F418057

General Info

Members Datasets Scaffolds Average Seq Length
349 225 698 192

Family's Representative Sequence

Representative Sequence 3300054114|Ga0501084_0083212|Ga0501084_0083212_668_1240
Length 190
Sequence MSDGSWYDADIQHVIISEKEIRDKIDELAKQVAADHERVTDGLLLVCVLKGAVMFMADFARALGRYGPPAELEFMAVSSYGQGTTSSGVVRILKDLDRDIAGRHVIVVEDIVDSGLTLSWLLRYLASRSAASVEVVALFRKPEAVKVTVPVRYVGFDIPNEFVVGYGLDFGERYRELPYVGVLKPEVYAR

Samples

Sample ID Description Type Environment
1 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
2 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
112 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
113 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
114 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
115 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
116 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
117 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
118 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
119 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
120 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
121 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
122 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
123 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
124 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
125 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
126 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
129 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
130 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
131 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
132 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
133 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
134 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
135 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
136 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
137 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
138 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
139 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
140 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
143 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
144 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
145 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
146 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
147 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
148 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
149 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
150 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
151 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
152 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
153 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
154 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
155 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
156 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
157 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
158 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
159 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
160 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
161 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
162 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
163 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
164 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
165 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
166 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
167 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
168 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
169 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
170 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
171 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
172 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
173 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
174 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
175 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
176 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
177 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
178 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
