F418141

General Info

Members Datasets Scaffolds Average Seq Length
350 198 700 116

Family's Representative Sequence

Representative Sequence 3300005339|Ga0070660_101423928|Ga0070660_1014239281
Length 136
Sequence MAACRCLNAGRPLMSAAVSDCLFCRMVAGEIPADVVHETDRVLAFRDINPQAPTHVLVIPKEHHRNLAALAAADAGLLGEVAVAAGDVARREGLVRDGGVEPGYRVVTNTGPDAGQSVDHLHLHVLGGRGLAWPPG

Samples

Sample ID Description Type Environment
1 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
59 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
100 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
101 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
102 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
103 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
104 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
105 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
106 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
107 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
108 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
109 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
110 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
111 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
112 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
113 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
114 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
115 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
116 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
117 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
118 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
119 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
120 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
121 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
122 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
123 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
124 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
125 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
126 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
127 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
128 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
129 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
130 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
131 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
132 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
133 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
134 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
135 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
136 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
137 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
138 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
139 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
140 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
141 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
142 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
143 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
144 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
145 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
146 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
147 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
148 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
149 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
150 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
151 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
152 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
153 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
154 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
155 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
156 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
157 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
158 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
159 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
160 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
161 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
162 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
163 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
164 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
165 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
166 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
178 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
179 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
180 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
181 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
182 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
183 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
184 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
185 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
186 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
187 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
188 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
189 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
190 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
191 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
192 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
193 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
194 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
195 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
196 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
197 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
198 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.86
Metatranscriptomes 0.86
Isolates 0.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4
Rhizosphere 94
Stem 0
Stem Tuber 0
Unclassified 8.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070660_101423928 3300005339 Bacteria 589
2 MBSR1b_contig_5179842 2162886012 Bacteria 925
3 LJQas_1013023 3300000549 Bacteria 980
4 rootH1_10159321 3300003316 Bacteria 1675
5 rootH2_10027573 3300003320 Bacteria 1988
6 Ga0065712_10139075 3300005290 Unclassified 1468
7 Ga0065715_10377325 3300005293 Bacteria 912
8 Ga0065715_10988664 3300005293 Bacteria 545
9 Ga0070658_10597822 3300005327 Bacteria 956
10 Ga0070683_100084289 3300005329 Bacteria 2978
11 Ga0070683_100789489 3300005329 Bacteria 910
12 Ga0070683_100932776 3300005329 Bacteria 833
13 Ga0070683_101450062 3300005329 Bacteria 660
14 Ga0070690_100181121 3300005330 Unclassified 1456
15 Ga0070670_101000790 3300005331 Bacteria 760
16 Ga0070680_100511447 3300005336 Bacteria 1028
17 Ga0070680_100701660 3300005336 Bacteria 871
18 Ga0070660_100181680 3300005339 Bacteria 1702
19 Ga0070689_100201166 3300005340 Bacteria 1627
20 Ga0070661_100760922 3300005344 Bacteria 793
21 Ga0070675_102095484 3300005354 Bacteria 521
22 Ga0070674_101772134 3300005356 Bacteria 559
23 Ga0070709_10198234 3300005434 Unclassified 1420
24 Ga0070709_11021322 3300005434 Bacteria 658
25 Ga0070709_11773422 3300005434 Bacteria 505
26 Ga0070705_100839866 3300005440 Bacteria 734
27 Ga0070694_100093800 3300005444 Unclassified 2111
28 Ga0070694_101320499 3300005444 Bacteria 607
29 Ga0070708_100005691 3300005445 Bacteria 9889
30 Ga0070708_100479224 3300005445 Bacteria 1174
31 Ga0070663_100342195 3300005455 Bacteria 1209
32 Ga0070663_100462792 3300005455 Bacteria 1047
33 Ga0070678_100285035 3300005456 Bacteria 1398
34 Ga0070681_10086670 3300005458 Bacteria 3085
35 Ga0070681_11442569 3300005458 Bacteria 612
36 Ga0070681_11594002 3300005458 Bacteria 578
37 Ga0070685_11153405 3300005466 Bacteria 587
38 Ga0070706_100002003 3300005467 Bacteria 20963
39 Ga0070706_100465242 3300005467 Bacteria 1177
40 Ga0070706_100982309 3300005467 Bacteria 779
41 Ga0070707_100005265 3300005468 Bacteria 12109
42 Ga0070707_100671619 3300005468 Bacteria 999
43 Ga0070698_100265171 3300005471 Bacteria 1649
44 Ga0070698_100511551 3300005471 Bacteria 1139
45 Ga0070699_100003896 3300005518 Bacteria 13193
46 Ga0070699_100036873 3300005518 Bacteria 4230
47 Ga0070679_100500391 3300005530 Bacteria 1159
48 Ga0070679_101088339 3300005530 Bacteria 744
49 Ga0070679_101270834 3300005530 Bacteria 682
50 Ga0070684_100370826 3300005535 Bacteria 1318
51 Ga0070697_100718718 3300005536 Bacteria 882
52 Ga0070697_100979359 3300005536 Unclassified 751
53 Ga0070697_101237893 3300005536 Bacteria 665
54 Ga0070672_100879375 3300005543 Bacteria 791
55 Ga0070686_100561999 3300005544 Unclassified 894
56 Ga0070695_100973902 3300005545 Unclassified 689
57 Ga0070695_101321011 3300005545 Bacteria 596
58 Ga0070696_100004371 3300005546 Bacteria 9415
59 Ga0070696_100304448 3300005546 Bacteria 1222
60 Ga0070696_101369477 3300005546 Bacteria 602
61 Ga0070693_101176151 3300005547 Bacteria 588
