F418057
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 349 | 225 | 698 | 192 |
Family's Representative Sequence
| Representative Sequence | 3300054114|Ga0501084_0083212|Ga0501084_0083212_668_1240 |
| Length | 190 |
| Sequence | MSDGSWYDADIQHVIISEKEIRDKIDELAKQVAADHERVTDGLLLVCVLKGAVMFMADFARALGRYGPPAELEFMAVSSYGQGTTSSGVVRILKDLDRDIAGRHVIVVEDIVDSGLTLSWLLRYLASRSAASVEVVALFRKPEAVKVTVPVRYVGFDIPNEFVVGYGLDFGERYRELPYVGVLKPEVYAR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 2 | 3300003162 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 5 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 6 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 31 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 34 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 36 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 37 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 39 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 40 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 41 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 42 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 43 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 44 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 45 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 46 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 47 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 48 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 49 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 50 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 52 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 53 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 54 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 55 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 76 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 77 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 78 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 108 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 112 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 113 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 114 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 115 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 116 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 117 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 118 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 119 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 120 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 121 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 122 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 123 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 124 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 125 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 126 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 127 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 128 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 129 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 130 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 131 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 132 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 133 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 134 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 135 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 136 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 137 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 138 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 139 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 140 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 141 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 142 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 143 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 144 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 145 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 146 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 147 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 148 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 149 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 150 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 151 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 152 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 158 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 159 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 160 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 161 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 162 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 163 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 164 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 165 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 166 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 167 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 168 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 169 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 170 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 171 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 173 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 174 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 175 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 176 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 177 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 178 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 179 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 180 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 181 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 182 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 183 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 184 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 185 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 186 | 2501939600 | Micromonospora sp. L5 | Isolate | Unclassified |
