F417980

General Info

Members Datasets Scaffolds Average Seq Length
349 189 698 533

Family's Representative Sequence

Representative Sequence 3300044719|Ga0466971_0040471|Ga0466971_0040471_398_2068
Length 556
Sequence VNGQMMDFQLTLPPLLRRAETYFPTKEIVTRLPDKSFHRYTYADFGRRARQLAVALGELGLERGDRVATLCWNHYQHLEAYFGIPCGGFVLHTLNIRLHPADLGYIASHAGDKAVIVDRSLLPLLDAFKGETQIEHVFVVEDSYEELLAGADPDAWRDPELDEGEAAAMCYTSGTTGLPKGVLYSHRSTVLHSLGVACGGPLGLGMSEQDTILPVVPMFHANAWGYPYLAAMIGAKQVYPGPHLDPESLLEDFVQERVTWTAGVPTIWLGILRLLDENPGRWDLSAMKGMLVGGSAAPRSMIAGFKQRHGLVVVHGWGMTETSPVASVATLPGELAEADEEIQFDYIAMQGLPLPFVEWRARDAEGNEIPKDGQAMGELEVRGPWVAASYYESPAIAGSAAGEAGDPRPEDRVASGDAGADRWTDDGWFRTGDIVSLDPKGFIRIQDRSKDVIKSGGEWISSVALENQLIAHEAVAEAAVIAIPDEKWQERPLAVVVLAPGREATPGELREFLAPHFASWWLPDRFEFVDEIPKTSVGKFRKTALREQFAGVPARS

Samples

Sample ID Description Type Environment
1 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
28 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
36 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
66 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
68 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
69 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
70 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
71 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
72 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
73 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
74 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
75 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
76 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
77 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
78 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
79 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
80 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
81 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
82 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
83 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
84 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
85 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
86 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
87 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
88 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
89 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
90 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
91 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
92 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
93 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
94 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
95 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
96 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
97 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
98 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
99 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
100 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
101 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
102 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
103 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
104 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
105 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
106 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
107 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
108 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
109 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
110 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
111 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
112 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
113 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
114 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
115 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
116 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
117 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
118 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
119 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