62 Ga0070665_100199408 3300005548 Bacteria 2002
63 Ga0070704_101814794 3300005549 Bacteria 564
64 Ga0070704_101935599 3300005549 Unclassified 547
65 Ga0070664_100034277 3300005564 Bacteria 4258
66 Ga0068857_100833393 3300005577 Bacteria 882
67 Ga0068857_101085801 3300005577 Bacteria 772
68 Ga0068856_100495171 3300005614 Bacteria 1243
69 Ga0068856_101641115 3300005614 Bacteria 656
70 Ga0070702_101221717 3300005615 Bacteria 607
71 Ga0070702_101749041 3300005615 Unclassified 518
72 Ga0068859_100792836 3300005617 Unclassified 1035
73 Ga0068864_100563185 3300005618 Bacteria 1103
74 Ga0068864_102541151 3300005618 Bacteria 518
75 Ga0068863_100332186 3300005841 Bacteria 1478
76 Ga0068860_101596069 3300005843 Bacteria 674
77 Ga0068860_102245757 3300005843 Unclassified 566
78 Ga0081538_10046106 3300005981 Bacteria 2693
79 Ga0081539_10138270 3300005985 Bacteria 1187
80 Ga0070715_10144163 3300006163 Unclassified 1160
81 Ga0068871_100991612 3300006358 Bacteria 782
82 Ga0075428_102061657 3300006844 Bacteria 590
83 Ga0075431_100993283 3300006847 Bacteria 806
84 Ga0075433_10018784 3300006852 Bacteria 5752
85 Ga0075434_100778224 3300006871 Bacteria 973
86 Ga0075434_102273157 3300006871 Bacteria 545
87 Ga0075436_100100826 3300006914 Bacteria 2011
88 Ga0097620_100792853 3300006931 Unclassified 1035
89 Ga0075435_100134313 3300007076 Bacteria 2072
90 Ga0075435_100178672 3300007076 Bacteria 1793
91 Ga0099794_10168536 3300007265 Unclassified 1116
92 Ga0105251_10051860 3300009011 Bacteria 1955
93 Ga0105245_10630123 3300009098 Bacteria 1101
94 Ga0114129_10068096 3300009147 Bacteria 4965
95 Ga0114129_10330016 3300009147 Bacteria 2026
96 Ga0105242_10678521 3300009176 Unclassified 1005
97 Ga0105248_11203725 3300009177 Bacteria 856
98 Ga0105248_11621304 3300009177 Unclassified 733
99 Ga0105238_11891519 3300009551 Bacteria 630
100 Ga0105238_12539356 3300009551 Bacteria 548
101 Ga0105249_10107244 3300009553 Bacteria 2636
102 Ga0105249_12867408 3300009553 Bacteria 553
103 Ga0099796_10081446 3300010159 Bacteria 1188
104 Ga0105239_10504986 3300010375 Unclassified 1375
105 Ga0105239_11277047 3300010375 Bacteria 847
106 Ga0105239_12146039 3300010375 Bacteria 649
107 Ga0105246_11165877 3300011119 Bacteria 707
108 Ga0157371_11623751 3300013102 Bacteria 506
109 Ga0157370_10502164 3300013104 Bacteria 1114
110 Ga0157369_10034461 3300013105 Bacteria 5556
111 Ga0157369_10598533 3300013105 Bacteria 1138
112 Ga0157372_11382247 3300013307 Bacteria 812
113 Ga0157372_12034279 3300013307 Unclassified 660
114 Ga0157375_10906616 3300013308 Bacteria 1025
115 Ga0163163_11278425 3300014325 Bacteria 796
116 Ga0163163_13117217 3300014325 Bacteria 517
117 Ga0157377_10130041 3300014745 Bacteria 1536
118 Ga0206354_11417601 3300020081 Bacteria 2209
119 Ga0206353_11049966 3300020082 Bacteria 560
120 Ga0206353_11240221 3300020082 Bacteria 9636
121 Ga0213875_10620496 3300021388 Bacteria 523
122 Ga0207680_10064811 3300025903 Bacteria 2241
123 Ga0207705_10142652 3300025909 Bacteria 1790
124 Ga0207705_10625569 3300025909 Bacteria 837
125 Ga0207684_10008496 3300025910 Bacteria 9135
126 Ga0207684_11161572 3300025910 Bacteria 641
127 Ga0207707_11080263 3300025912 Bacteria 655
128 Ga0207663_10868700 3300025916 Bacteria 720
129 Ga0207660_10130845 3300025917 Bacteria 1910
130 Ga0207657_10156953 3300025919 Bacteria 1850
131 Ga0207652_10306904 3300025921 Bacteria 1432
132 Ga0207652_10908345 3300025921 Bacteria 778
133 Ga0207646_10035846 3300025922 Bacteria 4479
134 Ga0207686_10574387 3300025934 Unclassified 884
135 Ga0207661_10312175 3300025944 Bacteria 1412
136 Ga0207661_10423368 3300025944 Bacteria 1210
137 Ga0207661_11215401 3300025944 Bacteria 693
138 Ga0207679_10215276 3300025945 Bacteria 1613
139 Ga0207679_11333057 3300025945 Bacteria 659
140 Ga0207712_10954486 3300025961 Bacteria 759
141 Ga0207703_11923748 3300026035 Bacteria 568
142 Ga0207678_10481966 3300026067 Bacteria 1080
143 Ga0207702_10858643 3300026078 Bacteria 898
144 Ga0207702_12211654 3300026078 Bacteria 539
145 Ga0207676_10619465 3300026095 Bacteria 1041
146 Ga0207674_10960488 3300026116 Bacteria 823
147 Ga0207674_11425537 3300026116 Bacteria 662
148 Ga0207675_100195399 3300026118 Bacteria 1942
149 Ga0209967_1035909 3300027364 Bacteria 748
150 Ga0209971_1124943 3300027682 Bacteria 633
151 Ga0265316_10157001 3300031344 Bacteria 1702
152 Ga0265316_10815550 3300031344 Unclassified 654