| 187 | 2515154088 | Salinispora arenicola CNT800 | Isolate | Rhizosphere |
| 188 | 2515154129 | Salinispora pacifica CNS103 | Isolate | Rhizosphere |
| 189 | 2515154137 | Salinispora arenicola CNX482 | Isolate | Rhizosphere |
| 190 | 2515154202 | Salinispora pacifica CNT084 | Isolate | Rhizosphere |
| 191 | 2515154203 | Salinispora arenicola CNR921 | Isolate | Rhizosphere |
| 192 | 2622736626 | Micromonospora rhizosphaerae DSM 45431 | Isolate | Rhizosphere |
| 193 | 2675903059 | Asanoa hainanensis CGMCC 4.5593 | Isolate | Rhizosphere |
| 194 | 2751185782 | Actinoplanes subtropicus NRRL B-24665 | Isolate | Rhizosphere |
| 195 | 2772190715 | Micromonospora chokoriensis NRRL B-24750 | Isolate | Unclassified |
| 196 | 2831935698 | Jishengella sp. AZ1-13 | Isolate | Unclassified |
| 197 | 2832004796 | Micromonospora endophytica JCM 18317 | Isolate | Unclassified |
| 198 | 2855670206 | Micromonospora noduli Lupac 07 | Isolate | Nodule |
| 199 | 2855676851 | Micromonospora saelicesensis GAR05 | Isolate | Unclassified |
| 200 | 2855683550 | Micromonospora sp. RP3T | Isolate | Unclassified |
| 201 | 2856858025 | Micromonospora aurantiaca 110B(2018) | Isolate | Unclassified |
| 202 | 2857288857 | Micromonospora noduli ONO23 | Isolate | Unclassified |
| 203 | 2858848962 | Micromonospora saelicesensis GAR06 | Isolate | Unclassified |
| 204 | 2858882152 | Micromonospora noduli MED15 | Isolate | Nodule |
| 205 | 2858888857 | Micromonospora saelicesensis Lupac 06 | Isolate | Unclassified |
| 206 | 2858895516 | Micromonospora saelicesensis PSN13 | Isolate | Unclassified |
| 207 | 2858902515 | Micromonospora sp. MW-13 | Isolate | Rhizosphere |
| 208 | 2866065130 | Micromonospora endophytica DSM 45430 | Isolate | Unclassified |
| 209 | 2867312974 | Micromonospora musae NGC1-4 | Isolate | Unclassified |
| 210 | 2867319477 | Micromonospora musae MS1-9 | Isolate | Unclassified |
| 211 | 2867507094 | Micromonospora zingiberis PLAI 1-1 | Isolate | Unclassified |
| 212 | 2869048445 | Micromonospora saelicesensis PSN01 | Isolate | Unclassified |
| 213 | 2869061728 | Micromonospora noduli ONO86 | Isolate | Unclassified |
| 214 | 2869068681 | Micromonospora noduli GUI43 | Isolate | Unclassified |
| 215 | 2880495981 | Micromonospora vinacea DSM 101695 | Isolate | Unclassified |
| 216 | 2902582711 | Micromonospora sp. AP08 | Isolate | Unclassified |
| 217 | 2929219909 | Micromonospora sp. R-75348 Hybrid assembly | Isolate | Unclassified |
| 218 | 2929226422 | Micromonospora sp. R-74116 Hybrid assembly | Isolate | Unclassified |
| 219 | 2996221748 | Micromonospora veneta CAP181 | Isolate | Unclassified |
| 220 | 649633069 | Micromonospora sp. L5 | Isolate | Unclassified |
| 221 | 8003830390 | Micromonospora parastrephiae STR1_7 | Isolate | Rhizosphere |
| 222 | 8003870546 | Micromonospora tarensis STR1s_6 | Isolate | Rhizosphere |
| 223 | 8054704163 | Micromonospora trifolii NIE79 | Isolate | Nodule |
| 224 | 8054727385 | Micromonospora alfalfae MED01 | Isolate | Nodule |
| 225 | 8054734606 | Micromonospora hortensis NIE111 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.25 |
| Metatranscriptomes | 2.29 |
| Isolates | 11.46 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.87 |
| Nodule | 1.43 |
| Rhizoplane | 4.01 |
| Rhizosphere | 77.65 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501084_0083212 | 3300054114 | Bacteria | 2686 |
| 2 | Ga0006778J45830_1027553 | 3300003162 | Bacteria | 858 |
| 3 | JGI25406J46586_10002388 | 3300003203 | Bacteria | 8876 |
| 4 | JGI25406J46586_10028499 | 3300003203 | Bacteria | 2127 |
| 5 | JGI25406J46586_10064701 | 3300003203 | Bacteria | 1168 |
| 6 | Ga0006777J48905_1106056 | 3300003308 | Bacteria | 741 |
| 7 | Ga0007410J51695_1035210 | 3300003574 | Bacteria | 884 |
| 8 | Ga0007429J51699_1044342 | 3300003579 | Bacteria | 1410 |
| 9 | Ga0070658_10035763 | 3300005327 | Bacteria | 4001 |
| 10 | Ga0070676_10050848 | 3300005328 | Bacteria | 2431 |
| 11 | Ga0070683_100009056 | 3300005329 | Bacteria | 8496 |
| 12 | Ga0070683_100012242 | 3300005329 | Bacteria | 7450 |
| 13 | Ga0070683_100449167 | 3300005329 | Bacteria | 1230 |
| 14 | Ga0070670_100991530 | 3300005331 | Bacteria | 764 |
| 15 | Ga0068869_100009486 | 3300005334 | Bacteria | 6318 |
| 16 | Ga0068869_100086731 | 3300005334 | Bacteria | 2347 |
| 17 | Ga0070682_100184753 | 3300005337 | Bacteria | 1459 |
| 18 | Ga0070682_100253165 | 3300005337 | Bacteria | 1271 |
| 19 | Ga0068868_100025543 | 3300005338 | Bacteria | 4495 |
| 20 | Ga0070661_100034047 | 3300005344 | Bacteria | 3694 |
| 21 | Ga0070668_100000915 | 3300005347 | Bacteria | 20561 |
| 22 | Ga0070668_100053659 | 3300005347 | Bacteria | 3108 |
| 23 | Ga0070668_100079671 | 3300005347 | Bacteria | 2565 |
| 24 | Ga0070675_100001609 | 3300005354 | Bacteria | 16654 |
| 25 | Ga0070671_100366915 | 3300005355 | Bacteria | 1230 |
