F418018

General Info

Members Datasets Scaffolds Average Seq Length
349 222 698 285

Family's Representative Sequence

Representative Sequence 3300048924|Ga0496121_0003816|Ga0496121_0003816_12723_13766
Length 347
Sequence MILAAAGTCNLPVIILGRPDATARYVDEVCRPNGKVPSAYARIPVDLCPRRPRIRRRFSFRQDIEMAIQTVGIIGSGLMGTGIAQACATSGLQVIIRDIDDAALKRGLDSISSSLARLVSKEKTTEAAKTAALAAIKTTTDLGALAAADFIIEAATENLGLKQKILKEIEAIAAPSCIIATNTSSVSITKLAATLSHPGRFVGMHFFNPVPVMALVEIIRAIQTTDATFAATEELARQVGKTPIGVKNAPGFVVNRILCPMINEAIFVLQEGLAAPEEIDAGMKLGANHPIGPLALADLVGLDTLLAVMNVFYADFKDSKYRPAPLLQEMVDAGYLGRKSGRGFYTY

Samples

Sample ID Description Type Environment
1 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
46 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
76 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
79 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
80 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
81 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
82 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
83 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
84 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
85 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
86 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
87 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
88 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
89 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
90 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
91 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
92 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
93 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
94 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
95 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
96 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
97 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
98 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
99 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
100 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
101 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
102 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
103 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
104 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
105 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
106 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
107 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
108 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
110 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
111 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
112 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
113 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
114 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
115 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
116 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
117 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
118 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
119 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
120 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
121 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
122 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
123 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
124 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
125 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
126 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
127 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
128 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
129 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
130 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
131 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
132 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
133 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
134 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
135 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
136 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
137 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
138 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
139 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
140 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
141 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
142 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
143 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
144 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
145 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
146 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
147 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
148 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
149 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
150 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
151 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
152 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
153 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
154 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
155 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
156 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
157 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
158 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
159 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
160 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
161 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
162 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
163 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
164 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
165 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
166 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
167 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
168 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
169 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
170 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
171 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
172 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
173 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
174 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
175 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
176 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
177 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
178 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
179 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
180 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
181 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
182 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
183 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
184 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
185 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
186 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
187 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
188 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
189 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
190 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
191 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
192 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
193 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
194 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
195 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
196 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
197 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
198 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
199 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
201 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
202 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
203 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
204 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
205 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
206 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
207 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
208 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
209 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
210 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
211 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
212 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
213 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
214 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
216 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
217 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
218 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
219 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
220 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
221 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
222 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.85
Metatranscriptomes 1.15
Isolates 2.01