179 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
180 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
181 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
182 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
183 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
184 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
185 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 2501939600 Micromonospora sp. L5 Isolate Unclassified
187 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
188 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
189 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
190 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
191 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
192 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
193 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
194 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
195 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
196 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
197 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
198 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
199 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
200 2855683550 Micromonospora sp. RP3T Isolate Unclassified
201 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
202 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
203 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
204 2858882152 Micromonospora noduli MED15 Isolate Nodule
205 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
206 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
207 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
208 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
209 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
210 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
211 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
212 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
213 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
214 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
215 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
216 2902582711 Micromonospora sp. AP08 Isolate Unclassified
217 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
218 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
219 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
220 649633069 Micromonospora sp. L5 Isolate Unclassified
221 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
222 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
223 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
224 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
225 8054734606 Micromonospora hortensis NIE111 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 86.25
Metatranscriptomes 2.29
Isolates 11.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.87
Nodule 1.43
Rhizoplane 4.01
Rhizosphere 77.65
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501084_0083212 3300054114 Bacteria 2686
2 Ga0006778J45830_1027553 3300003162 Bacteria 858
3 JGI25406J46586_10002388 3300003203 Bacteria 8876
4 JGI25406J46586_10028499 3300003203 Bacteria 2127
5 JGI25406J46586_10064701 3300003203 Bacteria 1168
6 Ga0006777J48905_1106056 3300003308 Bacteria 741
7 Ga0007410J51695_1035210 3300003574 Bacteria 884
8 Ga0007429J51699_1044342 3300003579 Bacteria 1410
9 Ga0070658_10035763 3300005327 Bacteria 4001
10 Ga0070676_10050848 3300005328 Bacteria 2431
11 Ga0070683_100009056 3300005329 Bacteria 8496
12 Ga0070683_100012242 3300005329 Bacteria 7450
13 Ga0070683_100449167 3300005329 Bacteria 1230
14 Ga0070670_100991530 3300005331 Bacteria 764
15 Ga0068869_100009486 3300005334 Bacteria 6318
16 Ga0068869_100086731 3300005334 Bacteria 2347
17 Ga0070682_100184753 3300005337 Bacteria 1459
18 Ga0070682_100253165 3300005337 Bacteria 1271
19 Ga0068868_100025543 3300005338 Bacteria 4495
20 Ga0070661_100034047 3300005344 Bacteria 3694
21 Ga0070668_100000915 3300005347 Bacteria 20561
22 Ga0070668_100053659 3300005347 Bacteria 3108
23 Ga0070668_100079671 3300005347 Bacteria 2565
24 Ga0070675_100001609 3300005354 Bacteria 16654
25 Ga0070671_100366915 3300005355 Bacteria 1230