| 26 | Ga0070674_100108747 | 3300005356 | Bacteria | 2032 |
| 27 | Ga0070659_100020946 | 3300005366 | Bacteria | 4972 |
| 28 | Ga0070659_100470175 | 3300005366 | Bacteria | 1069 |
| 29 | Ga0070667_100308724 | 3300005367 | Bacteria | 1425 |
| 30 | Ga0070713_100117125 | 3300005436 | Bacteria | 2331 |
| 31 | Ga0070713_101155135 | 3300005436 | Bacteria | 749 |
| 32 | Ga0070711_100246647 | 3300005439 | Bacteria | 1399 |
| 33 | Ga0070694_100172753 | 3300005444 | Bacteria | 1593 |
| 34 | Ga0070663_100010080 | 3300005455 | Bacteria | 5877 |
| 35 | Ga0070662_100148419 | 3300005457 | Bacteria | 1823 |
| 36 | Ga0070681_10251855 | 3300005458 | Bacteria | 1678 |
| 37 | Ga0070685_10359425 | 3300005466 | Bacteria | 998 |
| 38 | Ga0070679_100163814 | 3300005530 | Bacteria | 2197 |
| 39 | Ga0070679_100222568 | 3300005530 | Bacteria | 1848 |
| 40 | Ga0070684_100010857 | 3300005535 | Bacteria | 7237 |
| 41 | Ga0070684_100012252 | 3300005535 | Bacteria | 6866 |
| 42 | Ga0070684_100052292 | 3300005535 | Bacteria | 3552 |
| 43 | Ga0070684_100272749 | 3300005535 | Bacteria | 1549 |
| 44 | Ga0068853_100286657 | 3300005539 | Bacteria | 1519 |
| 45 | Ga0070693_100061304 | 3300005547 | Bacteria | 2186 |
| 46 | Ga0070665_100066291 | 3300005548 | Bacteria | 3622 |
| 47 | Ga0070665_100293581 | 3300005548 | Bacteria | 1628 |
| 48 | Ga0068855_100244251 | 3300005563 | Bacteria | 2005 |
| 49 | Ga0068855_101193244 | 3300005563 | Bacteria | 792 |
| 50 | Ga0070664_100008388 | 3300005564 | Bacteria | 8354 |
| 51 | Ga0070664_100452867 | 3300005564 | Bacteria | 1178 |
| 52 | Ga0070664_100506726 | 3300005564 | Bacteria | 1113 |
| 53 | Ga0070664_100853057 | 3300005564 | Bacteria | 853 |
| 54 | Ga0068857_100008236 | 3300005577 | Bacteria | 9009 |
| 55 | Ga0068857_101073866 | 3300005577 | Bacteria | 777 |
| 56 | Ga0068856_100190084 | 3300005614 | Bacteria | 2067 |
| 57 | Ga0070702_100113079 | 3300005615 | Bacteria | 1687 |
| 58 | Ga0068859_100293211 | 3300005617 | Bacteria | 1720 |
| 59 | Ga0068859_100538182 | 3300005617 | Bacteria | 1263 |
| 60 | Ga0068864_100103365 | 3300005618 | Bacteria | 2529 |
| 61 | Ga0068864_100466329 | 3300005618 | Bacteria | 1210 |
| 62 | Ga0068866_10306336 | 3300005718 | Bacteria | 994 |
| 63 | Ga0068861_100106879 | 3300005719 | Bacteria | 2236 |
| 64 | Ga0068863_100017891 | 3300005841 | Bacteria | 6782 |
| 65 | Ga0068863_100379221 | 3300005841 | Bacteria | 1380 |
| 66 | Ga0068858_100028941 | 3300005842 | Bacteria | 5144 |
| 67 | Ga0068860_100097367 | 3300005843 | Bacteria | 2805 |
| 68 | Ga0068860_100551674 | 3300005843 | Bacteria | 1155 |
| 69 | Ga0068862_100183325 | 3300005844 | Bacteria | 1880 |
| 70 | Ga0068862_100344185 | 3300005844 | Bacteria | 1382 |
| 71 | Ga0068862_100377449 | 3300005844 | Bacteria | 1321 |
| 72 | Ga0081455_10544310 | 3300005937 | Bacteria | 769 |
| 73 | Ga0081540_1019150 | 3300005983 | Bacteria | 4173 |
| 74 | Ga0081539_10000779 | 3300005985 | Bacteria | 62135 |
| 75 | Ga0081539_10001096 | 3300005985 | Bacteria | 49234 |
| 76 | Ga0081539_10004059 | 3300005985 | Bacteria | 16753 |
| 77 | Ga0081539_10004175 | 3300005985 | Bacteria | 16385 |
| 78 | Ga0081539_10004805 | 3300005985 | Bacteria | 14518 |
| 79 | Ga0081539_10015763 | 3300005985 | Bacteria | 5466 |
| 80 | Ga0081539_10150267 | 3300005985 | Bacteria | 1121 |
| 81 | Ga0075364_10051659 | 3300006051 | Bacteria | 2685 |
| 82 | Ga0070712_100586954 | 3300006175 | Bacteria | 942 |
| 83 | Ga0075428_100200260 | 3300006844 | Bacteria | 2159 |
| 84 | Ga0075428_100329363 | 3300006844 | Bacteria | 1640 |
| 85 | Ga0075428_100669890 | 3300006844 | Bacteria | 1106 |
| 86 | Ga0075430_100000906 | 3300006846 | Bacteria | 23226 |
| 87 | Ga0075430_100057182 | 3300006846 | Bacteria | 3281 |
| 88 | Ga0075430_100064749 | 3300006846 | Bacteria | 3071 |
| 89 | Ga0075430_100250519 | 3300006846 | Bacteria | 1468 |
| 90 | Ga0075431_100007731 | 3300006847 | Bacteria | 10710 |
| 91 | Ga0075431_100053983 | 3300006847 | Bacteria | 4144 |
| 92 | Ga0075429_100069299 | 3300006880 | Bacteria | 3071 |
| 93 | Ga0075429_100283556 | 3300006880 | Bacteria | 1451 |
| 94 | Ga0075429_100342383 | 3300006880 | Bacteria | 1309 |
| 95 | Ga0097620_100293217 | 3300006931 | Bacteria | 1720 |
| 96 | Ga0097620_100538221 | 3300006931 | Bacteria | 1263 |
| 97 | Ga0105251_10069174 | 3300009011 | Bacteria | 1646 |
| 98 | Ga0111539_10018989 | 3300009094 | Bacteria | 8499 |
| 99 | Ga0111539_10442366 | 3300009094 | Bacteria | 1514 |
| 100 | Ga0105245_10012776 | 3300009098 | Bacteria | 7315 |
| 101 | Ga0114129_10006682 | 3300009147 | Bacteria | 16381 |
| 102 | Ga0114129_10010147 | 3300009147 | Bacteria | 13428 |
| 103 | Ga0114129_10011002 | 3300009147 | Bacteria | 12891 |
| 104 | Ga0114129_10205292 | 3300009147 | Bacteria | 2666 |
| 105 | Ga0114129_10528549 | 3300009147 | Bacteria | 1537 |
| 106 | Ga0114129_10737460 | 3300009147 | Bacteria | 1262 |
| 107 | Ga0105243_10034721 | 3300009148 | Bacteria | 3907 |
| 108 | Ga0105248_10017097 | 3300009177 | Bacteria | 7989 |
| 109 | Ga0105248_10368078 | 3300009177 | Bacteria | 1618 |
| 110 | Ga0105237_10375913 | 3300009545 | Bacteria | 1425 |
| 111 | Ga0105238_10477434 | 3300009551 | Bacteria | 1246 |
| 112 | Ga0105249_10086969 | 3300009553 | Bacteria | 2916 |
| 113 | Ga0105239_10191731 | 3300010375 | Bacteria | 2288 |
| 114 | Ga0105239_10391321 | 3300010375 | Bacteria | 1572 |
| 115 | Ga0105239_10507676 | 3300010375 | Bacteria | 1371 |
| 116 | Ga0105246_10073339 | 3300011119 | Bacteria | 2416 |