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.15
Rhizosphere 94.27
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496121_0003816 3300048924 Bacteria 20993
2 SwRhRL2b_contig_510364 2162886007 Bacteria 3896
3 Ga0070690_100159514 3300005330 Bacteria 1544
4 Ga0070670_100005190 3300005331 Bacteria 10966
5 Ga0068868_100036652 3300005338 Bacteria 3798
6 Ga0070660_100042834 3300005339 Bacteria 3457
7 Ga0070689_100000294 3300005340 Bacteria 28902
8 Ga0070689_100002463 3300005340 Bacteria 12096
9 Ga0070687_100000468 3300005343 Bacteria 13589
10 Ga0070673_100572664 3300005364 Bacteria 1028
11 Ga0070688_100000055 3300005365 Bacteria 54317
12 Ga0070688_100003531 3300005365 Bacteria 8058
13 Ga0070659_100323643 3300005366 Bacteria 1289
14 Ga0070709_10049474 3300005434 Bacteria 2629
15 Ga0070714_100198839 3300005435 Bacteria 1833
16 Ga0070701_10050626 3300005438 Bacteria 2152
17 Ga0070701_10208249 3300005438 Bacteria 1160
18 Ga0070694_100023586 3300005444 Bacteria 3960
19 Ga0070694_100273946 3300005444 Bacteria 1284
20 Ga0070708_100642883 3300005445 Bacteria 1000
21 Ga0070685_10003891 3300005466 Bacteria 7548
22 Ga0070707_100001356 3300005468 Bacteria 24065
23 Ga0070707_100002196 3300005468 Bacteria 18638
24 Ga0070698_100052014 3300005471 Bacteria 4169
25 Ga0070699_100075082 3300005518 Bacteria 2942
26 Ga0070679_100182912 3300005530 Bacteria 2068
27 Ga0070684_100051997 3300005535 Bacteria 3561
28 Ga0070697_100127538 3300005536 Bacteria 2132
29 Ga0070697_100398455 3300005536 Bacteria 1194
30 Ga0070686_100004146 3300005544 Bacteria 7975
31 Ga0070686_100241386 3300005544 Bacteria 1316
32 Ga0070695_100202854 3300005545 Bacteria 1418
33 Ga0070696_100095976 3300005546 Bacteria 2118
34 Ga0070704_100022773 3300005549 Bacteria 4080
35 Ga0070704_100084162 3300005549 Bacteria 2351
36 Ga0068855_100086998 3300005563 Bacteria 3613
37 Ga0070664_100019976 3300005564 Bacteria 5515
38 Ga0070664_100319232 3300005564 Bacteria 1407
39 Ga0068854_100316512 3300005578 Bacteria 1267
40 Ga0068856_100089471 3300005614 Bacteria 3062
41 Ga0070702_100044411 3300005615 Bacteria 2509
42 Ga0070702_100122891 3300005615 Bacteria 1628
43 Ga0068861_100086583 3300005719 Bacteria 2463
44 Ga0068863_100341472 3300005841 Bacteria 1457
45 Ga0068863_100582373 3300005841 Bacteria 1107
46 Ga0068858_100089164 3300005842 Bacteria 2870
47 Ga0068860_100144079 3300005843 Bacteria 2292
48 Ga0068860_100515044 3300005843 Bacteria 1196
49 Ga0081455_10001856 3300005937 Bacteria 25428
50 Ga0081539_10008606 3300005985 Bacteria 8816
51 Ga0081539_10034575 3300005985 Bacteria 3053
52 Ga0070716_100002341 3300006173 Bacteria 8716
53 Ga0070716_100041276 3300006173 Bacteria 2570
54 Ga0075433_10008581 3300006852 Bacteria 8153
55 Ga0075433_10183334 3300006852 Bacteria 1863
56 Ga0075434_100008308 3300006871 Bacteria 9643
57 Ga0075434_100009562 3300006871 Bacteria 9049
58 Ga0075434_100062669 3300006871 Bacteria 3702
59 Ga0075434_100372158 3300006871 Bacteria 1449
60 Ga0075429_100003044 3300006880 Bacteria 14212
61 Ga0075436_100001705 3300006914 Bacteria 15041
62 Ga0075436_100212309 3300006914 Bacteria 1372
63 Ga0075435_100008392 3300007076 Bacteria 7409
64 Ga0075435_100011702 3300007076 Bacteria 6470
65 Ga0075435_100032198 3300007076 Bacteria 4139
66 Ga0099794_10002921 3300007265 Bacteria 6430
67 Ga0099794_10017408 3300007265 Bacteria 3202
68 Ga0099794_10027922 3300007265 Bacteria 2620
69 Ga0099794_10039466 3300007265 Bacteria 2241
70 Ga0099794_10074876 3300007265 Bacteria 1663
71 Ga0099794_10097242 3300007265 Bacteria 1466
72 Ga0099795_10037079 3300007788 Bacteria 1714
73 Ga0111539_10046445 3300009094 Bacteria 5194
74 Ga0105245_10134616 3300009098 Bacteria 2321
75 Ga0114129_10014176 3300009147 Bacteria 11358
76 Ga0105242_10063794 3300009176 Bacteria 3034
77 Ga0105242_10081125 3300009176 Bacteria 2712
78 Ga0105237_10500221 3300009545 Bacteria 1222
79 Ga0105239_10039184 3300010375 Bacteria 5191
80 Ga0105246_10252263 3300011119 Bacteria 1401
81 Ga0157370_10348425 3300013104 Bacteria 1365
82 Ga0157369_10036871 3300013105 Bacteria 5355
83 Ga0157372_10127543 3300013307 Bacteria 2926
84 Ga0157372_10183319 3300013307 Bacteria 2424
