236_2216 313
202 3300050489 nmdc:mga03683_62710_c1 nmdc:mga03683_62710_c1_162_1112 313
203 3300050493 nmdc:mga0k408_75902_c1 nmdc:mga0k408_75902_c1_668_1684 313
204 3300050496 nmdc:mga07m45_88507_c1 nmdc:mga07m45_88507_c1_615_1565 313
205 3300050507 nmdc:mga05p37_147018_c1 nmdc:mga05p37_147018_c1_1668_2615 313
206 3300050512 nmdc:mga0n895_7878_c1 nmdc:mga0n895_7878_c1_3518_4465 313
207 3300050515 nmdc:mga0a205_36296_c1 nmdc:mga0a205_36296_c1_3171_4118 313
208 3300005985 Ga0081539_10007994 Ga0081539_100079941 314
209 3300006353 Ga0075370_10029397 Ga0075370_100293972 314
210 3300009174 Ga0105241_10144863 Ga0105241_101448632 314
211 3300021441 Ga0213871_10000116 Ga0213871_100001162 314
212 3300039438 Ga0436360_1338344 Ga0436360_1338344_11973_12926 314
213 3300039447 Ga0436361_0141542 Ga0436361_0141542_18_971 314
214 3300044694 Ga0466963_0089245 Ga0466963_0089245_887_1840 314
215 3300045976 Ga0466967_0023986 Ga0466967_0023986_1732_2685 314
216 3300046616 Ga0495668_0000293 Ga0495668_0000293_14757_15704 314
217 3300048911 Ga0496108_0013651 Ga0496108_0013651_1930_2877 314
218 3300048928 Ga0496125_0028919 Ga0496125_0028919_3101_4048 314
219 3300050491 nmdc:mga00v17_28558_c1 nmdc:mga00v17_28558_c1_2174_3121 314
220 3300053140 Ga0500573_0021225 Ga0500573_0021225_352_1314 314
221 3300005327 Ga0070658_10002894 Ga0070658_100028947 315
222 3300005335 Ga0070666_10000020 Ga0070666_10000020105 315
223 3300005344 Ga0070661_100016885 Ga0070661_1000168855 315
224 3300005367 Ga0070667_100020783 Ga0070667_1000207832 315
225 3300005843 Ga0068860_100049883 Ga0068860_1000498834 315
226 3300005937 Ga0081455_10002662 Ga0081455_100026626 315
227 3300006042 Ga0075368_10056048 Ga0075368_100560482 315
228 3300006048 Ga0075363_100004077 Ga0075363_1000040774 315
229 3300006051 Ga0075364_10084092 Ga0075364_100840921 315
230 3300006178 Ga0075367_10011141 Ga0075367_100111414 315
231 3300006353 Ga0075370_10010823 Ga0075370_100108234 315
232 3300006847 Ga0075431_100257935 Ga0075431_1002579352 315
233 3300009551 Ga0105238_10002840 Ga0105238_100028404 315
234 3300013306 Ga0163162_10001110 Ga0163162_1000111018 315
235 3300025903 Ga0207680_10000001 Ga0207680_10000001908 315
236 3300025909 Ga0207705_10002523 Ga0207705_100025238 315
237 3300025924 Ga0207694_10000598 Ga0207694_100005984 315
238 3300025986 Ga0207658_10014582 Ga0207658_100145822 315
239 3300027866 Ga0209813_10033029 Ga0209813_100330291 315
240 3300028379 Ga0268266_10000067 Ga0268266_10000067118 315
241 3300028381 Ga0268264_10033868 Ga0268264_100338682 315
242 3300033180 Ga0307510_10004002 Ga0307510_100040023 315
243 3300033180 Ga0307510_10015076 Ga0307510_100150762 315
244 3300046471 Ga0495650_0000465 Ga0495650_0000465_55206_56171 315
245 3300048924 Ga0496121_0049091 Ga0496121_0049091_1585_2532 315
246 3300048929 Ga0496126_0054790 Ga0496126_0054790_1035_1982 315
247 3300050490 nmdc:mga03n38_12519_c1 nmdc:mga03n38_12519_c1_720_1673 315
248 3300050494 nmdc:mga06z11_6721_c1 nmdc:mga06z11_6721_c1_1673_2626 315
249 3300050495 nmdc:mga04h51_39205_c1 nmdc:mga04h51_39205_c1_252_1205 315
250 3300050496 nmdc:mga07m45_11166_c1 nmdc:mga07m45_11166_c1_3537_4490 315
251 iso_pu_bacteria 2751185788 2753303751 315
252 iso_pu_bacteria 2908674828 2908676065 315
253 3300044694 Ga0466963_0003733 Ga0466963_0003733_3014_3967 316
254 3300044842 Ga0466957_0030986 Ga0466957_0030986_175_1128 316
255 3300045976 Ga0466967_0002882 Ga0466967_0002882_6659_7612 316
256 3300049850 Ga0501204_003639 Ga0501204_003639_443_1411 316
257 3300061719 Ga0466962_0073366 Ga0466962_0073366_155_1108 316
258 3300010375 Ga0105239_10289455 Ga0105239_102894552 317
259 3300021384 Ga0213876_10000754 Ga0213876_1000075418 317
260 3300028800 Ga0265338_10200834 Ga0265338_102008341 317
261 3300035111 Ga0373923_0081423 Ga0373923_0081423_272_1231 317
262 3300035172 Ga0373955_0034727 Ga0373955_0034727_269_1375 317
263 3300035692 Ga0373935_0094832 Ga0373935_0094832_662_1621 317
264 3300037068 Ga0373925_0320036 Ga0373925_0320036_107_1066 317
265 3300044694 Ga0466963_0052969 Ga0466963_0052969_920_1936 317
266 3300044719 Ga0466971_0017348 Ga0466971_0017348_17_1033 317
267 3300046459 Ga0495629_0132418 Ga0495629_0132418_401_1483 317
268 3300046462 Ga0495651_0122101 Ga0495651_0122101_727_1686 317
269 3300046473 Ga0495582_0184550 Ga0495582_0184550_202_1161 317
270 3300046476 Ga0495662_0170290 Ga0495662_0170290_90_1049 317
271 3300046529 Ga0495652_0140166 Ga0495652_0140166_61_1167 317
272 3300046533 Ga0495640_0148702 Ga0495640_0148702_288_1247 317
273 3300046536 Ga0495587_0099067 Ga0495587_0099067_205_1311 317
274 3300046663 Ga0495635_0301944 Ga0495635_0301944_89_1048 317
275 3300046694 Ga0495649_0000586 Ga0495649_0000586_17426_18397 317
276 3300046809 Ga0495600_0206377 Ga0495600_0206377_117_1076 317