26 Ga0070674_100108747 3300005356 Bacteria 2032
27 Ga0070659_100020946 3300005366 Bacteria 4972
28 Ga0070659_100470175 3300005366 Bacteria 1069
29 Ga0070667_100308724 3300005367 Bacteria 1425
30 Ga0070713_100117125 3300005436 Bacteria 2331
31 Ga0070713_101155135 3300005436 Bacteria 749
32 Ga0070711_100246647 3300005439 Bacteria 1399
33 Ga0070694_100172753 3300005444 Bacteria 1593
34 Ga0070663_100010080 3300005455 Bacteria 5877
35 Ga0070662_100148419 3300005457 Bacteria 1823
36 Ga0070681_10251855 3300005458 Bacteria 1678
37 Ga0070685_10359425 3300005466 Bacteria 998
38 Ga0070679_100163814 3300005530 Bacteria 2197
39 Ga0070679_100222568 3300005530 Bacteria 1848
40 Ga0070684_100010857 3300005535 Bacteria 7237
41 Ga0070684_100012252 3300005535 Bacteria 6866
42 Ga0070684_100052292 3300005535 Bacteria 3552
43 Ga0070684_100272749 3300005535 Bacteria 1549
44 Ga0068853_100286657 3300005539 Bacteria 1519
45 Ga0070693_100061304 3300005547 Bacteria 2186
46 Ga0070665_100066291 3300005548 Bacteria 3622
47 Ga0070665_100293581 3300005548 Bacteria 1628
48 Ga0068855_100244251 3300005563 Bacteria 2005
49 Ga0068855_101193244 3300005563 Bacteria 792
50 Ga0070664_100008388 3300005564 Bacteria 8354
51 Ga0070664_100452867 3300005564 Bacteria 1178
52 Ga0070664_100506726 3300005564 Bacteria 1113
53 Ga0070664_100853057 3300005564 Bacteria 853
54 Ga0068857_100008236 3300005577 Bacteria 9009
55 Ga0068857_101073866 3300005577 Bacteria 777
56 Ga0068856_100190084 3300005614 Bacteria 2067
57 Ga0070702_100113079 3300005615 Bacteria 1687
58 Ga0068859_100293211 3300005617 Bacteria 1720
59 Ga0068859_100538182 3300005617 Bacteria 1263
60 Ga0068864_100103365 3300005618 Bacteria 2529
61 Ga0068864_100466329 3300005618 Bacteria 1210
62 Ga0068866_10306336 3300005718 Bacteria 994
63 Ga0068861_100106879 3300005719 Bacteria 2236
64 Ga0068863_100017891 3300005841 Bacteria 6782
65 Ga0068863_100379221 3300005841 Bacteria 1380
66 Ga0068858_100028941 3300005842 Bacteria 5144
67 Ga0068860_100097367 3300005843 Bacteria 2805
68 Ga0068860_100551674 3300005843 Bacteria 1155
69 Ga0068862_100183325 3300005844 Bacteria 1880
70 Ga0068862_100344185 3300005844 Bacteria 1382
71 Ga0068862_100377449 3300005844 Bacteria 1321
72 Ga0081455_10544310 3300005937 Bacteria 769
73 Ga0081540_1019150 3300005983 Bacteria 4173
74 Ga0081539_10000779 3300005985 Bacteria 62135
75 Ga0081539_10001096 3300005985 Bacteria 49234
76 Ga0081539_10004059 3300005985 Bacteria 16753
77 Ga0081539_10004175 3300005985 Bacteria 16385
78 Ga0081539_10004805 3300005985 Bacteria 14518
79 Ga0081539_10015763 3300005985 Bacteria 5466
80 Ga0081539_10150267 3300005985 Bacteria 1121
81 Ga0075364_10051659 3300006051 Bacteria 2685
82 Ga0070712_100586954 3300006175 Bacteria 942
83 Ga0075428_100200260 3300006844 Bacteria 2159
84 Ga0075428_100329363 3300006844 Bacteria 1640
85 Ga0075428_100669890 3300006844 Bacteria 1106
86 Ga0075430_100000906 3300006846 Bacteria 23226
87 Ga0075430_100057182 3300006846 Bacteria 3281
88 Ga0075430_100064749 3300006846 Bacteria 3071
89 Ga0075430_100250519 3300006846 Bacteria 1468
90 Ga0075431_100007731 3300006847 Bacteria 10710
91 Ga0075431_100053983 3300006847 Bacteria 4144
92 Ga0075429_100069299 3300006880 Bacteria 3071
93 Ga0075429_100283556 3300006880 Bacteria 1451
94 Ga0075429_100342383 3300006880 Bacteria 1309
95 Ga0097620_100293217 3300006931 Bacteria 1720
96 Ga0097620_100538221 3300006931 Bacteria 1263
97 Ga0105251_10069174 3300009011 Bacteria 1646
98 Ga0111539_10018989 3300009094 Bacteria 8499
99 Ga0111539_10442366 3300009094 Bacteria 1514
100 Ga0105245_10012776 3300009098 Bacteria 7315
101 Ga0114129_10006682 3300009147 Bacteria 16381
102 Ga0114129_10010147 3300009147 Bacteria 13428
103 Ga0114129_10011002 3300009147 Bacteria 12891
104 Ga0114129_10205292 3300009147 Bacteria 2666
105 Ga0114129_10528549 3300009147 Bacteria 1537
106 Ga0114129_10737460 3300009147 Bacteria 1262
107 Ga0105243_10034721 3300009148 Bacteria 3907
108 Ga0105248_10017097 3300009177 Bacteria 7989
109 Ga0105248_10368078 3300009177 Bacteria 1618
110 Ga0105237_10375913 3300009545 Bacteria 1425
111 Ga0105238_10477434 3300009551 Bacteria 1246
112 Ga0105249_10086969 3300009553 Bacteria 2916
113 Ga0105239_10191731 3300010375 Bacteria 2288