| 117 | Ga0105246_10835002 | 3300011119 | Bacteria | 820 |
| 118 | Ga0157369_10003881 | 3300013105 | Bacteria | 17737 |
| 119 | Ga0157374_10336244 | 3300013296 | Bacteria | 1498 |
| 120 | Ga0157374_10837541 | 3300013296 | Bacteria | 936 |
| 121 | Ga0163162_10902778 | 3300013306 | Bacteria | 997 |
| 122 | Ga0157372_10135578 | 3300013307 | Bacteria | 2835 |
| 123 | Ga0157372_10271535 | 3300013307 | Bacteria | 1971 |
| 124 | Ga0157372_10292228 | 3300013307 | Bacteria | 1895 |
| 125 | Ga0163163_10029795 | 3300014325 | Bacteria | 5251 |
| 126 | Ga0163163_10138542 | 3300014325 | Bacteria | 2475 |
| 127 | Ga0163163_10288920 | 3300014325 | Bacteria | 1692 |
| 128 | Ga0157380_11052343 | 3300014326 | Bacteria | 850 |
| 129 | Ga0157377_10358507 | 3300014745 | Bacteria | 981 |
| 130 | Ga0157379_10106543 | 3300014968 | Bacteria | 2516 |
| 131 | Ga0157379_10155746 | 3300014968 | Bacteria | 2061 |
| 132 | Ga0206354_10224837 | 3300020081 | Bacteria | 2311 |
| 133 | Ga0206353_11450956 | 3300020082 | Bacteria | 759 |
| 134 | Ga0224712_10009127 | 3300022467 | Bacteria | 2974 |
| 135 | Ga0207710_10075322 | 3300025900 | Bacteria | 1555 |
| 136 | Ga0207688_10013498 | 3300025901 | Bacteria | 4439 |
| 137 | Ga0207645_10116537 | 3300025907 | Bacteria | 1732 |
| 138 | Ga0207705_10089689 | 3300025909 | Bacteria | 2250 |
| 139 | Ga0207660_10189984 | 3300025917 | Bacteria | 1599 |
| 140 | Ga0207649_10011446 | 3300025920 | Bacteria | 4893 |
| 141 | Ga0207649_10197504 | 3300025920 | Bacteria | 1419 |
| 142 | Ga0207649_10822168 | 3300025920 | Bacteria | 726 |
| 143 | Ga0207652_10484946 | 3300025921 | Bacteria | 1113 |
| 144 | Ga0207652_10618471 | 3300025921 | Bacteria | 970 |
| 145 | Ga0207694_10781523 | 3300025924 | Bacteria | 806 |
| 146 | Ga0207659_10013448 | 3300025926 | Bacteria | 5242 |
| 147 | Ga0207687_10006347 | 3300025927 | Bacteria | 7812 |
| 148 | Ga0207700_10191241 | 3300025928 | Bacteria | 1720 |
| 149 | Ga0207664_10111863 | 3300025929 | Bacteria | 2272 |
| 150 | Ga0207644_10258414 | 3300025931 | Bacteria | 1392 |
| 151 | Ga0207706_10129665 | 3300025933 | Bacteria | 2218 |
| 152 | Ga0207670_10319678 | 3300025936 | Bacteria | 1221 |
| 153 | Ga0207691_10219209 | 3300025940 | Bacteria | 1650 |
| 154 | Ga0207711_10254089 | 3300025941 | Bacteria | 1614 |
| 155 | Ga0207689_10132194 | 3300025942 | Bacteria | 2054 |
| 156 | Ga0207689_10233021 | 3300025942 | Bacteria | 1522 |
| 157 | Ga0207661_10038864 | 3300025944 | Bacteria | 3732 |
| 158 | Ga0207661_10198934 | 3300025944 | Bacteria | 1761 |
| 159 | Ga0207679_10056821 | 3300025945 | Bacteria | 2891 |
| 160 | Ga0207679_10272248 | 3300025945 | Bacteria | 1449 |
| 161 | Ga0207679_10705843 | 3300025945 | Bacteria | 916 |
| 162 | Ga0207679_10940535 | 3300025945 | Bacteria | 791 |
| 163 | Ga0207668_10019384 | 3300025972 | Bacteria | 4299 |
| 164 | Ga0207668_10376097 | 3300025972 | Bacteria | 1194 |
| 165 | Ga0207658_10283835 | 3300025986 | Bacteria | 1420 |
| 166 | Ga0207677_10014365 | 3300026023 | Bacteria | 4622 |
| 167 | Ga0207703_10055571 | 3300026035 | Bacteria | 3221 |
| 168 | Ga0207703_10076017 | 3300026035 | Bacteria | 2785 |
| 169 | Ga0207678_10102155 | 3300026067 | Bacteria | 2448 |
| 170 | Ga0207678_10208655 | 3300026067 | Bacteria | 1671 |
| 171 | Ga0207641_10053340 | 3300026088 | Bacteria | 3427 |
| 172 | Ga0207676_10081956 | 3300026095 | Bacteria | 2622 |
| 173 | Ga0207674_10015167 | 3300026116 | Bacteria | 8479 |
| 174 | Ga0207674_10028264 | 3300026116 | Bacteria | 5920 |
| 175 | Ga0207675_100165926 | 3300026118 | Bacteria | 2109 |
| 176 | Ga0207428_10010084 | 3300027907 | Bacteria | 8456 |
| 177 | Ga0268266_10045947 | 3300028379 | Bacteria | 3738 |
| 178 | Ga0268266_10182610 | 3300028379 | Bacteria | 1911 |
| 179 | Ga0268265_10121570 | 3300028380 | Bacteria | 2152 |
| 180 | Ga0268265_10554685 | 3300028380 | Bacteria | 1091 |
| 181 | Ga0268264_10107986 | 3300028381 | Bacteria | 2432 |
| 182 | Ga0307517_10041929 | 3300028786 | Bacteria | 4925 |
| 183 | Ga0307515_10000083 | 3300028794 | Bacteria | 222889 |
| 184 | Ga0307515_10014982 | 3300028794 | Bacteria | 14323 |
| 185 | Ga0307515_10353496 | 3300028794 | Bacteria | 1114 |
| 186 | Ga0307512_10011572 | 3300030522 | Bacteria | 8354 |
| 187 | Ga0307512_10014056 | 3300030522 | Bacteria | 7473 |
| 188 | Ga0307512_10021079 | 3300030522 | Bacteria | 5883 |
| 189 | Ga0265328_10018454 | 3300031239 | Bacteria | 2690 |
| 190 | Ga0307513_10004641 | 3300031456 | Bacteria | 18282 |
| 191 | Ga0307513_10076489 | 3300031456 | Bacteria | 3471 |
| 192 | Ga0307513_10112486 | 3300031456 | Bacteria | 2712 |
| 193 | Ga0307408_100024967 | 3300031548 | Bacteria | 4088 |
| 194 | Ga0307508_10012057 | 3300031616 | Bacteria | 7908 |
| 195 | Ga0307508_10021385 | 3300031616 | Bacteria | 5882 |
| 196 | Ga0307516_10002906 | 3300031730 | Bacteria | 22441 |
| 197 | Ga0307516_10027518 | 3300031730 | Bacteria | 5765 |
| 198 | Ga0307405_10011835 | 3300031731 | Bacteria | 4592 |
| 199 | Ga0307405_10100564 | 3300031731 | Bacteria | 1938 |
| 200 | Ga0307405_10243591 | 3300031731 | Bacteria | 1333 |
| 201 | Ga0307413_10189822 | 3300031824 | Bacteria | 1474 |
| 202 | Ga0307413_10340426 | 3300031824 | Bacteria | 1153 |
| 203 | Ga0307410_10521294 | 3300031852 | Bacteria | 981 |
| 204 | Ga0326468_10000896 | 3300031889 | Bacteria | 2906 |
| 205 | Ga0307406_10036259 | 3300031901 | Bacteria | 3037 |
| 206 | Ga0307406_10044667 | 3300031901 | Bacteria | 2778 |
| 207 | Ga0307406_10050519 | 3300031901 | Bacteria | 2637 |