85 Ga0157380_10388004 3300014326 Bacteria 1320
86 Ga0207684_10350120 3300025910 Bacteria 1271
87 Ga0207662_10000468 3300025918 Bacteria 17994
88 Ga0207657_10020534 3300025919 Bacteria 6239
89 Ga0207657_10120041 3300025919 Bacteria 2163
90 Ga0207646_10000005 3300025922 Bacteria 523896
91 Ga0207646_10000938 3300025922 Bacteria 37489
92 Ga0207646_10619556 3300025922 Bacteria 971
93 Ga0207650_10014971 3300025925 Bacteria 5394
94 Ga0207687_10172598 3300025927 Bacteria 1669
95 Ga0207700_10053225 3300025928 Bacteria 3031
96 Ga0207664_10107184 3300025929 Bacteria 2318
97 Ga0207670_10000287 3300025936 Bacteria 30840
98 Ga0207670_10001909 3300025936 Bacteria 10895
99 Ga0207665_10000380 3300025939 Bacteria 30569
100 Ga0207711_10058288 3300025941 Bacteria 3323
101 Ga0207679_10005305 3300025945 Bacteria 8084
102 Ga0207703_10056064 3300026035 Bacteria 3208
103 Ga0207708_10171578 3300026075 Bacteria 1718
104 Ga0207641_10234221 3300026088 Bacteria 1708
105 Ga0207683_10024639 3300026121 Bacteria 5184
106 Ga0207683_10059418 3300026121 Bacteria 3358
107 Ga0209588_1001611 3300027671 Bacteria 5942
108 Ga0209588_1002951 3300027671 Bacteria 4675
109 Ga0209588_1050712 3300027671 Bacteria 1342
110 Ga0207428_10071211 3300027907 Bacteria 2731
111 Ga0207428_10082716 3300027907 Bacteria 2505
112 Ga0207428_10087593 3300027907 Bacteria 2422
113 Ga0268265_10360038 3300028380 Bacteria 1331
114 Ga0268264_10003957 3300028381 Bacteria 12691
115 Ga0268264_10035718 3300028381 Bacteria 4092
116 Ga0265760_10000019 3300031090 Bacteria 81444
117 Ga0265760_10002505 3300031090 Bacteria 5361
118 Ga0265330_10007373 3300031235 Bacteria 5365
119 Ga0265332_10016633 3300031238 Bacteria 3245
120 Ga0265328_10061724 3300031239 Bacteria 1376
121 Ga0265325_10029309 3300031241 Bacteria 2959
122 Ga0265340_10007846 3300031247 Bacteria 5790
123 Ga0265340_10039764 3300031247 Bacteria 2318
124 Ga0265339_10000081 3300031249 Bacteria 82039
125 Ga0265331_10014346 3300031250 Bacteria 4224
126 Ga0265327_10003315 3300031251 Bacteria 15583
127 Ga0265316_10001106 3300031344 Bacteria 29252
128 Ga0265316_10057046 3300031344 Bacteria 3047
129 Ga0265316_10086384 3300031344 Bacteria 2398
130 Ga0265316_10093044 3300031344 Bacteria 2298
131 Ga0307408_100233937 3300031548 Bacteria 1506
132 Ga0265313_10030126 3300031595 Bacteria 2798
133 Ga0265314_10117595 3300031711 Bacteria 1679
134 Ga0265342_10000636 3300031712 Bacteria 36784
135 Ga0307413_10006412 3300031824 Bacteria 5368
136 Ga0307406_10054805 3300031901 Bacteria 2546
137 Ga0307412_10111775 3300031911 Bacteria 1952
138 Ga0307409_100013843 3300031995 Bacteria 5215
139 Ga0307416_100075850 3300032002 Bacteria 2815
140 Ga0307414_10004322 3300032004 Bacteria 7709
141 Ga0307415_100016886 3300032126 Bacteria 4364
142 Ga0373926_0002419 3300035083 Bacteria 5916
143 Ga0373926_0003756 3300035083 Bacteria 4944
144 Ga0373934_0097867 3300035086 Bacteria 1185
145 Ga0373923_0108838 3300035111 Bacteria 1229
146 Ga0373943_0055808 3300035170 Bacteria 1958
147 Ga0373955_0144167 3300035172 Bacteria 1398
148 Ga0373935_0061442 3300035692 Bacteria 2405
149 Ga0373935_0232813 3300035692 Bacteria 1283
150 Ga0373935_0334010 3300035692 Bacteria 1078
151 Ga0373927_0004952 3300035695 Bacteria 9240
152 Ga0373927_0033082 3300035695 Bacteria 3366
153 Ga0373933_0000128 3300035724 Bacteria 48860
154 Ga0373933_0125097 3300035724 Bacteria 1613
155 Ga0373947_0063184 3300035725 Bacteria 2255
156 Ga0373937_0000049 3300036401 Bacteria 106227
157 Ga0373937_0009510 3300036401 Bacteria 8452
158 Ga0373937_0535790 3300036401 Bacteria 1112
159 Ga0373925_0000260 3300037068 Bacteria 55009
160 Ga0395899_0007216 3300037312 Bacteria 8602
161 Ga0395900_0070951 3300037418 Bacteria 3580
162 Ga0395898_0148727 3300037466 Bacteria 2241
163 Ga0395898_0328244 3300037466 Bacteria 1459
164 Ga0395905_0000522 3300037471 Bacteria 52712
165 Ga0395905_0081896 3300037471 Bacteria 3024
166 Ga0395905_0219162 3300037471 Bacteria 1781
167 Ga0395901_0062994 3300038443 Bacteria 3859
168 Ga0400483_073840 3300039062 Bacteria 5491
169 Ga0400483_267681 3300039062 Bacteria 5959
170 Ga0451833_1438534 3300041491 Bacteria 1188