114 Ga0105239_10391321 3300010375 Bacteria 1572
115 Ga0105239_10507676 3300010375 Bacteria 1371
116 Ga0105246_10073339 3300011119 Bacteria 2416
117 Ga0105246_10835002 3300011119 Bacteria 820
118 Ga0157369_10003881 3300013105 Bacteria 17737
119 Ga0157374_10336244 3300013296 Bacteria 1498
120 Ga0157374_10837541 3300013296 Bacteria 936
121 Ga0163162_10902778 3300013306 Bacteria 997
122 Ga0157372_10135578 3300013307 Bacteria 2835
123 Ga0157372_10271535 3300013307 Bacteria 1971
124 Ga0157372_10292228 3300013307 Bacteria 1895
125 Ga0163163_10029795 3300014325 Bacteria 5251
126 Ga0163163_10138542 3300014325 Bacteria 2475
127 Ga0163163_10288920 3300014325 Bacteria 1692
128 Ga0157380_11052343 3300014326 Bacteria 850
129 Ga0157377_10358507 3300014745 Bacteria 981
130 Ga0157379_10106543 3300014968 Bacteria 2516
131 Ga0157379_10155746 3300014968 Bacteria 2061
132 Ga0206354_10224837 3300020081 Bacteria 2311
133 Ga0206353_11450956 3300020082 Bacteria 759
134 Ga0224712_10009127 3300022467 Bacteria 2974
135 Ga0207710_10075322 3300025900 Bacteria 1555
136 Ga0207688_10013498 3300025901 Bacteria 4439
137 Ga0207645_10116537 3300025907 Bacteria 1732
138 Ga0207705_10089689 3300025909 Bacteria 2250
139 Ga0207660_10189984 3300025917 Bacteria 1599
140 Ga0207649_10011446 3300025920 Bacteria 4893
141 Ga0207649_10197504 3300025920 Bacteria 1419
142 Ga0207649_10822168 3300025920 Bacteria 726
143 Ga0207652_10484946 3300025921 Bacteria 1113
144 Ga0207652_10618471 3300025921 Bacteria 970
145 Ga0207694_10781523 3300025924 Bacteria 806
146 Ga0207659_10013448 3300025926 Bacteria 5242
147 Ga0207687_10006347 3300025927 Bacteria 7812
148 Ga0207700_10191241 3300025928 Bacteria 1720
149 Ga0207664_10111863 3300025929 Bacteria 2272
150 Ga0207644_10258414 3300025931 Bacteria 1392
151 Ga0207706_10129665 3300025933 Bacteria 2218
152 Ga0207670_10319678 3300025936 Bacteria 1221
153 Ga0207691_10219209 3300025940 Bacteria 1650
154 Ga0207711_10254089 3300025941 Bacteria 1614
155 Ga0207689_10132194 3300025942 Bacteria 2054
156 Ga0207689_10233021 3300025942 Bacteria 1522
157 Ga0207661_10038864 3300025944 Bacteria 3732
158 Ga0207661_10198934 3300025944 Bacteria 1761
159 Ga0207679_10056821 3300025945 Bacteria 2891
160 Ga0207679_10272248 3300025945 Bacteria 1449
161 Ga0207679_10705843 3300025945 Bacteria 916
162 Ga0207679_10940535 3300025945 Bacteria 791
163 Ga0207668_10019384 3300025972 Bacteria 4299
164 Ga0207668_10376097 3300025972 Bacteria 1194
165 Ga0207658_10283835 3300025986 Bacteria 1420
166 Ga0207677_10014365 3300026023 Bacteria 4622
167 Ga0207703_10055571 3300026035 Bacteria 3221
168 Ga0207703_10076017 3300026035 Bacteria 2785
169 Ga0207678_10102155 3300026067 Bacteria 2448
170 Ga0207678_10208655 3300026067 Bacteria 1671
171 Ga0207641_10053340 3300026088 Bacteria 3427
172 Ga0207676_10081956 3300026095 Bacteria 2622
173 Ga0207674_10015167 3300026116 Bacteria 8479
174 Ga0207674_10028264 3300026116 Bacteria 5920
175 Ga0207675_100165926 3300026118 Bacteria 2109
176 Ga0207428_10010084 3300027907 Bacteria 8456
177 Ga0268266_10045947 3300028379 Bacteria 3738
178 Ga0268266_10182610 3300028379 Bacteria 1911
179 Ga0268265_10121570 3300028380 Bacteria 2152
180 Ga0268265_10554685 3300028380 Bacteria 1091
181 Ga0268264_10107986 3300028381 Bacteria 2432
182 Ga0307517_10041929 3300028786 Bacteria 4925
183 Ga0307515_10000083 3300028794 Bacteria 222889
184 Ga0307515_10014982 3300028794 Bacteria 14323
185 Ga0307515_10353496 3300028794 Bacteria 1114
186 Ga0307512_10011572 3300030522 Bacteria 8354
187 Ga0307512_10014056 3300030522 Bacteria 7473
188 Ga0307512_10021079 3300030522 Bacteria 5883
189 Ga0265328_10018454 3300031239 Bacteria 2690
190 Ga0307513_10004641 3300031456 Bacteria 18282
191 Ga0307513_10076489 3300031456 Bacteria 3471
192 Ga0307513_10112486 3300031456 Bacteria 2712
193 Ga0307408_100024967 3300031548 Bacteria 4088
194 Ga0307508_10012057 3300031616 Bacteria 7908
195 Ga0307508_10021385 3300031616 Bacteria 5882
196 Ga0307516_10002906 3300031730 Bacteria 22441
197 Ga0307516_10027518 3300031730 Bacteria 5765
198 Ga0307405_10011835 3300031731 Bacteria 4592
199 Ga0307405_10100564 3300031731 Bacteria 1938
200 Ga0307405_10243591 3300031731 Bacteria 1333