277 3300047317 Ga0495604_0098279 Ga0495604_0098279_256_1215 317
278 3300047321 Ga0495676_0214960 Ga0495676_0214960_220_1179 317
279 3300047322 Ga0495680_0177664 Ga0495680_0177664_328_1287 317
280 3300047673 Ga0495593_0088917 Ga0495593_0088917_335_1417 317
281 3300048915 Ga0496112_0168233 Ga0496112_0168233_586_1545 317
282 3300053077 Ga0495601_0062337 Ga0495601_0062337_1314_2273 317
283 3300053078 Ga0495612_0109352 Ga0495612_0109352_35_994 317
284 3300053085 Ga0495619_0080410 Ga0495619_0080410_814_1920 317
285 3300005337 Ga0070682_100099572 Ga0070682_1000995722 319
286 3300005546 Ga0070696_100128872 Ga0070696_1001288722 319
287 3300005841 Ga0068863_100059539 Ga0068863_1000595392 319
288 3300006163 Ga0070715_10072231 Ga0070715_100722312 319
289 3300006237 Ga0097621_100299917 Ga0097621_1002999172 319
290 3300006871 Ga0075434_100292648 Ga0075434_1002926482 319
291 3300006914 Ga0075436_100076257 Ga0075436_1000762572 319
292 3300007076 Ga0075435_100052809 Ga0075435_1000528092 319
293 3300009174 Ga0105241_10052187 Ga0105241_100521874 319
294 3300025898 Ga0207692_10106181 Ga0207692_101061812 319
295 3300025906 Ga0207699_10193657 Ga0207699_101936572 319
296 3300025915 Ga0207693_10030165 Ga0207693_100301653 319
297 3300025916 Ga0207663_10005791 Ga0207663_100057914 319
298 3300025928 Ga0207700_10004087 Ga0207700_100040872 319
299 3300025929 Ga0207664_10248301 Ga0207664_102483012 319
300 3300025939 Ga0207665_10043938 Ga0207665_100439382 319
301 3300035083 Ga0373926_0045337 Ga0373926_0045337_457_1419 319
302 3300035111 Ga0373923_0066265 Ga0373923_0066265_275_1237 319
303 3300035113 Ga0373936_0039021 Ga0373936_0039021_871_1833 319
304 3300035116 Ga0373945_0018696 Ga0373945_0018696_269_1231 319
305 3300035241 Ga0373961_0002587 Ga0373961_0002587_1952_2914 319
306 3300035242 Ga0373962_0017905 Ga0373962_0017905_708_1670 319
307 3300035410 Ga0373924_0053118 Ga0373924_0053118_537_1499 319
308 3300035691 Ga0373931_0003421 Ga0373931_0003421_1533_2495 319
309 3300035695 Ga0373927_0021327 Ga0373927_0021327_3051_4013 319
310 3300035725 Ga0373947_0042393 Ga0373947_0042393_228_1190 319
311 3300037068 Ga0373925_0164970 Ga0373925_0164970_457_1419 319
312 3300045976 Ga0466967_0022873 Ga0466967_0022873_2493_3521 319
313 3300046459 Ga0495629_0002303 Ga0495629_0002303_3614_4576 319
314 3300046461 Ga0495641_0013560 Ga0495641_0013560_2657_3619 319
315 3300046462 Ga0495651_0211434 Ga0495651_0211434_114_1076 319
316 3300046463 Ga0495653_0044473 Ga0495653_0044473_1868_2830 319
317 3300046463 Ga0495653_0058210 Ga0495653_0058210_893_1855 319
318 3300046473 Ga0495582_0009049 Ga0495582_0009049_1923_2885 319
319 3300046517 Ga0495630_0018627 Ga0495630_0018627_532_1494 319
320 3300046529 Ga0495652_0129967 Ga0495652_0129967_146_1108 319
321 3300046531 Ga0495665_0003725 Ga0495665_0003725_1681_2643 319
322 3300046533 Ga0495640_0069967 Ga0495640_0069967_317_1279 319
323 3300046559 Ga0495667_0108873 Ga0495667_0108873_378_1340 319
324 3300046642 Ga0495634_0037061 Ga0495634_0037061_800_1762 319
325 3300046683 Ga0495658_0005186 Ga0495658_0005186_5319_6281 319
326 3300046689 Ga0495613_0018283 Ga0495613_0018283_1630_2592 319
327 3300046809 Ga0495600_0117934 Ga0495600_0117934_216_1178 319
328 3300047315 Ga0495581_0005082 Ga0495581_0005082_3806_4768 319
329 3300047317 Ga0495604_0051877 Ga0495604_0051877_1005_1967 319
330 3300047321 Ga0495676_0038287 Ga0495676_0038287_2054_3016 319
331 3300047322 Ga0495680_0071189 Ga0495680_0071189_1062_2024 319
332 3300047471 Ga0495684_0021135 Ga0495684_0021135_770_1732 319
333 3300047673 Ga0495593_0006627 Ga0495593_0006627_5077_6039 319
334 3300048903 Ga0496100_0189992 Ga0496100_0189992_497_1459 319
335 3300048904 Ga0496101_0219717 Ga0496101_0219717_206_1168 319
336 3300048905 Ga0496102_0317205 Ga0496102_0317205_307_1269 319
337 3300048906 Ga0496103_0206927 Ga0496103_0206927_194_1156 319
338 3300048909 Ga0496106_0048615 Ga0496106_0048615_1895_2857 319
339 3300048912 Ga0496109_0078058 Ga0496109_0078058_646_1608 319
340 3300048916 Ga0496113_0073959 Ga0496113_0073959_1145_2107 319
341 3300048918 Ga0496115_0001767 Ga0496115_0001767_12070_13032 319
342 3300048920 Ga0496117_0000672 Ga0496117_0000672_4902_5936 319
343 3300050512 nmdc:mga0n895_27397_c1 nmdc:mga0n895_27397_c1_64_1026 319
344 3300050514 nmdc:mga08x19_63640_c1 nmdc:mga08x19_63640_c1_192_1154 319
345 3300005518 Ga0070699_100010728 Ga0070699_1000107284 321
346 3300042876 Ga0451577_0027202 Ga0451577_0027202_4153_5133 323
347 3300044673 Ga0453683_0124192 Ga0453683_0124192_172_1152 323
348 3300044712 Ga0453684_0048015 Ga0453684_0048015_1938_2918 323
349 3300035207 Ga0373942_0008417 Ga0373942_0008417_510_1646 325
350 3300002067 JGI24735J21928_10020461 JGI24735J21928_100204612 335