171 Ga0453683_0017571 3300044673 Bacteria 4604
172 Ga0466965_0142992 3300044683 Bacteria 1247
173 Ga0466971_0039364 3300044719 Bacteria 2122
174 Ga0466959_0235535 3300045049 Bacteria 1266
175 Ga0451576_0039809 3300045051 Bacteria 4976
176 Ga0495617_010068 3300046452 Bacteria 3240
177 Ga0495592_0004946 3300046454 Bacteria 9807
178 Ga0495592_0280041 3300046454 Bacteria 1091
179 Ga0495603_0031852 3300046455 Bacteria 3174
180 Ga0495603_0059912 3300046455 Bacteria 2250
181 Ga0495590_0009325 3300046457 Bacteria 3723
182 Ga0495638_0001050 3300046460 Bacteria 27222
183 Ga0495651_0001304 3300046462 Bacteria 19298
184 Ga0495651_0004154 3300046462 Bacteria 11092
185 Ga0495651_0032790 3300046462 Bacteria 4051
186 Ga0495653_0018314 3300046463 Bacteria 5690
187 Ga0495653_0049306 3300046463 Bacteria 3245
188 Ga0495653_0059650 3300046463 Bacteria 2895
189 Ga0495653_0068779 3300046463 Bacteria 2655
190 Ga0495580_0004518 3300046472 Bacteria 11684
191 Ga0495605_0000850 3300046474 Bacteria 21303
192 Ga0495605_0000895 3300046474 Bacteria 20517
193 Ga0495662_0076236 3300046476 Bacteria 1628
194 Ga0495584_0002330 3300046491 Bacteria 10825
195 Ga0495585_0019536 3300046492 Bacteria 3906
196 Ga0495607_0006754 3300046501 Bacteria 8022
197 Ga0495607_0007328 3300046501 Bacteria 7647
198 Ga0495607_0039944 3300046501 Bacteria 2797
199 Ga0495607_0059050 3300046501 Bacteria 2189
200 Ga0495583_0000014 3300046506 Bacteria 320136
201 Ga0495608_0031274 3300046511 Bacteria 3600
202 Ga0495608_0063485 3300046511 Bacteria 2423
203 Ga0495616_0026607 3300046513 Bacteria 3076
204 Ga0495616_0046443 3300046513 Bacteria 2192
205 Ga0495618_0068411 3300046514 Bacteria 2258
206 Ga0495628_0007629 3300046516 Bacteria 9347
207 Ga0495628_0022887 3300046516 Bacteria 5130
208 Ga0495630_0004211 3300046517 Bacteria 10075
209 Ga0495630_0102808 3300046517 Bacteria 2162
210 Ga0495630_0140068 3300046517 Bacteria 1839
211 Ga0495630_0234996 3300046517 Bacteria 1401
212 Ga0495643_0001466 3300046522 Bacteria 21583
213 Ga0495644_0002177 3300046523 Bacteria 7872
214 Ga0495644_0007371 3300046523 Bacteria 4245
215 Ga0495648_0000128 3300046524 Bacteria 88948
216 Ga0495652_0011888 3300046529 Bacteria 7869
217 Ga0495652_0041702 3300046529 Bacteria 3960
218 Ga0495665_0009018 3300046531 Bacteria 5412
219 Ga0495586_0096574 3300046535 Bacteria 1637
220 Ga0495587_0000181 3300046536 Bacteria 46248
221 Ga0495587_0013107 3300046536 Bacteria 5212
222 Ga0495609_0000084 3300046538 Bacteria 113497
223 Ga0495609_0000182 3300046538 Bacteria 63465
224 Ga0495645_0145340 3300046543 Bacteria 1652
225 Ga0495667_0004052 3300046559 Bacteria 9848
226 Ga0495667_0334135 3300046559 Bacteria 958
227 Ga0495656_0000625 3300046615 Bacteria 11298
228 Ga0495656_0007964 3300046615 Bacteria 3768
229 Ga0495656_0227881 3300046615 Bacteria 934
230 Ga0495668_0000045 3300046616 Bacteria 225145
231 Ga0495668_0003084 3300046616 Bacteria 12895
232 Ga0495634_0024557 3300046642 Bacteria 4227
233 Ga0495611_0003978 3300046648 Bacteria 6429
234 Ga0495611_0005752 3300046648 Bacteria 5287
235 Ga0495625_0036170 3300046660 Bacteria 3631
236 Ga0495625_0064298 3300046660 Bacteria 2588
237 Ga0495625_0218350 3300046660 Bacteria 1250
238 Ga0495635_0017587 3300046663 Bacteria 4993
239 Ga0495635_0209005 3300046663 Bacteria 1322
240 Ga0495659_0000117 3300046664 Bacteria 35344
241 Ga0495659_0034867 3300046664 Bacteria 1771
242 Ga0495661_0000132 3300046665 Bacteria 90465
243 Ga0495661_0066198 3300046665 Bacteria 2127
244 Ga0495657_0085542 3300046675 Bacteria 2032
245 Ga0495599_0021094 3300046678 Bacteria 4062
246 Ga0495623_0012401 3300046679 Bacteria 5519
247 Ga0495646_0007571 3300046680 Bacteria 6902
248 Ga0495613_0024856 3300046689 Bacteria 4464
249 Ga0495624_0004907 3300046690 Bacteria 9713
250 Ga0495670_0006137 3300046691 Bacteria 5899
251 Ga0495671_0009408 3300046692 Bacteria 5456
252 Ga0495649_0019869 3300046694 Bacteria 3771
253 Ga0495649_0073175 3300046694 Bacteria 1836
254 Ga0495589_0001995 3300046794 Bacteria 11556
255 Ga0495589_0054200 3300046794 Bacteria 1978
256 Ga0495600_0047202 3300046809 Bacteria 2809
257 Ga0495600_0210052 3300046809 Bacteria 1247