153 Ga0307408_100394015 3300031548 Bacteria 1187
154 Ga0307405_10333007 3300031731 Bacteria 1164
155 Ga0307405_10396683 3300031731 Bacteria 1079
156 Ga0307405_11819871 3300031731 Bacteria 542
157 Ga0307405_12017820 3300031731 Bacteria 516
158 Ga0307413_10061630 3300031824 Bacteria 2316
159 Ga0307413_10089829 3300031824 Bacteria 1997
160 Ga0307413_11946653 3300031824 Bacteria 529
161 Ga0307410_10187994 3300031852 Bacteria 1569
162 Ga0307410_10476654 3300031852 Bacteria 1023
163 Ga0307410_10707800 3300031852 Bacteria 849
164 Ga0307406_10029107 3300031901 Bacteria 3342
165 Ga0307406_10165048 3300031901 Bacteria 1596
166 Ga0307406_10567281 3300031901 Unclassified 931
167 Ga0307406_11822076 3300031901 Bacteria 541
168 Ga0307407_10019683 3300031903 Bacteria 3441
169 Ga0307407_10109043 3300031903 Bacteria 1734
170 Ga0307407_10156838 3300031903 Bacteria 1485
171 Ga0307407_10363210 3300031903 Unclassified 1029
172 Ga0307407_10423535 3300031903 Bacteria 960
173 Ga0307412_10346210 3300031911 Bacteria 1191
174 Ga0307412_10527617 3300031911 Bacteria 988
175 Ga0307409_100002699 3300031995 Bacteria 9359
176 Ga0307409_100104276 3300031995 Bacteria 2361
177 Ga0307409_100237477 3300031995 Bacteria 1657
178 Ga0307409_100249206 3300031995 Unclassified 1623
179 Ga0307409_100295136 3300031995 Bacteria 1505
180 Ga0307409_100534817 3300031995 Bacteria 1147
181 Ga0307409_100620171 3300031995 Bacteria 1071
182 Ga0307409_101023481 3300031995 Bacteria 845
183 Ga0307409_101399462 3300031995 Bacteria 726
184 Ga0307409_101779453 3300031995 Bacteria 645
185 Ga0307409_101895308 3300031995 Bacteria 625
186 Ga0307416_100062313 3300032002 Bacteria 3049
187 Ga0307416_100215210 3300032002 Bacteria 1837
188 Ga0307416_100691411 3300032002 Bacteria 1108
189 Ga0307416_100766578 3300032002 Bacteria 1058
190 Ga0307416_100776256 3300032002 Bacteria 1052
191 Ga0307416_100923911 3300032002 Bacteria 973
192 Ga0307416_100944540 3300032002 Bacteria 964
193 Ga0307416_102056149 3300032002 Bacteria 673
194 Ga0307414_10309916 3300032004 Bacteria 1339
195 Ga0307414_10510311 3300032004 Bacteria 1065
196 Ga0307414_10563503 3300032004 Bacteria 1017
197 Ga0307411_10016382 3300032005 Bacteria 4194
198 Ga0307411_10036248 3300032005 Bacteria 3088
199 Ga0307411_10085830 3300032005 Bacteria 2182
200 Ga0307411_10553869 3300032005 Bacteria 981
201 Ga0307411_10616561 3300032005 Bacteria 935
202 Ga0307415_100017975 3300032126 Bacteria 4255
203 Ga0307415_100183251 3300032126 Bacteria 1645
204 Ga0307415_100382382 3300032126 Bacteria 1196
205 Ga0307415_101216534 3300032126 Bacteria 710
206 Ga0373928_0109181 3300035084 Bacteria 730
207 Ga0373923_0026694 3300035111 Bacteria 2299
208 Ga0373936_0017456 3300035113 Bacteria 2763
209 Ga0373939_0390827 3300035114 Bacteria 574
210 Ga0373954_0057422 3300035118 Bacteria 1833
211 Ga0373960_0067921 3300035121 Bacteria 1096
212 Ga0373927_0318891 3300035695 Bacteria 1023
213 Ga0373947_0368988 3300035725 Bacteria 965
214 Ga0373947_0899365 3300035725 Bacteria 604
215 Ga0373925_0386993 3300037068 Bacteria 1139
216 Ga0395899_0412262 3300037312 Bacteria 892
217 Ga0395898_0782729 3300037466 Bacteria 895
218 Ga0395898_1237089 3300037466 Bacteria 677
219 Ga0436364_1083302 3300037853 Bacteria 627
220 Ga0436364_1383066 3300037853 Bacteria 2004
221 Ga0242420_112050 3300038996 Bacteria 588
222 Ga0436365_1097994 3300039437 Bacteria 1138
223 Ga0436360_0766300 3300039438 Bacteria 1647
224 Ga0436362_0653068 3300039453 Bacteria 858
225 Ga0436362_1132612 3300039453 Bacteria 852
226 Ga0451833_0146830 3300041491 Bacteria 918
227 Ga0451577_0507488 3300042876 Bacteria 1095
228 Ga0451577_1098936 3300042876 Bacteria 712
229 Ga0466965_0054904 3300044683 Bacteria 1982
230 Ga0466965_0105748 3300044683 Bacteria 1443
231 Ga0466965_0693811 3300044683 Bacteria 584
232 Ga0466965_0695121 3300044683 Bacteria 583
233 Ga0466966_0170720 3300044684 Bacteria 1322
234 Ga0466966_0917586 3300044684 Bacteria 528
235 Ga0466961_0319873 3300044693 Bacteria 946
236 Ga0466961_0966762 3300044693 Bacteria 506
237 Ga0466963_0385672 3300044694 Bacteria 988
238 Ga0466963_0400116 3300044694 Bacteria 968
239 Ga0466963_0536786 3300044694 Bacteria 826
240 Ga0466963_0811071 3300044694 Bacteria 660
241 Ga0466963_0812836 3300044694 Bacteria 659
242 Ga0466963_1097907 3300044694 Bacteria 560
243 Ga0466964_0598109 3300044706 Unclassified 605
244 Ga0453684_0504071 3300044712 Bacteria 1340