120 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
121 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
122 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
123 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
124 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
125 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
126 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
127 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
128 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
129 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
130 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
131 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
132 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
133 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
134 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
135 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
136 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
137 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
138 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
139 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
140 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
141 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
142 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
143 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
144 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
145 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
146 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
147 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
148 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
149 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
150 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
151 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
152 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
153 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
154 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
155 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
156 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
167 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
168 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
169 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
170 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
171 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
172 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
173 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
174 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
175 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
176 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
177 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
178 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
179 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
180 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
181 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
182 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
183 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
184 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
185 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
186 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
187 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
188 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
189 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.85
Metatranscriptomes 0.86
Isolates 0.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.86
Nodule 0
Rhizoplane 12.03
Rhizosphere 85.96
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466971_0040471 3300044719 Bacteria 2093
2 JGI25406J46586_10010847 3300003203 Bacteria 4019
3 Ga0070658_10031838 3300005327 Bacteria 4237
4 Ga0070683_100031346 3300005329 Bacteria 4833
5 Ga0070683_100050059 3300005329 Bacteria 3866
6 Ga0070683_100155611 3300005329 Bacteria 2168
7 Ga0070680_100023877 3300005336 Bacteria 4880
8 Ga0070660_100000819 3300005339 Bacteria 20620
9 Ga0070660_100015896 3300005339 Bacteria 5448
10 Ga0070660_100022520 3300005339 Bacteria 4660
11 Ga0070660_100034888 3300005339 Bacteria 3804
12 Ga0070660_100073668 3300005339 Bacteria 2670
13 Ga0070661_100022258 3300005344 Bacteria 4537
14 Ga0070661_100080353 3300005344 Bacteria 2407
15 Ga0070671_100082477 3300005355 Bacteria 2688
16 Ga0070674_100037055 3300005356 Bacteria 3278
17 Ga0070659_100007957 3300005366 Bacteria 7725
18 Ga0070678_100011659 3300005456 Bacteria 5432
19 Ga0070681_10000818 3300005458 Bacteria 25982
20 Ga0070681_10003368 3300005458 Bacteria 14946
21 Ga0070681_10005575 3300005458 Bacteria 12154
22 Ga0070681_10173840 3300005458 Bacteria 2075
23 Ga0070706_100192936 3300005467 Bacteria 1903
24 Ga0070707_100000243 3300005468 Bacteria 54319
25 Ga0070707_100036784 3300005468 Bacteria 4672
26 Ga0070698_100010455 3300005471 Bacteria 9907
27 Ga0070698_100016741 3300005471 Bacteria 7733
28 Ga0070698_100078896 3300005471 Bacteria 3290
29 Ga0070699_100000794 3300005518 Bacteria 29142
30 Ga0070699_100033471 3300005518 Bacteria 4440
31 Ga0070679_100043069 3300005530 Bacteria 4497
32 Ga0070679_100045088 3300005530 Bacteria 4393
33 Ga0070679_100118739 3300005530 Bacteria 2629
34 Ga0070679_100131685 3300005530 Bacteria 2482
35 Ga0070684_100004955 3300005535 Bacteria 10161
36 Ga0070684_100011479 3300005535 Bacteria 7055
37 Ga0070684_100043803 3300005535 Bacteria 3866
38 Ga0070684_100048478 3300005535 Bacteria 3686
39 Ga0070697_100000162 3300005536 Bacteria 54387
40 Ga0070695_100000108 3300005545 Bacteria 36621
41 Ga0070693_100010169 3300005547 Bacteria 4703
42 Ga0068855_100087026 3300005563 Bacteria 3612
43 Ga0068855_100117642 3300005563 Bacteria 3044
44 Ga0070664_100033411 3300005564 Bacteria 4309
45 Ga0068857_100041569 3300005577 Bacteria 4077
46 Ga0068852_100217535 3300005616 Bacteria 1815
47 Ga0081455_10003327 3300005937 Bacteria 18552
48 Ga0081455_10038323 3300005937 Bacteria 4245
49 Ga0081455_10051596 3300005937 Bacteria 3527
50 Ga0081455_10065455 3300005937 Bacteria 3040
51 Ga0081455_10079107 3300005937 Bacteria 2700
52 Ga0081538_10000195 3300005981 Bacteria 66942
53 Ga0081538_10025084 3300005981 Bacteria 4221
54 Ga0081538_10031386 3300005981 Bacteria 3585
55 Ga0081539_10006290 3300005985 Bacteria 11478
56 Ga0081539_10008764 3300005985 Bacteria 8681
57 Ga0070717_10058620 3300006028 Bacteria 3184
58 Ga0070717_10080849 3300006028 Bacteria 2727
59 Ga0075365_10102662 3300006038 Bacteria 1959
60 Ga0075364_10058178 3300006051 Bacteria 2533
61 Ga0070712_100054727 3300006175 Bacteria 2791
62 Ga0075431_100046520 3300006847 Bacteria 4475
63 Ga0075434_100006734 3300006871 Bacteria 10559
64 Ga0075434_100142386 3300006871 Bacteria 2418
65 Ga0075434_100197790 3300006871 Bacteria 2030
66 Ga0075436_100016740 3300006914 Bacteria 5018
67 Ga0075435_100020849 3300007076 Bacteria 5030
68 Ga0105240_10080831 3300009093 Bacteria 3996
69 Ga0111539_10067444 3300009094 Bacteria 4225
70 Ga0111539_10073223 3300009094 Bacteria 4039
71 Ga0111539_10302675 3300009094 Bacteria 1861
72 Ga0105245_10057025 3300009098 Bacteria 3512
73 Ga0114129_10039825 3300009147 Bacteria 6628
74 Ga0114129_10152737 3300009147 Bacteria 3159
75 Ga0105243_10123969 3300009148 Bacteria 2183
76 Ga0105238_10060705 3300009551 Bacteria 3785
77 Ga0157370_10006933 3300013104 Bacteria 12382
78 Ga0157370_10039573 3300013104 Bacteria 4556
79 Ga0157370_10044751 3300013104 Bacteria 4251
80 Ga0157369_10001003 3300013105 Bacteria 35669
81 Ga0157369_10014601 3300013105 Bacteria 8860
82 Ga0163162_10208086 3300013306 Bacteria 2086
83 Ga0163163_10030481 3300014325 Bacteria 5198
84 Ga0197907_10195995 3300020069 Bacteria 2288
85 Ga0206356_11759133 3300020070 Bacteria 2809
86 Ga0206353_11616165 3300020082 Bacteria 3925
87 Ga0207705_10042722 3300025909 Bacteria 3255
88 Ga0207705_10045932 3300025909 Bacteria 3138
89 Ga0207705_10047426 3300025909 Bacteria 3089
90 Ga0207684_10134512 3300025910 Bacteria 2122
91 Ga0207707_10010499 3300025912 Bacteria 8038