201 Ga0307413_10189822 3300031824 Bacteria 1474
202 Ga0307413_10340426 3300031824 Bacteria 1153
203 Ga0307410_10521294 3300031852 Bacteria 981
204 Ga0326468_10000896 3300031889 Bacteria 2906
205 Ga0307406_10036259 3300031901 Bacteria 3037
206 Ga0307406_10044667 3300031901 Bacteria 2778
207 Ga0307406_10050519 3300031901 Bacteria 2637
208 Ga0307406_10146911 3300031901 Bacteria 1677
209 Ga0307406_10259560 3300031901 Bacteria 1314
210 Ga0307406_10315365 3300031901 Bacteria 1207
211 Ga0307406_10352213 3300031901 Bacteria 1151
212 Ga0307407_10253890 3300031903 Bacteria 1206
213 Ga0307412_10052235 3300031911 Bacteria 2706
214 Ga0307409_100240286 3300031995 Bacteria 1648
215 Ga0307416_100021524 3300032002 Bacteria 4632
216 Ga0307416_100056099 3300032002 Bacteria 3177
217 Ga0307416_100129946 3300032002 Bacteria 2265
218 Ga0307416_100203580 3300032002 Bacteria 1881
219 Ga0307416_101572382 3300032002 Bacteria 763
220 Ga0307414_10398785 3300032004 Bacteria 1194
221 Ga0307411_10133343 3300032005 Bacteria 1819
222 Ga0307411_10310946 3300032005 Bacteria 1268
223 Ga0307411_10481462 3300032005 Bacteria 1045
224 Ga0307415_100012886 3300032126 Bacteria 4855
225 Ga0307415_100041188 3300032126 Bacteria 3065
226 Ga0307415_100048625 3300032126 Bacteria 2863
227 Ga0307415_100076578 3300032126 Bacteria 2372
228 Ga0307415_100087161 3300032126 Bacteria 2248
229 Ga0307510_10121834 3300033180 Bacteria 2309
230 Ga0307510_10192324 3300033180 Bacteria 1587
231 Ga0307510_10250589 3300033180 Bacteria 1259
232 Ga0373938_0130974 3300034957 Bacteria 654
233 Ga0373951_0000013 3300035091 Bacteria 71164
234 Ga0373939_0043627 3300035114 Bacteria 1362
235 Ga0373939_0046991 3300035114 Bacteria 1324
236 Ga0373943_0454114 3300035170 Bacteria 745
237 Ga0373955_0162321 3300035172 Bacteria 1319
238 Ga0373955_0507837 3300035172 Bacteria 736
239 Ga0373942_0141485 3300035207 Bacteria 766
240 Ga0373962_0006751 3300035242 Bacteria 2786
241 Ga0373931_0232334 3300035691 Bacteria 1115
242 Ga0373937_0275273 3300036401 Bacteria 1589
243 Ga0373925_0403871 3300037068 Bacteria 1115
244 Ga0395899_0328778 3300037312 Bacteria 1028
245 Ga0395900_0029565 3300037418 Bacteria 5621
246 Ga0395900_0068053 3300037418 Bacteria 3659
247 Ga0395901_0039004 3300038443 Bacteria 4914
248 Ga0395901_0152563 3300038443 Bacteria 2427
249 Ga0451797_0247151 3300041453 Bacteria 1209
250 Ga0451853_1491772 3300041512 Bacteria 1638
251 Ga0439448_0165339 3300042005 Bacteria 771
252 Ga0439463_066217 3300042016 Bacteria 924
253 Ga0450903_028168 3300042138 Bacteria 853
254 Ga0466957_0023278 3300044842 Bacteria 3661
255 Ga0466957_0618845 3300044842 Bacteria 759
256 Ga0466967_0498958 3300045976 Bacteria 1194
257 Ga0495629_0055557 3300046459 Bacteria 2768
258 Ga0495629_0330777 3300046459 Bacteria 1041
259 Ga0495594_0007050 3300046499 Bacteria 5779
260 Ga0495594_0096536 3300046499 Bacteria 1661
261 Ga0495594_0194953 3300046499 Bacteria 1154
262 Ga0495630_0256179 3300046517 Bacteria 1337
263 Ga0495632_0050217 3300046519 Bacteria 2058
264 Ga0495581_0329365 3300047315 Bacteria 892
265 Ga0496104_0062958 3300048907 Bacteria 3517
266 Ga0496104_0095138 3300048907 Bacteria 2850
267 Ga0496104_0405093 3300048907 Bacteria 1276
268 Ga0496105_0087942 3300048908 Bacteria 2567
269 Ga0496105_0166985 3300048908 Bacteria 1805
270 Ga0496108_0000071 3300048911 Bacteria 113930
271 Ga0496108_0009017 3300048911 Bacteria 8082
272 Ga0496110_0130567 3300048913 Bacteria 2268
273 Ga0496111_0048360 3300048914 Bacteria 3064
274 Ga0496112_0020271 3300048915 Bacteria 6298
275 Ga0496112_0267130 3300048915 Bacteria 1659
276 Ga0496112_0328438 3300048915 Bacteria 1473
277 Ga0496113_0003155 3300048916 Bacteria 9811
278 Ga0501047_0048636 3300049581 Bacteria 4095
279 nmdc:mga00v17_340009_c1 3300050491 Bacteria 976
280 nmdc:mga05p37_1585_c2 3300050507 Bacteria 25594
281 nmdc:mga05p37_27327_c1 3300050507 Bacteria 6947
282 nmdc:mga05p37_519528_c1 3300050507 Bacteria 1362
283 nmdc:mga05p37_83802_c1 3300050507 Bacteria 3928
284 nmdc:mga09592_176320_c1 3300050508 Bacteria 1849
285 nmdc:mga09592_177_c1 3300050508 Bacteria 45265
286 nmdc:mga0qj67_311870_c1 3300050509 Bacteria 1274
287 nmdc:mga0qj67_318538_c1 3300050509 Bacteria 1259
288 nmdc:mga0qj67_36_c3 3300050509 Bacteria 71496