245 Ga0466971_0237810 3300044719 Bacteria 866
246 Ga0466971_0275774 3300044719 Bacteria 804
247 Ga0466971_0416414 3300044719 Bacteria 656
248 Ga0466968_0118952 3300044735 Bacteria 1194
249 Ga0466970_0152942 3300044765 Bacteria 1274
250 Ga0466970_0207557 3300044765 Bacteria 1091
251 Ga0466970_0249771 3300044765 Bacteria 994
252 Ga0466970_0679917 3300044765 Bacteria 599
253 Ga0466960_0190562 3300044901 Bacteria 1116
254 Ga0466960_0633441 3300044901 Bacteria 637
255 Ga0466959_0022177 3300045049 Bacteria 4691
256 Ga0466959_0156252 3300045049 Bacteria 1605
257 Ga0466959_0195694 3300045049 Bacteria 1409
258 Ga0466959_0276883 3300045049 Bacteria 1152
259 Ga0466959_0401068 3300045049 Bacteria 932
260 Ga0466959_0418095 3300045049 Bacteria 910
261 Ga0451576_0402870 3300045051 Unclassified 1434
262 Ga0466958_0048354 3300045836 Bacteria 2570
263 Ga0466958_0197750 3300045836 Bacteria 1279
264 Ga0466958_0261087 3300045836 Bacteria 1109
265 Ga0466958_0671915 3300045836 Bacteria 674
266 Ga0466967_0002287 3300045976 Bacteria 11824
267 Ga0466967_0113859 3300045976 Bacteria 2489
268 Ga0466967_0158586 3300045976 Bacteria 2122
269 Ga0466967_0234381 3300045976 Bacteria 1749
270 Ga0466967_0301969 3300045976 Bacteria 1540
271 Ga0466967_0316228 3300045976 Bacteria 1505
272 Ga0466967_0425777 3300045976 Bacteria 1294
273 Ga0495629_0271019 3300046459 Bacteria 1166
274 Ga0495629_0479577 3300046459 Bacteria 840
275 Ga0495651_0371865 3300046462 Bacteria 939
276 Ga0495608_0062151 3300046511 Bacteria 2454
277 Ga0495663_0207353 3300046525 Bacteria 686
278 Ga0495621_0204571 3300046539 Bacteria 795
279 Ga0495634_0181063 3300046642 Bacteria 1319
280 Ga0495635_0006307 3300046663 Bacteria 8261
281 Ga0495659_0067058 3300046664 Bacteria 1338
282 Ga0495599_0178928 3300046678 Bacteria 1308
283 Ga0495624_0151849 3300046690 Unclassified 1417
284 Ga0495624_0856410 3300046690 Unclassified 536
285 Ga0495604_0144395 3300047317 Bacteria 1697
286 Ga0495604_0533636 3300047317 Bacteria 758
287 Ga0496100_1104463 3300048903 Bacteria 625
288 Ga0496102_0165486 3300048905 Unclassified 2081
289 Ga0496105_0064601 3300048908 Bacteria 3020
290 Ga0496108_0520104 3300048911 Bacteria 1039
291 Ga0496109_0021377 3300048912 Bacteria 5721
292 Ga0496109_1503496 3300048912 Bacteria 608
293 Ga0496110_0002783 3300048913 Bacteria 13204
294 Ga0496110_0411568 3300048913 Bacteria 1233
295 Ga0496111_0036540 3300048914 Bacteria 3513
296 Ga0496112_1078424 3300048915 Bacteria 722
297 Ga0496112_1144537 3300048915 Bacteria 696
298 Ga0496113_0008774 3300048916 Bacteria 6603
299 Ga0496113_1337748 3300048916 Unclassified 556
300 Ga0496114_0502684 3300048917 Bacteria 1072
301 Ga0501032_0118974 3300049569 Bacteria 1747
302 Ga0501033_0005975 3300049570 Bacteria 9556
303 Ga0501034_0003674 3300049571 Bacteria 17345
304 Ga0501034_0004342 3300049571 Bacteria 15797
305 Ga0501034_0196313 3300049571 Bacteria 1978
306 Ga0501034_1438185 3300049571 Bacteria 564
307 Ga0501036_1003789 3300049572 Bacteria 683
308 Ga0501037_0004553 3300049573 Bacteria 10082
309 Ga0501038_0028992 3300049574 Bacteria 4910
310 Ga0501039_0193462 3300049575 Bacteria 1599
311 Ga0501043_0015276 3300049579 Bacteria 6014
312 Ga0501046_0807901 3300049580 Bacteria 657
313 Ga0501047_0179483 3300049581 Bacteria 1984
314 Ga0501047_0206136 3300049581 Bacteria 1825
315 Ga0501048_0429734 3300049582 Bacteria 945
316 Ga0501067_0000353 3300049583 Bacteria 25052
317 Ga0501067_0600070 3300049583 Bacteria 617
318 Ga0501068_0000825 3300049584 Bacteria 16103
319 Ga0501069_0000105 3300049585 Bacteria 38637
320 Ga0501069_0016617 3300049585 Bacteria 3954
321 Ga0501069_0580594 3300049585 Bacteria 672
322 Ga0501070_0000192 3300049586 Bacteria 57359
323 Ga0501070_0046720 3300049586 Bacteria 3600
324 Ga0501071_0000678 3300049587 Bacteria 17791
325 Ga0501072_0005762 3300049588 Bacteria 9432
326 Ga0501073_0000949 3300049589 Bacteria 20906
327 Ga0501074_0000171 3300049590 Bacteria 34937
328 Ga0501074_0362799 3300049590 Bacteria 1028
329 Ga0501075_0572511 3300049591 Bacteria 862
330 Ga0501079_0186440 3300049741 Bacteria 1619
331 Ga0501079_1165671 3300049741 Bacteria 607
332 Ga0501080_0000060 3300049742 Bacteria 71292
333 Ga0501080_0002718 3300049742 Bacteria 15506
334 Ga0501080_1263508 3300049742 Bacteria 633
335 Ga0501083_0000737 3300049744 Bacteria 21351
336 Ga0501044_0004147 3300049823 Bacteria 16277