258 Ga0495660_0000057 3300046810 Bacteria 133310
259 Ga0495604_0003555 3300047317 Bacteria 12435
260 Ga0495604_0034872 3300047317 Bacteria 3976
261 Ga0495604_0086112 3300047317 Bacteria 2344
262 Ga0495636_0000229 3300047318 Bacteria 22039
263 Ga0495636_0001614 3300047318 Bacteria 8573
264 Ga0495674_0005500 3300047319 Bacteria 12169
265 Ga0495674_0072312 3300047319 Bacteria 2974
266 Ga0495674_0718821 3300047319 Bacteria 782
267 Ga0495672_0003078 3300047320 Bacteria 14599
268 Ga0495672_0015610 3300047320 Bacteria 5149
269 Ga0495672_0125571 3300047320 Bacteria 1357
270 Ga0495676_0330540 3300047321 Bacteria 1022
271 Ga0495680_0000041 3300047322 Bacteria 99386
272 Ga0495680_0032924 3300047322 Bacteria 4202
273 Ga0495680_0038885 3300047322 Bacteria 3799
274 Ga0495683_0002444 3300047323 Bacteria 11223
275 Ga0495683_0026528 3300047323 Bacteria 2965
276 Ga0495687_000164 3300047443 Bacteria 99940
277 Ga0495687_001041 3300047443 Bacteria 27555
278 Ga0495687_050468 3300047443 Bacteria 1772
279 Ga0495675_0000350 3300047444 Bacteria 32505
280 Ga0495675_0002211 3300047444 Bacteria 11606
281 Ga0495675_0002242 3300047444 Bacteria 11546
282 Ga0495677_0000294 3300047445 Bacteria 21826
283 Ga0495677_0011564 3300047445 Bacteria 3226
284 Ga0495677_0014609 3300047445 Bacteria 2856
285 Ga0495677_0020335 3300047445 Bacteria 2406
286 Ga0495685_000002 3300047447 Bacteria 132680
287 Ga0495673_0014691 3300047469 Bacteria 4064
288 Ga0495681_0011484 3300047470 Bacteria 5273
289 Ga0495684_0024531 3300047471 Bacteria 4643
290 Ga0495684_0094953 3300047471 Bacteria 2257
291 Ga0495684_0436453 3300047471 Bacteria 913
292 Ga0495686_0177382 3300047472 Bacteria 1236
293 Ga0495593_0038902 3300047673 Bacteria 2567
294 Ga0495593_0132537 3300047673 Bacteria 1265
295 Ga0495602_0100944 3300048088 Bacteria 2368
296 Ga0495602_0395769 3300048088 Bacteria 986
297 Ga0495626_0000011 3300048091 Bacteria 260928
298 Ga0496101_0001454 3300048904 Bacteria 14133
299 Ga0496104_0000224 3300048907 Bacteria 49763
300 Ga0496105_0063660 3300048908 Bacteria 3043
301 Ga0496108_0000751 3300048911 Bacteria 25244
302 Ga0496108_0001995 3300048911 Bacteria 16346
303 Ga0496109_0005324 3300048912 Bacteria 10756
304 Ga0496109_0023119 3300048912 Bacteria 5515
305 Ga0496110_0004215 3300048913 Bacteria 11121
306 Ga0496110_0255412 3300048913 Bacteria 1595
307 Ga0496111_0000434 3300048914 Bacteria 21163
308 Ga0496114_0000395 3300048917 Bacteria 32156
309 Ga0496121_0000997 3300048924 Bacteria 50601
310 Ga0496125_0014367 3300048928 Bacteria 7714
311 Ga0495678_000379 3300049459 Bacteria 45162
312 Ga0495678_001232 3300049459 Bacteria 20875
313 Ga0501314_007341 3300049530 Bacteria 976
314 Ga0501224_000025 3300049664 Bacteria 56130
315 Ga0501233_000065 3300049668 Bacteria 14205
316 Ga0501235_028192 3300049669 Bacteria 1261
317 Ga0501225_0000402 3300049705 Bacteria 13589
318 Ga0501234_002016 3300049707 Bacteria 3207
319 Ga0501226_000020 3300049853 Bacteria 141193
320 nmdc:mga05p37_143190_c1 3300050507 Bacteria 2928
321 nmdc:mga09592_117_c1 3300050508 Bacteria 50343
322 nmdc:mga08y16_224961_c1 3300050511 Bacteria 1942
323 nmdc:mga08y16_63347_c1 3300050511 Bacteria 3861
324 nmdc:mga08y16_88233_c1 3300050511 Bacteria 3232
325 nmdc:mga0n895_268622_c1 3300050512 Bacteria 1730
326 nmdc:mga0n895_33277_c1 3300050512 Bacteria 4953
327 nmdc:mga0n895_55754_c1 3300050512 Bacteria 3890
328 nmdc:mga0n895_58608_c1 3300050512 Bacteria 3796
329 nmdc:mga0n895_62026_c1 3300050512 Bacteria 3693
330 nmdc:mga0n895_724862_c1 3300050512 Bacteria 989
331 nmdc:mga0rr50_52145_c1 3300050513 Bacteria 3038
332 nmdc:mga0rr50_8534_c1 3300050513 Bacteria 6383
333 nmdc:mga08x19_11411_c1 3300050514 Bacteria 5349
334 nmdc:mga08x19_153107_c1 3300050514 Bacteria 1562
335 nmdc:mga08x19_199244_c1 3300050514 Bacteria 1372
336 nmdc:mga08x19_211_c1 3300050514 Bacteria 44219
337 nmdc:mga08x19_297448_c1 3300050514 Bacteria 1121
338 nmdc:mga0a205_14166_c1 3300050515 Bacteria 7438
339 nmdc:mga0a205_48576_c1 3300050515 Bacteria 4095
340 Ga0495619_0104923 3300053085 Bacteria 1927
341 Ga0587076_001298 3300059645 Bacteria 2503
342 Ga0466962_0031127 3300061719 Bacteria 2555