| 208 | Ga0307406_10146911 | 3300031901 | Bacteria | 1677 |
| 209 | Ga0307406_10259560 | 3300031901 | Bacteria | 1314 |
| 210 | Ga0307406_10315365 | 3300031901 | Bacteria | 1207 |
| 211 | Ga0307406_10352213 | 3300031901 | Bacteria | 1151 |
| 212 | Ga0307407_10253890 | 3300031903 | Bacteria | 1206 |
| 213 | Ga0307412_10052235 | 3300031911 | Bacteria | 2706 |
| 214 | Ga0307409_100240286 | 3300031995 | Bacteria | 1648 |
| 215 | Ga0307416_100021524 | 3300032002 | Bacteria | 4632 |
| 216 | Ga0307416_100056099 | 3300032002 | Bacteria | 3177 |
| 217 | Ga0307416_100129946 | 3300032002 | Bacteria | 2265 |
| 218 | Ga0307416_100203580 | 3300032002 | Bacteria | 1881 |
| 219 | Ga0307416_101572382 | 3300032002 | Bacteria | 763 |
| 220 | Ga0307414_10398785 | 3300032004 | Bacteria | 1194 |
| 221 | Ga0307411_10133343 | 3300032005 | Bacteria | 1819 |
| 222 | Ga0307411_10310946 | 3300032005 | Bacteria | 1268 |
| 223 | Ga0307411_10481462 | 3300032005 | Bacteria | 1045 |
| 224 | Ga0307415_100012886 | 3300032126 | Bacteria | 4855 |
| 225 | Ga0307415_100041188 | 3300032126 | Bacteria | 3065 |
| 226 | Ga0307415_100048625 | 3300032126 | Bacteria | 2863 |
| 227 | Ga0307415_100076578 | 3300032126 | Bacteria | 2372 |
| 228 | Ga0307415_100087161 | 3300032126 | Bacteria | 2248 |
| 229 | Ga0307510_10121834 | 3300033180 | Bacteria | 2309 |
| 230 | Ga0307510_10192324 | 3300033180 | Bacteria | 1587 |
| 231 | Ga0307510_10250589 | 3300033180 | Bacteria | 1259 |
| 232 | Ga0373938_0130974 | 3300034957 | Bacteria | 654 |
| 233 | Ga0373951_0000013 | 3300035091 | Bacteria | 71164 |
| 234 | Ga0373939_0043627 | 3300035114 | Bacteria | 1362 |
| 235 | Ga0373939_0046991 | 3300035114 | Bacteria | 1324 |
| 236 | Ga0373943_0454114 | 3300035170 | Bacteria | 745 |
| 237 | Ga0373955_0162321 | 3300035172 | Bacteria | 1319 |
| 238 | Ga0373955_0507837 | 3300035172 | Bacteria | 736 |
| 239 | Ga0373942_0141485 | 3300035207 | Bacteria | 766 |
| 240 | Ga0373962_0006751 | 3300035242 | Bacteria | 2786 |
| 241 | Ga0373931_0232334 | 3300035691 | Bacteria | 1115 |
| 242 | Ga0373937_0275273 | 3300036401 | Bacteria | 1589 |
| 243 | Ga0373925_0403871 | 3300037068 | Bacteria | 1115 |
| 244 | Ga0395899_0328778 | 3300037312 | Bacteria | 1028 |
| 245 | Ga0395900_0029565 | 3300037418 | Bacteria | 5621 |
| 246 | Ga0395900_0068053 | 3300037418 | Bacteria | 3659 |
| 247 | Ga0395901_0039004 | 3300038443 | Bacteria | 4914 |
| 248 | Ga0395901_0152563 | 3300038443 | Bacteria | 2427 |
| 249 | Ga0451797_0247151 | 3300041453 | Bacteria | 1209 |
| 250 | Ga0451853_1491772 | 3300041512 | Bacteria | 1638 |
| 251 | Ga0439448_0165339 | 3300042005 | Bacteria | 771 |
| 252 | Ga0439463_066217 | 3300042016 | Bacteria | 924 |
| 253 | Ga0450903_028168 | 3300042138 | Bacteria | 853 |
| 254 | Ga0466957_0023278 | 3300044842 | Bacteria | 3661 |
| 255 | Ga0466957_0618845 | 3300044842 | Bacteria | 759 |
| 256 | Ga0466967_0498958 | 3300045976 | Bacteria | 1194 |
| 257 | Ga0495629_0055557 | 3300046459 | Bacteria | 2768 |
| 258 | Ga0495629_0330777 | 3300046459 | Bacteria | 1041 |
| 259 | Ga0495594_0007050 | 3300046499 | Bacteria | 5779 |
| 260 | Ga0495594_0096536 | 3300046499 | Bacteria | 1661 |
| 261 | Ga0495594_0194953 | 3300046499 | Bacteria | 1154 |
| 262 | Ga0495630_0256179 | 3300046517 | Bacteria | 1337 |
| 263 | Ga0495632_0050217 | 3300046519 | Bacteria | 2058 |
| 264 | Ga0495581_0329365 | 3300047315 | Bacteria | 892 |
| 265 | Ga0496104_0062958 | 3300048907 | Bacteria | 3517 |
| 266 | Ga0496104_0095138 | 3300048907 | Bacteria | 2850 |
| 267 | Ga0496104_0405093 | 3300048907 | Bacteria | 1276 |
| 268 | Ga0496105_0087942 | 3300048908 | Bacteria | 2567 |
| 269 | Ga0496105_0166985 | 3300048908 | Bacteria | 1805 |
| 270 | Ga0496108_0000071 | 3300048911 | Bacteria | 113930 |
| 271 | Ga0496108_0009017 | 3300048911 | Bacteria | 8082 |
| 272 | Ga0496110_0130567 | 3300048913 | Bacteria | 2268 |
| 273 | Ga0496111_0048360 | 3300048914 | Bacteria | 3064 |
| 274 | Ga0496112_0020271 | 3300048915 | Bacteria | 6298 |
| 275 | Ga0496112_0267130 | 3300048915 | Bacteria | 1659 |
| 276 | Ga0496112_0328438 | 3300048915 | Bacteria | 1473 |
| 277 | Ga0496113_0003155 | 3300048916 | Bacteria | 9811 |
| 278 | Ga0501047_0048636 | 3300049581 | Bacteria | 4095 |
| 279 | nmdc:mga00v17_340009_c1 | 3300050491 | Bacteria | 976 |
| 280 | nmdc:mga05p37_1585_c2 | 3300050507 | Bacteria | 25594 |
| 281 | nmdc:mga05p37_27327_c1 | 3300050507 | Bacteria | 6947 |
| 282 | nmdc:mga05p37_519528_c1 | 3300050507 | Bacteria | 1362 |
| 283 | nmdc:mga05p37_83802_c1 | 3300050507 | Bacteria | 3928 |
| 284 | nmdc:mga09592_176320_c1 | 3300050508 | Bacteria | 1849 |
| 285 | nmdc:mga09592_177_c1 | 3300050508 | Bacteria | 45265 |
| 286 | nmdc:mga0qj67_311870_c1 | 3300050509 | Bacteria | 1274 |
| 287 | nmdc:mga0qj67_318538_c1 | 3300050509 | Bacteria | 1259 |
| 288 | nmdc:mga0qj67_36_c3 | 3300050509 | Bacteria | 71496 |
| 289 | nmdc:mga0qj67_517_c1 | 3300050509 | Bacteria | 26296 |
| 290 | nmdc:mga06r32_21285_c1 | 3300050510 | Bacteria | 5985 |
| 291 | nmdc:mga06r32_290_c2 | 3300050510 | Bacteria | 38684 |
| 292 | nmdc:mga08y16_87818_c1 | 3300050511 | Bacteria | 3240 |
| 293 | Ga0495619_0006039 | 3300053085 | Bacteria | 7674 |
| 294 | Ga0500644_0106025 | 3300053088 | Bacteria | 1075 |
| 295 | Ga0500644_0127202 | 3300053088 | Bacteria | 999 |
| 296 | Ga0500646_0000052 | 3300053090 | Bacteria | 32125 |
| 297 | Ga0500583_0008711 | 3300053092 | Bacteria | 3661 |