337 nmdc:mga05p37_169703_c1 3300050507 Bacteria 2661
338 nmdc:mga06r32_933845_c1 3300050510 Bacteria 823
339 nmdc:mga0rr50_1389534_c1 3300050513 Bacteria 594
340 nmdc:mga0rr50_183592_c1 3300050513 Bacteria 1711
341 nmdc:mga08x19_352239_c1 3300050514 Bacteria 1028
342 nmdc:mga0a205_272289_c1 3300050515 Bacteria 1570
343 Ga0501084_0002953 3300054114 Bacteria 13773
344 Ga0501082_0000646 3300060353 Bacteria 30722
345 Ga0501082_0382740 3300060353 Bacteria 1228
346 Ga0501082_1015170 3300060353 Bacteria 725
347 Ga0501082_1704372 3300060353 Unclassified 550
348 Ga0466962_0166353 3300061719 Bacteria 1073
349 Ga0466962_0226055 3300061719 Bacteria 917
350 2623499782 2622736605 Bacteria 4992138
351 Ga0070660_101423928
352 MBSR1b_contig_5179842
353 LJQas_1013023
354 rootH1_10159321
355 rootH2_10027573
356 Ga0065712_10139075
357 Ga0065715_10377325
358 Ga0065715_10988664
359 Ga0070658_10597822
360 Ga0070683_100084289
361 Ga0070683_100789489
362 Ga0070683_100932776
363 Ga0070683_101450062
364 Ga0070690_100181121
365 Ga0070670_101000790
366 Ga0070680_100511447
367 Ga0070680_100701660
368 Ga0070660_100181680
369 Ga0070689_100201166
370 Ga0070661_100760922
371 Ga0070675_102095484
372 Ga0070674_101772134
373 Ga0070709_10198234
374 Ga0070709_11021322
375 Ga0070709_11773422
376 Ga0070705_100839866
377 Ga0070694_100093800
378 Ga0070694_101320499
379 Ga0070708_100005691
380 Ga0070708_100479224
381 Ga0070663_100342195
382 Ga0070663_100462792
383 Ga0070678_100285035
384 Ga0070681_10086670
385 Ga0070681_11442569
386 Ga0070681_11594002
387 Ga0070685_11153405
388 Ga0070706_100002003
389 Ga0070706_100465242
390 Ga0070706_100982309
391 Ga0070707_100005265
392 Ga0070707_100671619
393 Ga0070698_100265171
394 Ga0070698_100511551
395 Ga0070699_100003896
396 Ga0070699_100036873
397 Ga0070679_100500391
398 Ga0070679_101088339
399 Ga0070679_101270834
400 Ga0070684_100370826
401 Ga0070697_100718718
402 Ga0070697_100979359
403 Ga0070697_101237893
404 Ga0070672_100879375
405 Ga0070686_100561999
406 Ga0070695_100973902
407 Ga0070695_101321011
408 Ga0070696_100004371
409 Ga0070696_100304448
410 Ga0070696_101369477
411 Ga0070693_101176151
412 Ga0070665_100199408
413 Ga0070704_101814794
414 Ga0070704_101935599
415 Ga0070664_100034277
416 Ga0068857_100833393
417 Ga0068857_101085801
418 Ga0068856_100495171
419 Ga0068856_101641115
420 Ga0070702_101221717
421 Ga0070702_101749041
422 Ga0068859_100792836
423 Ga0068864_100563185
424 Ga0068864_102541151
425 Ga0068863_100332186
426 Ga0068860_101596069
427 Ga0068860_102245757
428 Ga0081538_10046106
429 Ga0081539_10138270
430 Ga0070715_10144163
431 Ga0068871_100991612
432 Ga0075428_102061657
433 Ga0075431_100993283
434 Ga0075433_10018784
435 Ga0075434_100778224
436 Ga0075434_102273157
437 Ga0075436_100100826
438 Ga0097620_100792853
439 Ga0075435_100134313
440 Ga0075435_100178672
441 Ga0099794_10168536
442 Ga0105251_10051860
443 Ga0105245_10630123
444 Ga0114129_10068096
445 Ga0114129_10330016
446 Ga0105242_10678521
447 Ga0105248_11203725
448 Ga0105248_11621304
449 Ga0105238_11891519
450 Ga0105238_12539356
451 Ga0105249_10107244
452 Ga0105249_12867408
453 Ga0099796_10081446
454 Ga0105239_10504986
455 Ga0105239_11277047
456 Ga0105239_12146039
457 Ga0105246_11165877
458 Ga0157371_11623751
459 Ga0157370_10502164
460 Ga0157369_10034461
461 Ga0157369_10598533
462 Ga0157372_11382247
463 Ga0157372_12034279
464 Ga0157375_10906616
465 Ga0163163_11278425
466 Ga0163163_13117217
467 Ga0157377_10130041
468 Ga0206354_11417601
469 Ga0206353_11049966
470 Ga0206353_11240221
471 Ga0213875_10620496
472 Ga0207680_10064811
473 Ga0207705_10142652
474 Ga0207705_10625569
475 Ga0207684_10008496
476 Ga0207684_11161572
477 Ga0207707_11080263
478 Ga0207663_10868700
479 Ga0207660_10130845
480 Ga0207657_10156953
481 Ga0207652_10306904
482 Ga0207652_10908345
483 Ga0207646_10035846
484 Ga0207686_10574387
485 Ga0207661_10312175
486 Ga0207661_10423368
487 Ga0207661_11215401
488 Ga0207679_10215276
489 Ga0207679_11333057
490 Ga0207712_10954486
491 Ga0207703_11923748
492 Ga0207678_10481966
493 Ga0207702_10858643
494 Ga0207702_12211654
495 Ga0207676_10619465
496 Ga0207674_10960488
497 Ga0207674_11425537
498 Ga0207675_100195399
499 Ga0209967_1035909
500 Ga0209971_1124943
501 Ga0265316_10157001
502 Ga0265316_10815550
503 Ga0307408_100394015
504 Ga0307405_10333007
505 Ga0307405_10396683
506 Ga0307405_11819871
507 Ga0307405_12017820