289 nmdc:mga0qj67_517_c1 3300050509 Bacteria 26296
290 nmdc:mga06r32_21285_c1 3300050510 Bacteria 5985
291 nmdc:mga06r32_290_c2 3300050510 Bacteria 38684
292 nmdc:mga08y16_87818_c1 3300050511 Bacteria 3240
293 Ga0495619_0006039 3300053085 Bacteria 7674
294 Ga0500644_0106025 3300053088 Bacteria 1075
295 Ga0500644_0127202 3300053088 Bacteria 999
296 Ga0500646_0000052 3300053090 Bacteria 32125
297 Ga0500583_0008711 3300053092 Bacteria 3661
298 Ga0500651_0194218 3300053093 Bacteria 1200
299 Ga0500650_0188101 3300053098 Bacteria 944
300 Ga0500654_135256 3300053099 Bacteria 919
301 Ga0500594_0002960 3300053118 Bacteria 3711
302 Ga0500594_0031493 3300053118 Bacteria 1399
303 Ga0500621_145451 3300053126 Bacteria 895
304 Ga0500652_006673 3300053131 Bacteria 3731
305 Ga0500579_068289 3300053143 Bacteria 2066
306 Ga0500588_0002196 3300053146 Bacteria 3914
307 Ga0500600_0040310 3300053149 Bacteria 2698
308 Ga0500633_0161789 3300053160 Bacteria 840
309 Ga0587111_0060554 3300060346 Bacteria 860
310 2501945950 2501939600 Bacteria 6907073
311 2515497683 2515154088 Bacteria 5526283
312 2515720400 2515154129 Bacteria 5584369
313 2515757795 2515154137 Bacteria 5711575
314 2516084543 2515154202 Bacteria 5471270
315 2516091603 2515154203 Bacteria 5458536
316 2623585446 2622736626 Bacteria 7181580
317 2676487237 2675903059 Bacteria 8644972
318 2753266950 2751185782 Bacteria 11227053
319 2772645278 2772190715 Bacteria 6959372
320 2831939792 2831935698 Bacteria 5963223
321 2832005841 2832004796 Bacteria 6538017
322 2855672416 2855670206 Bacteria 7120389
323 2855677245 2855676851 Bacteria 7063653
324 2855686242 2855683550 Bacteria 7134265
325 2856859361 2856858025 Bacteria 7255264
326 2857291418 2857288857 Bacteria 7189066
327 2858850279 2858848962 Bacteria 6963058
328 2858884699 2858882152 Bacteria 7230291
329 2858893348 2858888857 Bacteria 7060307
330 2858898271 2858895516 Bacteria 7378898
331 2858902579 2858902515 Bacteria 7086037
332 2866066336 2866065130 Bacteria 6518152
333 2867317109 2867312974 Bacteria 7058875
334 2867322931 2867319477 Bacteria 7069771
335 2867510528 2867507094 Bacteria 6506033
336 2869048740 2869048445 Bacteria 6875584
337 2869066816 2869061728 Bacteria 7112407
338 2869075274 2869068681 Bacteria 7205615
339 2880497542 2880495981 Bacteria 7340502
340 2902584333 2902582711 Bacteria 6187705
341 2929226106 2929219909 Bacteria 6984360
342 2929232768 2929226422 Bacteria 7248583
343 2996228142 2996221748 Bacteria 6799777
344 649812774 649633069 Bacteria 6962533
345 8003832914 8003830390 Bacteria 6541657
346 8003876623 8003870546 Bacteria 7396674
347 8054710690 8054704163 Bacteria 7247792
348 8054732392 8054727385 Bacteria 7558670
349 8054739355 8054734606 Bacteria 6947278
350 Ga0501084_0083212
351 Ga0006778J45830_1027553
352 JGI25406J46586_10002388
353 JGI25406J46586_10028499
354 JGI25406J46586_10064701
355 Ga0006777J48905_1106056
356 Ga0007410J51695_1035210
357 Ga0007429J51699_1044342
358 Ga0070658_10035763
359 Ga0070676_10050848
360 Ga0070683_100009056
361 Ga0070683_100012242
362 Ga0070683_100449167
363 Ga0070670_100991530
364 Ga0068869_100009486
365 Ga0068869_100086731
366 Ga0070682_100184753
367 Ga0070682_100253165
368 Ga0068868_100025543
369 Ga0070661_100034047
370 Ga0070668_100000915
371 Ga0070668_100053659
372 Ga0070668_100079671
373 Ga0070675_100001609
374 Ga0070671_100366915
375 Ga0070674_100108747
376 Ga0070659_100020946
377 Ga0070659_100470175
378 Ga0070667_100308724
379 Ga0070713_100117125
380 Ga0070713_101155135
381 Ga0070711_100246647
382 Ga0070694_100172753
383 Ga0070663_100010080
384 Ga0070662_100148419
385 Ga0070681_10251855
386 Ga0070685_10359425
387 Ga0070679_100163814
388 Ga0070679_100222568
389 Ga0070684_100010857
390 Ga0070684_100012252
391 Ga0070684_100052292
392 Ga0070684_100272749
393 Ga0068853_100286657
394 Ga0070693_100061304
395 Ga0070665_100066291
396 Ga0070665_100293581
397 Ga0068855_100244251
398 Ga0068855_101193244
399 Ga0070664_100008388
400 Ga0070664_100452867
401 Ga0070664_100506726
402 Ga0070664_100853057
403 Ga0068857_100008236
404 Ga0068857_101073866
405 Ga0068856_100190084
406 Ga0070702_100113079
407 Ga0068859_100293211
408 Ga0068859_100538182
409 Ga0068864_100103365