| 298 | Ga0500651_0194218 | 3300053093 | Bacteria | 1200 |
| 299 | Ga0500650_0188101 | 3300053098 | Bacteria | 944 |
| 300 | Ga0500654_135256 | 3300053099 | Bacteria | 919 |
| 301 | Ga0500594_0002960 | 3300053118 | Bacteria | 3711 |
| 302 | Ga0500594_0031493 | 3300053118 | Bacteria | 1399 |
| 303 | Ga0500621_145451 | 3300053126 | Bacteria | 895 |
| 304 | Ga0500652_006673 | 3300053131 | Bacteria | 3731 |
| 305 | Ga0500579_068289 | 3300053143 | Bacteria | 2066 |
| 306 | Ga0500588_0002196 | 3300053146 | Bacteria | 3914 |
| 307 | Ga0500600_0040310 | 3300053149 | Bacteria | 2698 |
| 308 | Ga0500633_0161789 | 3300053160 | Bacteria | 840 |
| 309 | Ga0587111_0060554 | 3300060346 | Bacteria | 860 |
| 310 | 2501945950 | 2501939600 | Bacteria | 6907073 |
| 311 | 2515497683 | 2515154088 | Bacteria | 5526283 |
| 312 | 2515720400 | 2515154129 | Bacteria | 5584369 |
| 313 | 2515757795 | 2515154137 | Bacteria | 5711575 |
| 314 | 2516084543 | 2515154202 | Bacteria | 5471270 |
| 315 | 2516091603 | 2515154203 | Bacteria | 5458536 |
| 316 | 2623585446 | 2622736626 | Bacteria | 7181580 |
| 317 | 2676487237 | 2675903059 | Bacteria | 8644972 |
| 318 | 2753266950 | 2751185782 | Bacteria | 11227053 |
| 319 | 2772645278 | 2772190715 | Bacteria | 6959372 |
| 320 | 2831939792 | 2831935698 | Bacteria | 5963223 |
| 321 | 2832005841 | 2832004796 | Bacteria | 6538017 |
| 322 | 2855672416 | 2855670206 | Bacteria | 7120389 |
| 323 | 2855677245 | 2855676851 | Bacteria | 7063653 |
| 324 | 2855686242 | 2855683550 | Bacteria | 7134265 |
| 325 | 2856859361 | 2856858025 | Bacteria | 7255264 |
| 326 | 2857291418 | 2857288857 | Bacteria | 7189066 |
| 327 | 2858850279 | 2858848962 | Bacteria | 6963058 |
| 328 | 2858884699 | 2858882152 | Bacteria | 7230291 |
| 329 | 2858893348 | 2858888857 | Bacteria | 7060307 |
| 330 | 2858898271 | 2858895516 | Bacteria | 7378898 |
| 331 | 2858902579 | 2858902515 | Bacteria | 7086037 |
| 332 | 2866066336 | 2866065130 | Bacteria | 6518152 |
| 333 | 2867317109 | 2867312974 | Bacteria | 7058875 |
| 334 | 2867322931 | 2867319477 | Bacteria | 7069771 |
| 335 | 2867510528 | 2867507094 | Bacteria | 6506033 |
| 336 | 2869048740 | 2869048445 | Bacteria | 6875584 |
| 337 | 2869066816 | 2869061728 | Bacteria | 7112407 |
| 338 | 2869075274 | 2869068681 | Bacteria | 7205615 |
| 339 | 2880497542 | 2880495981 | Bacteria | 7340502 |
| 340 | 2902584333 | 2902582711 | Bacteria | 6187705 |
| 341 | 2929226106 | 2929219909 | Bacteria | 6984360 |
| 342 | 2929232768 | 2929226422 | Bacteria | 7248583 |
| 343 | 2996228142 | 2996221748 | Bacteria | 6799777 |
| 344 | 649812774 | 649633069 | Bacteria | 6962533 |
| 345 | 8003832914 | 8003830390 | Bacteria | 6541657 |
| 346 | 8003876623 | 8003870546 | Bacteria | 7396674 |
| 347 | 8054710690 | 8054704163 | Bacteria | 7247792 |
| 348 | 8054732392 | 8054727385 | Bacteria | 7558670 |
| 349 | 8054739355 | 8054734606 | Bacteria | 6947278 |
| 350 | Ga0501084_0083212 | |||
| 351 | Ga0006778J45830_1027553 | |||
| 352 | JGI25406J46586_10002388 | |||
| 353 | JGI25406J46586_10028499 | |||
| 354 | JGI25406J46586_10064701 | |||
| 355 | Ga0006777J48905_1106056 | |||
| 356 | Ga0007410J51695_1035210 | |||
| 357 | Ga0007429J51699_1044342 | |||
| 358 | Ga0070658_10035763 | |||
| 359 | Ga0070676_10050848 | |||
| 360 | Ga0070683_100009056 | |||
| 361 | Ga0070683_100012242 | |||
| 362 | Ga0070683_100449167 | |||
| 363 | Ga0070670_100991530 | |||
| 364 | Ga0068869_100009486 | |||
| 365 | Ga0068869_100086731 | |||
| 366 | Ga0070682_100184753 | |||
| 367 | Ga0070682_100253165 | |||
| 368 | Ga0068868_100025543 | |||
| 369 | Ga0070661_100034047 | |||
| 370 | Ga0070668_100000915 | |||
| 371 | Ga0070668_100053659 | |||
| 372 | Ga0070668_100079671 | |||
| 373 | Ga0070675_100001609 | |||
| 374 | Ga0070671_100366915 | |||
| 375 | Ga0070674_100108747 | |||
| 376 | Ga0070659_100020946 | |||
| 377 | Ga0070659_100470175 | |||
| 378 | Ga0070667_100308724 | |||
| 379 | Ga0070713_100117125 | |||
| 380 | Ga0070713_101155135 | |||
| 381 | Ga0070711_100246647 | |||
| 382 | Ga0070694_100172753 | |||
| 383 | Ga0070663_100010080 | |||
| 384 | Ga0070662_100148419 | |||
| 385 | Ga0070681_10251855 | |||
| 386 | Ga0070685_10359425 | |||
| 387 | Ga0070679_100163814 | |||
| 388 | Ga0070679_100222568 | |||
| 389 | Ga0070684_100010857 | |||
| 390 | Ga0070684_100012252 | |||
| 391 | Ga0070684_100052292 | |||
| 392 | Ga0070684_100272749 | |||
| 393 | Ga0068853_100286657 | |||
| 394 | Ga0070693_100061304 | |||
| 395 | Ga0070665_100066291 | |||
| 396 | Ga0070665_100293581 | |||
| 397 | Ga0068855_100244251 | |||
| 398 | Ga0068855_101193244 | |||
| 399 | Ga0070664_100008388 | |||
| 400 | Ga0070664_100452867 | |||
| 401 | Ga0070664_100506726 | |||
| 402 | Ga0070664_100853057 | |||
| 403 | Ga0068857_100008236 | |||
| 404 | Ga0068857_101073866 | |||
| 405 | Ga0068856_100190084 | |||
| 406 | Ga0070702_100113079 | |||
| 407 | Ga0068859_100293211 | |||
| 408 | Ga0068859_100538182 | |||
| 409 | Ga0068864_100103365 | |||
| 410 | Ga0068864_100466329 | |||
| 411 | Ga0068866_10306336 | |||
| 412 | Ga0068861_100106879 | |||
| 413 | Ga0068863_100017891 | |||
| 414 | Ga0068863_100379221 | |||
| 415 | Ga0068858_100028941 | |||
| 416 | Ga0068860_100097367 | |||
| 417 | Ga0068860_100551674 | |||
| 418 | Ga0068862_100183325 | |||
| 419 | Ga0068862_100344185 | |||
| 420 | Ga0068862_100377449 | |||
| 421 | Ga0081455_10544310 | |||
| 422 | Ga0081540_1019150 | |||
| 423 | Ga0081539_10000779 | |||
| 424 | Ga0081539_10001096 | |||