92 Ga0207707_10012886 3300025912 Bacteria 7277
93 Ga0207707_10030281 3300025912 Bacteria 4735
94 Ga0207695_10095992 3300025913 Bacteria 2967
95 Ga0207693_10068012 3300025915 Bacteria 2789
96 Ga0207693_10077668 3300025915 Bacteria 2600
97 Ga0207657_10000046 3300025919 Bacteria 113887
98 Ga0207657_10001876 3300025919 Bacteria 22733
99 Ga0207657_10009260 3300025919 Bacteria 9920
100 Ga0207657_10037496 3300025919 Bacteria 4327
101 Ga0207652_10028518 3300025921 Bacteria 4658
102 Ga0207652_10055509 3300025921 Bacteria 3407
103 Ga0207652_10091869 3300025921 Bacteria 2669
104 Ga0207652_10093403 3300025921 Bacteria 2647
105 Ga0207646_10001088 3300025922 Bacteria 34574
106 Ga0207646_10001751 3300025922 Bacteria 26322
107 Ga0207646_10002797 3300025922 Bacteria 20322
108 Ga0207665_10043370 3300025939 Bacteria 3007
109 Ga0207661_10010994 3300025944 Bacteria 6539
110 Ga0207661_10044915 3300025944 Bacteria 3494
111 Ga0207661_10136602 3300025944 Bacteria 2106
112 Ga0207679_10030869 3300025945 Bacteria 3746
113 Ga0207702_10042312 3300026078 Bacteria 3821
114 Ga0207674_10104943 3300026116 Bacteria 2804
115 Ga0207683_10009335 3300026121 Bacteria 8356
116 Ga0209967_1000471 3300027364 Bacteria 5283
117 Ga0207428_10078108 3300027907 Bacteria 2590
118 Ga0268266_10104499 3300028379 Bacteria 2501
119 Ga0265318_10010396 3300028577 Bacteria 4055
120 Ga0265336_10001276 3300028666 Bacteria 11870
121 Ga0265338_10002226 3300028800 Bacteria 29543
122 Ga0265338_10024348 3300028800 Bacteria 6185
123 Ga0265338_10043586 3300028800 Bacteria 4158
124 Ga0265338_10045778 3300028800 Bacteria 4018
125 Ga0265342_10038035 3300031712 Bacteria 2933
126 Ga0307407_10043179 3300031903 Bacteria 2533
127 Ga0307409_100042537 3300031995 Bacteria 3404
128 Ga0307414_10089829 3300032004 Bacteria 2278
129 Ga0307415_100005561 3300032126 Bacteria 6706
130 Ga0373944_0002673 3300035089 Bacteria 4542
131 Ga0373945_0017863 3300035116 Bacteria 2407
132 Ga0373943_0001869 3300035170 Bacteria 9519
133 Ga0373943_0006483 3300035170 Bacteria 5257
134 Ga0373946_0007592 3300035171 Bacteria 3969
135 Ga0373935_0043487 3300035692 Bacteria 2827
136 Ga0373927_0042846 3300035695 Bacteria 2933
137 Ga0373947_0000658 3300035725 Bacteria 20469
138 Ga0373925_0011642 3300037068 Bacteria 6362
139 Ga0373925_0023734 3300037068 Bacteria 4474
140 Ga0373925_0107152 3300037068 Bacteria 2155
141 Ga0395899_0005121 3300037312 Bacteria 10201
142 Ga0395899_0005857 3300037312 Bacteria 9540
143 Ga0395899_0014612 3300037312 Bacteria 5992
144 Ga0395899_0053022 3300037312 Bacteria 3004
145 Ga0395899_0063740 3300037312 Bacteria 2710
146 Ga0395899_0068765 3300037312 Bacteria 2596
147 Ga0395900_0001698 3300037418 Bacteria 25566
148 Ga0395900_0011379 3300037418 Bacteria 9106
149 Ga0395900_0085265 3300037418 Bacteria 3246
150 Ga0395900_0165051 3300037418 Bacteria 2257
151 Ga0395900_0177006 3300037418 Bacteria 2169
152 Ga0395900_0198454 3300037418 Bacteria 2031
153 Ga0395898_0002320 3300037466 Bacteria 22735
154 Ga0395898_0009510 3300037466 Bacteria 10203
155 Ga0395898_0116512 3300037466 Bacteria 2560
156 Ga0395898_0184644 3300037466 Bacteria 1993
157 Ga0395905_0006116 3300037471 Bacteria 12159
158 Ga0395905_0088782 3300037471 Bacteria 2897
159 Ga0395901_0000915 3300038443 Bacteria 32230
160 Ga0395901_0017241 3300038443 Bacteria 7370
161 Ga0395901_0024475 3300038443 Bacteria 6197
162 Ga0395901_0062184 3300038443 Bacteria 3885
163 Ga0395901_0076251 3300038443 Bacteria 3497
164 Ga0395901_0078405 3300038443 Bacteria 3449
165 Ga0395901_0096778 3300038443 Bacteria 3093
166 Ga0395901_0144403 3300038443 Bacteria 2501
167 Ga0395901_0162662 3300038443 Bacteria 2344
168 Ga0436365_0204409 3300039437 Bacteria 1831
169 Ga0436365_0888470 3300039437 Bacteria 1724
170 Ga0451804_0318762 3300041463 Bacteria 3037
171 Ga0451835_0164844 3300041492 Bacteria 2629
172 Ga0451839_0366569 3300041496 Bacteria 3477
173 Ga0439432_018441 3300042006 Bacteria 2332
174 Ga0439451_003163 3300042009 Bacteria 3343
175 Ga0466966_0089158 3300044684 Bacteria 1916
176 Ga0466961_0005612 3300044693 Bacteria 7928