343 2511243673 2511231002 Bacteria 5042903
344 2644030900 2643221603 Bacteria 6147767
345 2713472416 2711768613 Bacteria 11048459
346 2792834433 2791355137 Bacteria 9654227
347 2900642207 2900634093 Bacteria 10263517
348 2904483561 2904479285 Bacteria 5073931
349 8056133964 8056131705 Bacteria 6107031
350 Ga0496121_0003816
351 SwRhRL2b_contig_510364
352 Ga0070690_100159514
353 Ga0070670_100005190
354 Ga0068868_100036652
355 Ga0070660_100042834
356 Ga0070689_100000294
357 Ga0070689_100002463
358 Ga0070687_100000468
359 Ga0070673_100572664
360 Ga0070688_100000055
361 Ga0070688_100003531
362 Ga0070659_100323643
363 Ga0070709_10049474
364 Ga0070714_100198839
365 Ga0070701_10050626
366 Ga0070701_10208249
367 Ga0070694_100023586
368 Ga0070694_100273946
369 Ga0070708_100642883
370 Ga0070685_10003891
371 Ga0070707_100001356
372 Ga0070707_100002196
373 Ga0070698_100052014
374 Ga0070699_100075082
375 Ga0070679_100182912
376 Ga0070684_100051997
377 Ga0070697_100127538
378 Ga0070697_100398455
379 Ga0070686_100004146
380 Ga0070686_100241386
381 Ga0070695_100202854
382 Ga0070696_100095976
383 Ga0070704_100022773
384 Ga0070704_100084162
385 Ga0068855_100086998
386 Ga0070664_100019976
387 Ga0070664_100319232
388 Ga0068854_100316512
389 Ga0068856_100089471
390 Ga0070702_100044411
391 Ga0070702_100122891
392 Ga0068861_100086583
393 Ga0068863_100341472
394 Ga0068863_100582373
395 Ga0068858_100089164
396 Ga0068860_100144079
397 Ga0068860_100515044
398 Ga0081455_10001856
399 Ga0081539_10008606
400 Ga0081539_10034575
401 Ga0070716_100002341
402 Ga0070716_100041276
403 Ga0075433_10008581
404 Ga0075433_10183334
405 Ga0075434_100008308
406 Ga0075434_100009562
407 Ga0075434_100062669
408 Ga0075434_100372158
409 Ga0075429_100003044
410 Ga0075436_100001705
411 Ga0075436_100212309
412 Ga0075435_100008392
413 Ga0075435_100011702
414 Ga0075435_100032198
415 Ga0099794_10002921
416 Ga0099794_10017408
417 Ga0099794_10027922
418 Ga0099794_10039466
419 Ga0099794_10074876
420 Ga0099794_10097242
421 Ga0099795_10037079
422 Ga0111539_10046445
423 Ga0105245_10134616
424 Ga0114129_10014176
425 Ga0105242_10063794
426 Ga0105242_10081125
427 Ga0105237_10500221
428 Ga0105239_10039184
429 Ga0105246_10252263
430 Ga0157370_10348425
431 Ga0157369_10036871
432 Ga0157372_10127543
433 Ga0157372_10183319
434 Ga0157380_10388004
435 Ga0207684_10350120
436 Ga0207662_10000468
437 Ga0207657_10020534
438 Ga0207657_10120041
439 Ga0207646_10000005
440 Ga0207646_10000938
441 Ga0207646_10619556
442 Ga0207650_10014971
443 Ga0207687_10172598
444 Ga0207700_10053225
445 Ga0207664_10107184
446 Ga0207670_10000287
447 Ga0207670_10001909
448 Ga0207665_10000380
449 Ga0207711_10058288
450 Ga0207679_10005305
451 Ga0207703_10056064
452 Ga0207708_10171578
453 Ga0207641_10234221
454 Ga0207683_10024639
455 Ga0207683_10059418
456 Ga0209588_1001611
457 Ga0209588_1002951
458 Ga0209588_1050712
459 Ga0207428_10071211
460 Ga0207428_10082716
461 Ga0207428_10087593
462 Ga0268265_10360038
463 Ga0268264_10003957
464 Ga0268264_10035718
465 Ga0265760_10000019
466 Ga0265760_10002505
467 Ga0265330_10007373
468 Ga0265332_10016633
469 Ga0265328_10061724
470 Ga0265325_10029309
471 Ga0265340_10007846
472 Ga0265340_10039764
473 Ga0265339_10000081
474 Ga0265331_10014346
475 Ga0265327_10003315
476 Ga0265316_10001106
477 Ga0265316_10057046
478 Ga0265316_10086384
479 Ga0265316_10093044
480 Ga0307408_100233937
481 Ga0265313_10030126
482 Ga0265314_10117595
483 Ga0265342_10000636
484 Ga0307413_10006412
485 Ga0307406_10054805
486 Ga0307412_10111775
487 Ga0307409_100013843
488 Ga0307416_100075850
489 Ga0307414_10004322
490 Ga0307415_100016886
491 Ga0373926_0002419
492 Ga0373926_0003756
493 Ga0373934_0097867
494 Ga0373923_0108838
495 Ga0373943_0055808
496 Ga0373955_0144167
497 Ga0373935_0061442
498 Ga0373935_0232813
499 Ga0373935_0334010
500 Ga0373927_0004952
501 Ga0373927_0033082
502 Ga0373933_0000128
503 Ga0373933_0125097
504 Ga0373947_0063184
505 Ga0373937_0000049
506 Ga0373937_0009510
507 Ga0373937_0535790
508 Ga0373925_0000260
509 Ga0395899_0007216
510 Ga0395900_0070951
511 Ga0395898_0148727
512 Ga0395898_0328244
513 Ga0395905_0000522