| 425 | Ga0081539_10004059 | |||
| 426 | Ga0081539_10004175 | |||
| 427 | Ga0081539_10004805 | |||
| 428 | Ga0081539_10015763 | |||
| 429 | Ga0081539_10150267 | |||
| 430 | Ga0075364_10051659 | |||
| 431 | Ga0070712_100586954 | |||
| 432 | Ga0075428_100200260 | |||
| 433 | Ga0075428_100329363 | |||
| 434 | Ga0075428_100669890 | |||
| 435 | Ga0075430_100000906 | |||
| 436 | Ga0075430_100057182 | |||
| 437 | Ga0075430_100064749 | |||
| 438 | Ga0075430_100250519 | |||
| 439 | Ga0075431_100007731 | |||
| 440 | Ga0075431_100053983 | |||
| 441 | Ga0075429_100069299 | |||
| 442 | Ga0075429_100283556 | |||
| 443 | Ga0075429_100342383 | |||
| 444 | Ga0097620_100293217 | |||
| 445 | Ga0097620_100538221 | |||
| 446 | Ga0105251_10069174 | |||
| 447 | Ga0111539_10018989 | |||
| 448 | Ga0111539_10442366 | |||
| 449 | Ga0105245_10012776 | |||
| 450 | Ga0114129_10006682 | |||
| 451 | Ga0114129_10010147 | |||
| 452 | Ga0114129_10011002 | |||
| 453 | Ga0114129_10205292 | |||
| 454 | Ga0114129_10528549 | |||
| 455 | Ga0114129_10737460 | |||
| 456 | Ga0105243_10034721 | |||
| 457 | Ga0105248_10017097 | |||
| 458 | Ga0105248_10368078 | |||
| 459 | Ga0105237_10375913 | |||
| 460 | Ga0105238_10477434 | |||
| 461 | Ga0105249_10086969 | |||
| 462 | Ga0105239_10191731 | |||
| 463 | Ga0105239_10391321 | |||
| 464 | Ga0105239_10507676 | |||
| 465 | Ga0105246_10073339 | |||
| 466 | Ga0105246_10835002 | |||
| 467 | Ga0157369_10003881 | |||
| 468 | Ga0157374_10336244 | |||
| 469 | Ga0157374_10837541 | |||
| 470 | Ga0163162_10902778 | |||
| 471 | Ga0157372_10135578 | |||
| 472 | Ga0157372_10271535 | |||
| 473 | Ga0157372_10292228 | |||
| 474 | Ga0163163_10029795 | |||
| 475 | Ga0163163_10138542 | |||
| 476 | Ga0163163_10288920 | |||
| 477 | Ga0157380_11052343 | |||
| 478 | Ga0157377_10358507 | |||
| 479 | Ga0157379_10106543 | |||
| 480 | Ga0157379_10155746 | |||
| 481 | Ga0206354_10224837 | |||
| 482 | Ga0206353_11450956 | |||
| 483 | Ga0224712_10009127 | |||
| 484 | Ga0207710_10075322 | |||
| 485 | Ga0207688_10013498 | |||
| 486 | Ga0207645_10116537 | |||
| 487 | Ga0207705_10089689 | |||
| 488 | Ga0207660_10189984 | |||
| 489 | Ga0207649_10011446 | |||
| 490 | Ga0207649_10197504 | |||
| 491 | Ga0207649_10822168 | |||
| 492 | Ga0207652_10484946 | |||
| 493 | Ga0207652_10618471 | |||
| 494 | Ga0207694_10781523 | |||
| 495 | Ga0207659_10013448 | |||
| 496 | Ga0207687_10006347 | |||
| 497 | Ga0207700_10191241 | |||
| 498 | Ga0207664_10111863 | |||
| 499 | Ga0207644_10258414 | |||
| 500 | Ga0207706_10129665 | |||
| 501 | Ga0207670_10319678 | |||
| 502 | Ga0207691_10219209 | |||
| 503 | Ga0207711_10254089 | |||
| 504 | Ga0207689_10132194 | |||
| 505 | Ga0207689_10233021 | |||
| 506 | Ga0207661_10038864 | |||
| 507 | Ga0207661_10198934 | |||
| 508 | Ga0207679_10056821 | |||
| 509 | Ga0207679_10272248 | |||
| 510 | Ga0207679_10705843 | |||
| 511 | Ga0207679_10940535 | |||
| 512 | Ga0207668_10019384 | |||
| 513 | Ga0207668_10376097 | |||
| 514 | Ga0207658_10283835 | |||
| 515 | Ga0207677_10014365 | |||
| 516 | Ga0207703_10055571 | |||
| 517 | Ga0207703_10076017 | |||
| 518 | Ga0207678_10102155 | |||
| 519 | Ga0207678_10208655 | |||
| 520 | Ga0207641_10053340 | |||
| 521 | Ga0207676_10081956 | |||
| 522 | Ga0207674_10015167 | |||
| 523 | Ga0207674_10028264 | |||
| 524 | Ga0207675_100165926 | |||
| 525 | Ga0207428_10010084 | |||
| 526 | Ga0268266_10045947 | |||
| 527 | Ga0268266_10182610 | |||
| 528 | Ga0268265_10121570 | |||
| 529 | Ga0268265_10554685 | |||
| 530 | Ga0268264_10107986 | |||
| 531 | Ga0307517_10041929 | |||
| 532 | Ga0307515_10000083 | |||
| 533 | Ga0307515_10014982 | |||
| 534 | Ga0307515_10353496 | |||
| 535 | Ga0307512_10011572 | |||
| 536 | Ga0307512_10014056 | |||
| 537 | Ga0307512_10021079 | |||
| 538 | Ga0265328_10018454 | |||
| 539 | Ga0307513_10004641 | |||
| 540 | Ga0307513_10076489 | |||
| 541 | Ga0307513_10112486 | |||
| 542 | Ga0307408_100024967 | |||
| 543 | Ga0307508_10012057 | |||
| 544 | Ga0307508_10021385 | |||
| 545 | Ga0307516_10002906 | |||
| 546 | Ga0307516_10027518 | |||
| 547 | Ga0307405_10011835 | |||
| 548 | Ga0307405_10100564 | |||
| 549 | Ga0307405_10243591 | |||
| 550 | Ga0307413_10189822 | |||
| 551 | Ga0307413_10340426 | |||
| 552 | Ga0307410_10521294 | |||
| 553 | Ga0326468_10000896 | |||
| 554 | Ga0307406_10036259 | |||
| 555 | Ga0307406_10044667 | |||
| 556 | Ga0307406_10050519 | |||
| 557 | Ga0307406_10146911 | |||
| 558 | Ga0307406_10259560 | |||
| 559 | Ga0307406_10315365 | |||
| 560 | Ga0307406_10352213 | |||
| 561 | Ga0307407_10253890 | |||
| 562 | Ga0307412_10052235 | |||
| 563 | Ga0307409_100240286 | |||
| 564 | Ga0307416_100021524 | |||
| 565 | Ga0307416_100056099 | |||
| 566 | Ga0307416_100129946 | |||
| 567 | Ga0307416_100203580 | |||
| 568 | Ga0307416_101572382 | |||
| 569 | Ga0307414_10398785 | |||
| 570 | Ga0307411_10133343 | |||
| 571 | Ga0307411_10310946 | |||
| 572 | Ga0307411_10481462 | |||
| 573 | Ga0307415_100012886 | |||
| 574 | Ga0307415_100041188 | |||
| 575 | Ga0307415_100048625 | |||
| 576 | Ga0307415_100076578 | |||
| 577 | Ga0307415_100087161 | |||
| 578 | Ga0307510_10121834 | |||
| 579 | Ga0307510_10192324 | |||
| 580 | Ga0307510_10250589 | |||
| 581 | Ga0373938_0130974 | |||
| 582 | Ga0373951_0000013 | |||
| 583 | Ga0373939_0043627 | |||
| 584 | Ga0373939_0046991 | |||
| 585 | Ga0373943_0454114 | |||
| 586 | Ga0373955_0162321 | |||
| 587 | Ga0373955_0507837 | |||
| 588 | Ga0373942_0141485 | |||