410 Ga0068864_100466329
411 Ga0068866_10306336
412 Ga0068861_100106879
413 Ga0068863_100017891
414 Ga0068863_100379221
415 Ga0068858_100028941
416 Ga0068860_100097367
417 Ga0068860_100551674
418 Ga0068862_100183325
419 Ga0068862_100344185
420 Ga0068862_100377449
421 Ga0081455_10544310
422 Ga0081540_1019150
423 Ga0081539_10000779
424 Ga0081539_10001096
425 Ga0081539_10004059
426 Ga0081539_10004175
427 Ga0081539_10004805
428 Ga0081539_10015763
429 Ga0081539_10150267
430 Ga0075364_10051659
431 Ga0070712_100586954
432 Ga0075428_100200260
433 Ga0075428_100329363
434 Ga0075428_100669890
435 Ga0075430_100000906
436 Ga0075430_100057182
437 Ga0075430_100064749
438 Ga0075430_100250519
439 Ga0075431_100007731
440 Ga0075431_100053983
441 Ga0075429_100069299
442 Ga0075429_100283556
443 Ga0075429_100342383
444 Ga0097620_100293217
445 Ga0097620_100538221
446 Ga0105251_10069174
447 Ga0111539_10018989
448 Ga0111539_10442366
449 Ga0105245_10012776
450 Ga0114129_10006682
451 Ga0114129_10010147
452 Ga0114129_10011002
453 Ga0114129_10205292
454 Ga0114129_10528549
455 Ga0114129_10737460
456 Ga0105243_10034721
457 Ga0105248_10017097
458 Ga0105248_10368078
459 Ga0105237_10375913
460 Ga0105238_10477434
461 Ga0105249_10086969
462 Ga0105239_10191731
463 Ga0105239_10391321
464 Ga0105239_10507676
465 Ga0105246_10073339
466 Ga0105246_10835002
467 Ga0157369_10003881
468 Ga0157374_10336244
469 Ga0157374_10837541
470 Ga0163162_10902778
471 Ga0157372_10135578
472 Ga0157372_10271535
473 Ga0157372_10292228
474 Ga0163163_10029795
475 Ga0163163_10138542
476 Ga0163163_10288920
477 Ga0157380_11052343
478 Ga0157377_10358507
479 Ga0157379_10106543
480 Ga0157379_10155746
481 Ga0206354_10224837
482 Ga0206353_11450956
483 Ga0224712_10009127
484 Ga0207710_10075322
485 Ga0207688_10013498
486 Ga0207645_10116537
487 Ga0207705_10089689
488 Ga0207660_10189984
489 Ga0207649_10011446
490 Ga0207649_10197504
491 Ga0207649_10822168
492 Ga0207652_10484946
493 Ga0207652_10618471
494 Ga0207694_10781523
495 Ga0207659_10013448
496 Ga0207687_10006347
497 Ga0207700_10191241
498 Ga0207664_10111863
499 Ga0207644_10258414
500 Ga0207706_10129665
501 Ga0207670_10319678
502 Ga0207691_10219209
503 Ga0207711_10254089
504 Ga0207689_10132194
505 Ga0207689_10233021
506 Ga0207661_10038864
507 Ga0207661_10198934
508 Ga0207679_10056821
509 Ga0207679_10272248
510 Ga0207679_10705843
511 Ga0207679_10940535
512 Ga0207668_10019384
513 Ga0207668_10376097
514 Ga0207658_10283835
515 Ga0207677_10014365
516 Ga0207703_10055571
517 Ga0207703_10076017
518 Ga0207678_10102155
519 Ga0207678_10208655
520 Ga0207641_10053340
521 Ga0207676_10081956
522 Ga0207674_10015167
523 Ga0207674_10028264
524 Ga0207675_100165926
525 Ga0207428_10010084
526 Ga0268266_10045947
527 Ga0268266_10182610
528 Ga0268265_10121570
529 Ga0268265_10554685
530 Ga0268264_10107986
531 Ga0307517_10041929
532 Ga0307515_10000083
533 Ga0307515_10014982
534 Ga0307515_10353496
535 Ga0307512_10011572
536 Ga0307512_10014056
537 Ga0307512_10021079
538 Ga0265328_10018454
539 Ga0307513_10004641
540 Ga0307513_10076489
541 Ga0307513_10112486
542 Ga0307408_100024967
543 Ga0307508_10012057
544 Ga0307508_10021385
545 Ga0307516_10002906
546 Ga0307516_10027518
547 Ga0307405_10011835
548 Ga0307405_10100564
549 Ga0307405_10243591
550 Ga0307413_10189822
551 Ga0307413_10340426
552 Ga0307410_10521294
553 Ga0326468_10000896
554 Ga0307406_10036259
555 Ga0307406_10044667
556 Ga0307406_10050519
557 Ga0307406_10146911
558 Ga0307406_10259560
559 Ga0307406_10315365
560 Ga0307406_10352213
561 Ga0307407_10253890
562 Ga0307412_10052235
563 Ga0307409_100240286
564 Ga0307416_100021524
565 Ga0307416_100056099
566 Ga0307416_100129946
567 Ga0307416_100203580
568 Ga0307416_101572382
569 Ga0307414_10398785
570 Ga0307411_10133343
571 Ga0307411_10310946
572 Ga0307411_10481462
573 Ga0307415_100012886
574 Ga0307415_100041188
575 Ga0307415_100048625
576 Ga0307415_100076578
577 Ga0307415_100087161
578 Ga0307510_10121834
579 Ga0307510_10192324
580 Ga0307510_10250589
581 Ga0373938_0130974
582 Ga0373951_0000013
583 Ga0373939_0043627
584 Ga0373939_0046991
585 Ga0373943_0454114
586 Ga0373955_0162321
587 Ga0373955_0507837
588 Ga0373942_0141485
589 Ga0373962_0006751
590 Ga0373931_0232334
591 Ga0373937_0275273