514 Ga0395905_0081896
515 Ga0395905_0219162
516 Ga0395901_0062994
517 Ga0400483_073840
518 Ga0400483_267681
519 Ga0451833_1438534
520 Ga0453683_0017571
521 Ga0466965_0142992
522 Ga0466971_0039364
523 Ga0466959_0235535
524 Ga0451576_0039809
525 Ga0495617_010068
526 Ga0495592_0004946
527 Ga0495592_0280041
528 Ga0495603_0031852
529 Ga0495603_0059912
530 Ga0495590_0009325
531 Ga0495638_0001050
532 Ga0495651_0001304
533 Ga0495651_0004154
534 Ga0495651_0032790
535 Ga0495653_0018314
536 Ga0495653_0049306
537 Ga0495653_0059650
538 Ga0495653_0068779
539 Ga0495580_0004518
540 Ga0495605_0000850
541 Ga0495605_0000895
542 Ga0495662_0076236
543 Ga0495584_0002330
544 Ga0495585_0019536
545 Ga0495607_0006754
546 Ga0495607_0007328
547 Ga0495607_0039944
548 Ga0495607_0059050
549 Ga0495583_0000014
550 Ga0495608_0031274
551 Ga0495608_0063485
552 Ga0495616_0026607
553 Ga0495616_0046443
554 Ga0495618_0068411
555 Ga0495628_0007629
556 Ga0495628_0022887
557 Ga0495630_0004211
558 Ga0495630_0102808
559 Ga0495630_0140068
560 Ga0495630_0234996
561 Ga0495643_0001466
562 Ga0495644_0002177
563 Ga0495644_0007371
564 Ga0495648_0000128
565 Ga0495652_0011888
566 Ga0495652_0041702
567 Ga0495665_0009018
568 Ga0495586_0096574
569 Ga0495587_0000181
570 Ga0495587_0013107
571 Ga0495609_0000084
572 Ga0495609_0000182
573 Ga0495645_0145340
574 Ga0495667_0004052
575 Ga0495667_0334135
576 Ga0495656_0000625
577 Ga0495656_0007964
578 Ga0495656_0227881
579 Ga0495668_0000045
580 Ga0495668_0003084
581 Ga0495634_0024557
582 Ga0495611_0003978
583 Ga0495611_0005752
584 Ga0495625_0036170
585 Ga0495625_0064298
586 Ga0495625_0218350
587 Ga0495635_0017587
588 Ga0495635_0209005
589 Ga0495659_0000117
590 Ga0495659_0034867
591 Ga0495661_0000132
592 Ga0495661_0066198
593 Ga0495657_0085542
594 Ga0495599_0021094
595 Ga0495623_0012401
596 Ga0495646_0007571
597 Ga0495613_0024856
598 Ga0495624_0004907
599 Ga0495670_0006137
600 Ga0495671_0009408
601 Ga0495649_0019869
602 Ga0495649_0073175
603 Ga0495589_0001995
604 Ga0495589_0054200
605 Ga0495600_0047202
606 Ga0495600_0210052
607 Ga0495660_0000057
608 Ga0495604_0003555
609 Ga0495604_0034872
610 Ga0495604_0086112
611 Ga0495636_0000229
612 Ga0495636_0001614
613 Ga0495674_0005500
614 Ga0495674_0072312
615 Ga0495674_0718821
616 Ga0495672_0003078
617 Ga0495672_0015610
618 Ga0495672_0125571
619 Ga0495676_0330540
620 Ga0495680_0000041
621 Ga0495680_0032924
622 Ga0495680_0038885
623 Ga0495683_0002444
624 Ga0495683_0026528
625 Ga0495687_000164
626 Ga0495687_001041
627 Ga0495687_050468
628 Ga0495675_0000350
629 Ga0495675_0002211
630 Ga0495675_0002242
631 Ga0495677_0000294
632 Ga0495677_0011564
633 Ga0495677_0014609
634 Ga0495677_0020335
635 Ga0495685_000002
636 Ga0495673_0014691
637 Ga0495681_0011484
638 Ga0495684_0024531
639 Ga0495684_0094953
640 Ga0495684_0436453
641 Ga0495686_0177382
642 Ga0495593_0038902
643 Ga0495593_0132537
644 Ga0495602_0100944
645 Ga0495602_0395769
646 Ga0495626_0000011
647 Ga0496101_0001454
648 Ga0496104_0000224
649 Ga0496105_0063660
650 Ga0496108_0000751
651 Ga0496108_0001995
652 Ga0496109_0005324
653 Ga0496109_0023119
654 Ga0496110_0004215
655 Ga0496110_0255412
656 Ga0496111_0000434
657 Ga0496114_0000395
658 Ga0496121_0000997
659 Ga0496125_0014367
660 Ga0495678_000379
661 Ga0495678_001232
662 Ga0501314_007341
663 Ga0501224_000025
664 Ga0501233_000065
665 Ga0501235_028192
666 Ga0501225_0000402
667 Ga0501234_002016
668 Ga0501226_000020
669 nmdc:mga05p37_143190_c1
670 nmdc:mga09592_117_c1
671 nmdc:mga08y16_224961_c1
672 nmdc:mga08y16_63347_c1
673 nmdc:mga08y16_88233_c1
674 nmdc:mga0n895_268622_c1
675 nmdc:mga0n895_33277_c1
676 nmdc:mga0n895_55754_c1
677 nmdc:mga0n895_58608_c1
678 nmdc:mga0n895_62026_c1
679 nmdc:mga0n895_724862_c1
680 nmdc:mga0rr50_52145_c1
681 nmdc:mga0rr50_8534_c1
682 nmdc:mga08x19_11411_c1
683 nmdc:mga08x19_153107_c1
684 nmdc:mga08x19_199244_c1
685 nmdc:mga08x19_211_c1
686 nmdc:mga08x19_297448_c1
687 nmdc:mga0a205_14166_c1
688 nmdc:mga0a205_48576_c1
689 Ga0495619_0104923
690 Ga0587076_001298
691 Ga0466962_0031127
692 2511243673
693 2644030900
694 2713472416
695 2792834433
696 2900642207
697 2904483561
698 8056133964