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

64

365

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7utf-assembly1.cif.gz_C structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9501 1 315
7utf-assembly2.cif.gz_D structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9431 1 320
7utf-assembly1.cif.gz_A structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9402 1 315
7utf-assembly2.cif.gz_B structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9354 1 320
6ovq-assembly2.cif.gz_B crystal structure of mithramycin 3-side chain keto-reductase mtmw 0.9192 1 314
ID Description Score Start End Superfamily
5danA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9116 1 312 3.20.20.100
4xk2A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9053 1 320 3.20.20.100
5danA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9053 1 312 3.20.20.100
af_Q8VZ23_56_411_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9053 1 312 3.20.20.100
af_C4J2K0_1_323_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9048 1 319 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A529I2A4-F1-model_v4 deleted 0.9924 97 314
AF-A0A1S9Y2H9-F1-model_v4 deleted 0.9917 160 273
AF-A0A6G3XD47-F1-model_v4 Aldo/keto reductase 0.9906 18 169 GO:0005829
GO:0016491
AF-A0A435G3J2-F1-model_v4 Aldo/keto reductase 0.9903 110 313 GO:0005829
AF-A0A3N7H1F2-F1-model_v4 Aldo/keto reductase 0.9903 148 313 GO:0005829

Feature Viewer

pLDDT pTM Quality
90.98 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map