592 Ga0373925_0403871
593 Ga0395899_0328778
594 Ga0395900_0029565
595 Ga0395900_0068053
596 Ga0395901_0039004
597 Ga0395901_0152563
598 Ga0451797_0247151
599 Ga0451853_1491772
600 Ga0439448_0165339
601 Ga0439463_066217
602 Ga0450903_028168
603 Ga0466957_0023278
604 Ga0466957_0618845
605 Ga0466967_0498958
606 Ga0495629_0055557
607 Ga0495629_0330777
608 Ga0495594_0007050
609 Ga0495594_0096536
610 Ga0495594_0194953
611 Ga0495630_0256179
612 Ga0495632_0050217
613 Ga0495581_0329365
614 Ga0496104_0062958
615 Ga0496104_0095138
616 Ga0496104_0405093
617 Ga0496105_0087942
618 Ga0496105_0166985
619 Ga0496108_0000071
620 Ga0496108_0009017
621 Ga0496110_0130567
622 Ga0496111_0048360
623 Ga0496112_0020271
624 Ga0496112_0267130
625 Ga0496112_0328438
626 Ga0496113_0003155
627 Ga0501047_0048636
628 nmdc:mga00v17_340009_c1
629 nmdc:mga05p37_1585_c2
630 nmdc:mga05p37_27327_c1
631 nmdc:mga05p37_519528_c1
632 nmdc:mga05p37_83802_c1
633 nmdc:mga09592_176320_c1
634 nmdc:mga09592_177_c1
635 nmdc:mga0qj67_311870_c1
636 nmdc:mga0qj67_318538_c1
637 nmdc:mga0qj67_36_c3
638 nmdc:mga0qj67_517_c1
639 nmdc:mga06r32_21285_c1
640 nmdc:mga06r32_290_c2
641 nmdc:mga08y16_87818_c1
642 Ga0495619_0006039
643 Ga0500644_0106025
644 Ga0500644_0127202
645 Ga0500646_0000052
646 Ga0500583_0008711
647 Ga0500651_0194218
648 Ga0500650_0188101
649 Ga0500654_135256
650 Ga0500594_0002960
651 Ga0500594_0031493
652 Ga0500621_145451
653 Ga0500652_006673
654 Ga0500579_068289
655 Ga0500588_0002196
656 Ga0500600_0040310
657 Ga0500633_0161789
658 Ga0587111_0060554
659 2501945950
660 2515497683
661 2515720400
662 2515757795
663 2516084543
664 2516091603
665 2623585446
666 2676487237
667 2753266950
668 2772645278
669 2831939792
670 2832005841
671 2855672416
672 2855677245
673 2855686242
674 2856859361
675 2857291418
676 2858850279
677 2858884699
678 2858893348
679 2858898271
680 2858902579
681 2866066336
682 2867317109
683 2867322931
684 2867510528
685 2869048740
686 2869066816
687 2869075274
688 2880497542
689 2902584333
690 2929226106
691 2929232768
692 2996228142
693 649812774
694 8003832914
695 8003876623
696 8054710690
697 8054732392
698 8054739355

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00156

Pribosyltran

Phosphoribosyl transferase domain

15

171

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ohp-assembly1.cif.gz_C crystal structure of hgprt from vibrio cholerae 0.966 14 183
3ohp-assembly1.cif.gz_D crystal structure of hgprt from vibrio cholerae 0.9637 14 183
4lyy-assembly1.cif.gz_D crystal structure of hypoxanthine phosphoribosyltransferase from shewanella pealeana atcc 700345, nysgrc target 029677. 0.9618 14 183
3ohp-assembly1.cif.gz_B crystal structure of hgprt from vibrio cholerae 0.9609 14 183
6d9r-assembly1.cif.gz_B the substrate-bound crystal structure of hprt (hypoxanthine phosphoribosyltransferase) 0.957 8 187
ID Description Score Start End Superfamily
4rhtD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9391 10 183 3.40.50.2020
3acdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9353 10 184 3.40.50.2020
4rhtD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.928 10 183 3.40.50.2020
af_I1LDB6_1_185_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9193 8 187 3.40.50.2020
1hgxB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9114 9 187 3.40.50.2020
ID Description Score Start End GO Terms
AF-A0A656SG47-F1-model_v4 deleted 0.9593 15 169
AF-A0A0S4JLD9-F1-model_v4 Hypoxanthine-guanine phosphoribosyltransferase, putative 0.9591 12 152 GO:0000166
GO:0000287
GO:0004422
GO:0005829
GO:0006178
GO:0032263
GO:0032264
GO:0046100
AF-A0A0F5LTM7-F1-model_v4 Hypoxanthine phosphoribosyltransferase (EC 2.4.2.8) 0.956 14 183 GO:0000166
GO:0000287
GO:0004422
GO:0005829
GO:0006166
GO:0006178
GO:0032263
GO:0032264
GO:0046100
GO:0052657
AF-A0A316GPY1-F1-model_v4 Hypoxanthine phosphoribosyltransferase (EC 2.4.2.8) 0.9559 14 183 GO:0000166
GO:0000287
GO:0004422
GO:0005829
GO:0006166
GO:0006178
GO:0032263
GO:0032264
GO:0046100
GO:0052657
AF-A0A3B8Q7S9-F1-model_v4 Hypoxanthine phosphoribosyltransferase (EC 2.4.2.8) 0.9556 14 190 GO:0000166
GO:0000287
GO:0004422
GO:0005829
GO:0006166
GO:0006178
GO:0032263
GO:0032264
GO:0046100
GO:0052657

Map