| 589 | Ga0373962_0006751 | |||
| 590 | Ga0373931_0232334 | |||
| 591 | Ga0373937_0275273 | |||
| 592 | Ga0373925_0403871 | |||
| 593 | Ga0395899_0328778 | |||
| 594 | Ga0395900_0029565 | |||
| 595 | Ga0395900_0068053 | |||
| 596 | Ga0395901_0039004 | |||
| 597 | Ga0395901_0152563 | |||
| 598 | Ga0451797_0247151 | |||
| 599 | Ga0451853_1491772 | |||
| 600 | Ga0439448_0165339 | |||
| 601 | Ga0439463_066217 | |||
| 602 | Ga0450903_028168 | |||
| 603 | Ga0466957_0023278 | |||
| 604 | Ga0466957_0618845 | |||
| 605 | Ga0466967_0498958 | |||
| 606 | Ga0495629_0055557 | |||
| 607 | Ga0495629_0330777 | |||
| 608 | Ga0495594_0007050 | |||
| 609 | Ga0495594_0096536 | |||
| 610 | Ga0495594_0194953 | |||
| 611 | Ga0495630_0256179 | |||
| 612 | Ga0495632_0050217 | |||
| 613 | Ga0495581_0329365 | |||
| 614 | Ga0496104_0062958 | |||
| 615 | Ga0496104_0095138 | |||
| 616 | Ga0496104_0405093 | |||
| 617 | Ga0496105_0087942 | |||
| 618 | Ga0496105_0166985 | |||
| 619 | Ga0496108_0000071 | |||
| 620 | Ga0496108_0009017 | |||
| 621 | Ga0496110_0130567 | |||
| 622 | Ga0496111_0048360 | |||
| 623 | Ga0496112_0020271 | |||
| 624 | Ga0496112_0267130 | |||
| 625 | Ga0496112_0328438 | |||
| 626 | Ga0496113_0003155 | |||
| 627 | Ga0501047_0048636 | |||
| 628 | nmdc:mga00v17_340009_c1 | |||
| 629 | nmdc:mga05p37_1585_c2 | |||
| 630 | nmdc:mga05p37_27327_c1 | |||
| 631 | nmdc:mga05p37_519528_c1 | |||
| 632 | nmdc:mga05p37_83802_c1 | |||
| 633 | nmdc:mga09592_176320_c1 | |||
| 634 | nmdc:mga09592_177_c1 | |||
| 635 | nmdc:mga0qj67_311870_c1 | |||
| 636 | nmdc:mga0qj67_318538_c1 | |||
| 637 | nmdc:mga0qj67_36_c3 | |||
| 638 | nmdc:mga0qj67_517_c1 | |||
| 639 | nmdc:mga06r32_21285_c1 | |||
| 640 | nmdc:mga06r32_290_c2 | |||
| 641 | nmdc:mga08y16_87818_c1 | |||
| 642 | Ga0495619_0006039 | |||
| 643 | Ga0500644_0106025 | |||
| 644 | Ga0500644_0127202 | |||
| 645 | Ga0500646_0000052 | |||
| 646 | Ga0500583_0008711 | |||
| 647 | Ga0500651_0194218 | |||
| 648 | Ga0500650_0188101 | |||
| 649 | Ga0500654_135256 | |||
| 650 | Ga0500594_0002960 | |||
| 651 | Ga0500594_0031493 | |||
| 652 | Ga0500621_145451 | |||
| 653 | Ga0500652_006673 | |||
| 654 | Ga0500579_068289 | |||
| 655 | Ga0500588_0002196 | |||
| 656 | Ga0500600_0040310 | |||
| 657 | Ga0500633_0161789 | |||
| 658 | Ga0587111_0060554 | |||
| 659 | 2501945950 | |||
| 660 | 2515497683 | |||
| 661 | 2515720400 | |||
| 662 | 2515757795 | |||
| 663 | 2516084543 | |||
| 664 | 2516091603 | |||
| 665 | 2623585446 | |||
| 666 | 2676487237 | |||
| 667 | 2753266950 | |||
| 668 | 2772645278 | |||
| 669 | 2831939792 | |||
| 670 | 2832005841 | |||
| 671 | 2855672416 | |||
| 672 | 2855677245 | |||
| 673 | 2855686242 | |||
| 674 | 2856859361 | |||
| 675 | 2857291418 | |||
| 676 | 2858850279 | |||
| 677 | 2858884699 | |||
| 678 | 2858893348 | |||
| 679 | 2858898271 | |||
| 680 | 2858902579 | |||
| 681 | 2866066336 | |||
| 682 | 2867317109 | |||
| 683 | 2867322931 | |||
| 684 | 2867510528 | |||
| 685 | 2869048740 | |||
| 686 | 2869066816 | |||
| 687 | 2869075274 | |||
| 688 | 2880497542 | |||
| 689 | 2902584333 | |||
| 690 | 2929226106 | |||
| 691 | 2929232768 | |||
| 692 | 2996228142 | |||
| 693 | 649812774 | |||
| 694 | 8003832914 | |||
| 695 | 8003876623 | |||
| 696 | 8054710690 | |||
| 697 | 8054732392 | |||
| 698 | 8054739355 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ohp-assembly1.cif.gz_C | crystal structure of hgprt from vibrio cholerae | 0.966 | 14 | 183 |
| 3ohp-assembly1.cif.gz_D | crystal structure of hgprt from vibrio cholerae | 0.9637 | 14 | 183 |
| 4lyy-assembly1.cif.gz_D | crystal structure of hypoxanthine phosphoribosyltransferase from shewanella pealeana atcc 700345, nysgrc target 029677. | 0.9618 | 14 | 183 |
| 3ohp-assembly1.cif.gz_B | crystal structure of hgprt from vibrio cholerae | 0.9609 | 14 | 183 |
| 6d9r-assembly1.cif.gz_B | the substrate-bound crystal structure of hprt (hypoxanthine phosphoribosyltransferase) | 0.957 | 8 | 187 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4rhtD00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9391 | 10 | 183 | 3.40.50.2020 |
| 3acdA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9353 | 10 | 184 | 3.40.50.2020 |
| 4rhtD00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.928 | 10 | 183 | 3.40.50.2020 |
| af_I1LDB6_1_185_3.40.50.2020 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9193 | 8 | 187 | 3.40.50.2020 |
| 1hgxB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9114 | 9 | 187 | 3.40.50.2020 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A656SG47-F1-model_v4 | deleted | 0.9593 | 15 | 169 |
|
| AF-A0A0S4JLD9-F1-model_v4 | Hypoxanthine-guanine phosphoribosyltransferase, putative | 0.9591 | 12 | 152 |
GO:0000166
GO:0000287 GO:0004422 GO:0005829 GO:0006178 GO:0032263 GO:0032264 GO:0046100 |
| AF-A0A0F5LTM7-F1-model_v4 | Hypoxanthine phosphoribosyltransferase (EC 2.4.2.8) | 0.956 | 14 | 183 |
GO:0000166
GO:0000287 GO:0004422 GO:0005829 GO:0006166 GO:0006178 GO:0032263 GO:0032264 GO:0046100 GO:0052657 |
| AF-A0A316GPY1-F1-model_v4 | Hypoxanthine phosphoribosyltransferase (EC 2.4.2.8) | 0.9559 | 14 | 183 |
GO:0000166
GO:0000287 GO:0004422 GO:0005829 GO:0006166 GO:0006178 GO:0032263 GO:0032264 GO:0046100 GO:0052657 |
| AF-A0A3B8Q7S9-F1-model_v4 | Hypoxanthine phosphoribosyltransferase (EC 2.4.2.8) | 0.9556 | 14 | 190 |
GO:0000166
GO:0000287 GO:0004422 GO:0005829 GO:0006166 GO:0006178 GO:0032263 GO:0032264 GO:0046100 GO:0052657 |