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00725

3HCDH

3-hydroxyacyl-CoA dehydrogenase, C-terminal domain

251

347

1

PF02737

3HCDH_N

3-hydroxyacyl-CoA dehydrogenase, NAD binding domain

70

249

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7fgp-assembly1.cif.gz_A crystal structure of aureimonas altamirenisis flavin-containing opine dehydrogenase (fad-bound form) 0.9816 5 36
4j33-assembly2.cif.gz_B crystal structure of kynurenine 3-monooxygenase (kmo-394) 0.9804 5 36
4j33-assembly1.cif.gz_A crystal structure of kynurenine 3-monooxygenase (kmo-394) 0.9802 5 36
4j36-assembly2.cif.gz_B cocrystal structure of kynurenine 3-monooxygenase in complex with upf 648 inhibitor(kmo-394upf) 0.9798 5 36
4j34-assembly1.cif.gz_A crystal structure of kynurenine 3-monooxygenase - truncated at position 394 plus his tag cleaved. 0.9761 5 36
ID Description Score Start End Superfamily
af_I1MHA5_112_472_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9916 6 33 3.50.50.60
af_Q54VB8_19_206_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9886 3 189 3.40.50.720
4kuhA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9834 7 190 3.40.50.720
af_Q8H191_31_475_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9827 8 36 3.50.50.60
3mogC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9825 3 189 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A6B3HMS0-F1-model_v4 NAD(P)-binding domain-containing protein 0.9921 6 93 GO:0006635
GO:0008691
GO:0070403
AF-A0A6I2VRB6-F1-model_v4 3-hydroxybutyryl-CoA dehydrogenase 0.9907 15 167 GO:0006635
GO:0008691
GO:0070403
AF-A0A4Q5SU61-F1-model_v4 3-hydroxybutyryl-CoA dehydrogenase (EC 1.1.1.157) 0.9904 5 126 GO:0006631
GO:0008691
GO:0070403
AF-A0A540QTY0-F1-model_v4 deleted 0.9886 4 161
AF-A0A352SBA1-F1-model_v4 3-hydroxyacyl-CoA dehydrogenase 0.9863 1 192 GO:0003857
GO:0006635
GO:0016829
GO:0016853
GO:0070403

Map