508 Ga0307413_10061630
509 Ga0307413_10089829
510 Ga0307413_11946653
511 Ga0307410_10187994
512 Ga0307410_10476654
513 Ga0307410_10707800
514 Ga0307406_10029107
515 Ga0307406_10165048
516 Ga0307406_10567281
517 Ga0307406_11822076
518 Ga0307407_10019683
519 Ga0307407_10109043
520 Ga0307407_10156838
521 Ga0307407_10363210
522 Ga0307407_10423535
523 Ga0307412_10346210
524 Ga0307412_10527617
525 Ga0307409_100002699
526 Ga0307409_100104276
527 Ga0307409_100237477
528 Ga0307409_100249206
529 Ga0307409_100295136
530 Ga0307409_100534817
531 Ga0307409_100620171
532 Ga0307409_101023481
533 Ga0307409_101399462
534 Ga0307409_101779453
535 Ga0307409_101895308
536 Ga0307416_100062313
537 Ga0307416_100215210
538 Ga0307416_100691411
539 Ga0307416_100766578
540 Ga0307416_100776256
541 Ga0307416_100923911
542 Ga0307416_100944540
543 Ga0307416_102056149
544 Ga0307414_10309916
545 Ga0307414_10510311
546 Ga0307414_10563503
547 Ga0307411_10016382
548 Ga0307411_10036248
549 Ga0307411_10085830
550 Ga0307411_10553869
551 Ga0307411_10616561
552 Ga0307415_100017975
553 Ga0307415_100183251
554 Ga0307415_100382382
555 Ga0307415_101216534
556 Ga0373928_0109181
557 Ga0373923_0026694
558 Ga0373936_0017456
559 Ga0373939_0390827
560 Ga0373954_0057422
561 Ga0373960_0067921
562 Ga0373927_0318891
563 Ga0373947_0368988
564 Ga0373947_0899365
565 Ga0373925_0386993
566 Ga0395899_0412262
567 Ga0395898_0782729
568 Ga0395898_1237089
569 Ga0436364_1083302
570 Ga0436364_1383066
571 Ga0242420_112050
572 Ga0436365_1097994
573 Ga0436360_0766300
574 Ga0436362_0653068
575 Ga0436362_1132612
576 Ga0451833_0146830
577 Ga0451577_0507488
578 Ga0451577_1098936
579 Ga0466965_0054904
580 Ga0466965_0105748
581 Ga0466965_0693811
582 Ga0466965_0695121
583 Ga0466966_0170720
584 Ga0466966_0917586
585 Ga0466961_0319873
586 Ga0466961_0966762
587 Ga0466963_0385672
588 Ga0466963_0400116
589 Ga0466963_0536786
590 Ga0466963_0811071
591 Ga0466963_0812836
592 Ga0466963_1097907
593 Ga0466964_0598109
594 Ga0453684_0504071
595 Ga0466971_0237810
596 Ga0466971_0275774
597 Ga0466971_0416414
598 Ga0466968_0118952
599 Ga0466970_0152942
600 Ga0466970_0207557
601 Ga0466970_0249771
602 Ga0466970_0679917
603 Ga0466960_0190562
604 Ga0466960_0633441
605 Ga0466959_0022177
606 Ga0466959_0156252
607 Ga0466959_0195694
608 Ga0466959_0276883
609 Ga0466959_0401068
610 Ga0466959_0418095
611 Ga0451576_0402870
612 Ga0466958_0048354
613 Ga0466958_0197750
614 Ga0466958_0261087
615 Ga0466958_0671915
616 Ga0466967_0002287
617 Ga0466967_0113859
618 Ga0466967_0158586
619 Ga0466967_0234381
620 Ga0466967_0301969
621 Ga0466967_0316228
622 Ga0466967_0425777
623 Ga0495629_0271019
624 Ga0495629_0479577
625 Ga0495651_0371865
626 Ga0495608_0062151
627 Ga0495663_0207353
628 Ga0495621_0204571
629 Ga0495634_0181063
630 Ga0495635_0006307
631 Ga0495659_0067058
632 Ga0495599_0178928
633 Ga0495624_0151849
634 Ga0495624_0856410
635 Ga0495604_0144395
636 Ga0495604_0533636
637 Ga0496100_1104463
638 Ga0496102_0165486
639 Ga0496105_0064601
640 Ga0496108_0520104
641 Ga0496109_0021377
642 Ga0496109_1503496
643 Ga0496110_0002783
644 Ga0496110_0411568
645 Ga0496111_0036540
646 Ga0496112_1078424
647 Ga0496112_1144537
648 Ga0496113_0008774
649 Ga0496113_1337748
650 Ga0496114_0502684
651 Ga0501032_0118974
652 Ga0501033_0005975
653 Ga0501034_0003674
654 Ga0501034_0004342
655 Ga0501034_0196313
656 Ga0501034_1438185
657 Ga0501036_1003789
658 Ga0501037_0004553
659 Ga0501038_0028992
660 Ga0501039_0193462
661 Ga0501043_0015276
662 Ga0501046_0807901
663 Ga0501047_0179483
664 Ga0501047_0206136
665 Ga0501048_0429734
666 Ga0501067_0000353
667 Ga0501067_0600070
668 Ga0501068_0000825
669 Ga0501069_0000105
670 Ga0501069_0016617
671 Ga0501069_0580594
672 Ga0501070_0000192
673 Ga0501070_0046720
674 Ga0501071_0000678
675 Ga0501072_0005762
676 Ga0501073_0000949
677 Ga0501074_0000171
678 Ga0501074_0362799
679 Ga0501075_0572511
680 Ga0501079_0186440
681 Ga0501079_1165671
682 Ga0501080_0000060
683 Ga0501080_0002718
684 Ga0501080_1263508
685 Ga0501083_0000737
686 Ga0501044_0004147
687 nmdc:mga05p37_169703_c1
688 nmdc:mga06r32_933845_c1
689 nmdc:mga0rr50_1389534_c1
690 nmdc:mga0rr50_183592_c1
691 nmdc:mga08x19_352239_c1
692 nmdc:mga0a205_272289_c1
693 Ga0501084_0002953
694 Ga0501082_0000646
695 Ga0501082_0382740
696 Ga0501082_1015170
697 Ga0501082_1704372
698 Ga0466962_0166353
699 Ga0466962_0226055
700 2623499782

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11969

DcpS_C

Scavenger mRNA decapping enzyme C-term binding

20

130

0.97

PF01230

HIT

HIT domain

28

131

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
6d6j-assembly1.cif.gz_A crystal structure of hit family hydrolase from legionella pneumophila philadelphia 1 0.9638 3 115
6ypr-assembly1.cif.gz_AAA-2 human histidine triad nucleotide-binding protein 2 (hhint2) refined to 1.26 a in h32 space group 0.9579 20 115
6d6j-assembly1.cif.gz_A crystal structure of hit family hydrolase from legionella pneumophila philadelphia 1 0.9554 3 115
5uvm-assembly1.cif.gz_A hit family hydrolase from clostridium thermocellum cth-393 0.9521 1 111
6ypx-assembly1.cif.gz_AAA human histidine triad nucleotide-binding protein 2 (hhint2) refined to 2.11 a in c2221 space group 0.9511 1 115
ID Description Score Start End Superfamily
4q61B00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9497 4 108 3.30.428.10
3oxkA00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9481 3 112 3.30.428.10
1kpcB00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.947 3 115 3.30.428.10
4eguB00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.946 1 111 3.30.428.10
5uvmA00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9459 1 113 3.30.428.10
ID Description Score Start End GO Terms
AF-A0A0F2Q8Y7-F1-model_v4 HIT family hydrolase 0.9753 1 115 GO:0016787
AF-A0A5N9EEI3-F1-model_v4 Histidine triad nucleotide-binding protein 0.9729 1 111 GO:0003824
AF-A0A0B2D5E3-F1-model_v4 Histidine triad (HIT) family protein (Zinc-binding protein) 0.9725 3 115 GO:0003824
AF-A0A2E5U426-F1-model_v4 Histidine triad nucleotide-binding protein 0.9721 4 115 GO:0003824
AF-A0A317T407-F1-model_v4 Histidine triad nucleotide-binding protein 0.9718 1 115 GO:0003824

Map