177 Ga0466961_0014292 3300044693 Bacteria 5096
178 Ga0466961_0033292 3300044693 Bacteria 3312
179 Ga0466963_0003298 3300044694 Bacteria 9204
180 Ga0466963_0003999 3300044694 Bacteria 8527
181 Ga0466963_0009729 3300044694 Bacteria 5799
182 Ga0466963_0010394 3300044694 Bacteria 5634
183 Ga0466963_0014440 3300044694 Bacteria 4869
184 Ga0466963_0031965 3300044694 Bacteria 3404
185 Ga0466964_0003514 3300044706 Bacteria 5723
186 Ga0466964_0032410 3300044706 Bacteria 2076
187 Ga0466971_0019350 3300044719 Bacteria 3023
188 Ga0466968_0006895 3300044735 Bacteria 4300
189 Ga0466968_0020152 3300044735 Bacteria 2689
190 Ga0466957_0002576 3300044842 Bacteria 9755
191 Ga0466959_0002397 3300045049 Bacteria 11960
192 Ga0466959_0041391 3300045049 Bacteria 3401
193 Ga0466959_0048991 3300045049 Bacteria 3103
194 Ga0466959_0079008 3300045049 Bacteria 2372
195 Ga0466958_0000188 3300045836 Bacteria 22432
196 Ga0466958_0004864 3300045836 Bacteria 7149
197 Ga0466958_0007496 3300045836 Bacteria 6006
198 Ga0466958_0054816 3300045836 Bacteria 2418
199 Ga0466967_0003469 3300045976 Bacteria 10295
200 Ga0466967_0007075 3300045976 Bacteria 8040
201 Ga0466967_0012413 3300045976 Bacteria 6513
202 Ga0466967_0019892 3300045976 Bacteria 5412
203 Ga0466967_0025955 3300045976 Bacteria 4842
204 Ga0466967_0055223 3300045976 Bacteria 3498
205 Ga0466967_0124632 3300045976 Bacteria 2385
206 Ga0466967_0140743 3300045976 Bacteria 2247
207 Ga0466967_0258674 3300045976 Bacteria 1665
208 Ga0495592_0025584 3300046454 Bacteria 4478
209 Ga0495592_0064609 3300046454 Bacteria 2681
210 Ga0495603_0012452 3300046455 Bacteria 5149
211 Ga0495629_0000159 3300046459 Bacteria 59616
212 Ga0495629_0016241 3300046459 Bacteria 5344
213 Ga0495641_0003425 3300046461 Bacteria 11883
214 Ga0495651_0038600 3300046462 Bacteria 3719
215 Ga0495653_0108458 3300046463 Bacteria 1999
216 Ga0495582_0000183 3300046473 Bacteria 34098
217 Ga0495639_0005180 3300046475 Bacteria 5600
218 Ga0495662_0000220 3300046476 Bacteria 23891
219 Ga0495608_0038566 3300046511 Bacteria 3208
220 Ga0495618_0028679 3300046514 Bacteria 3470
221 Ga0495628_0034382 3300046516 Bacteria 4077
222 Ga0495630_0004113 3300046517 Bacteria 10186
223 Ga0495652_0065312 3300046529 Bacteria 3058
224 Ga0495652_0089436 3300046529 Bacteria 2521
225 Ga0495652_0179277 3300046529 Bacteria 1627
226 Ga0495665_0003082 3300046531 Bacteria 9020
227 Ga0495640_0081663 3300046533 Bacteria 2148
228 Ga0495587_0008243 3300046536 Bacteria 6708
229 Ga0495645_0035057 3300046543 Bacteria 3659
230 Ga0495645_0066240 3300046543 Bacteria 2611
231 Ga0495667_0002831 3300046559 Bacteria 11595
232 Ga0495667_0033511 3300046559 Bacteria 3437
233 Ga0495667_0045892 3300046559 Bacteria 2890
234 Ga0495634_0006252 3300046642 Bacteria 9068
235 Ga0495635_0037718 3300046663 Bacteria 3345
236 Ga0495657_0077347 3300046675 Bacteria 2159
237 Ga0495623_0117681 3300046679 Bacteria 1604
238 Ga0495646_0035262 3300046680 Bacteria 3104
239 Ga0495647_0003039 3300046681 Bacteria 5345
240 Ga0495658_0003812 3300046683 Bacteria 7469
241 Ga0495613_0018344 3300046689 Bacteria 5218
242 Ga0495624_0011284 3300046690 Bacteria 6143
243 Ga0495589_0031921 3300046794 Bacteria 2650
244 Ga0495600_0053152 3300046809 Bacteria 2645
245 Ga0495581_0002281 3300047315 Bacteria 10800
246 Ga0495604_0086060 3300047317 Bacteria 2344
247 Ga0495674_0003066 3300047319 Bacteria 16232
248 Ga0495674_0028946 3300047319 Bacteria 5046
249 Ga0495680_0004997 3300047322 Bacteria 12543
250 Ga0495680_0073454 3300047322 Bacteria 2599
251 Ga0495675_0034000 3300047444 Bacteria 3254
252 Ga0495602_0135542 3300048088 Bacteria 1956
253 Ga0495614_0004946 3300048089 Bacteria 6011
254 Ga0496100_0003593 3300048903 Bacteria 8103
255 Ga0496100_0009272 3300048903 Bacteria 5526
256 Ga0496100_0014502 3300048903 Bacteria 4576
257 Ga0496101_0003566 3300048904 Bacteria 9708
258 Ga0496101_0005078 3300048904 Bacteria 8373
259 Ga0496101_0042436 3300048904 Bacteria 3247
260 Ga0496101_0071457 3300048904 Bacteria 2544
261 Ga0496101_0138258 3300048904 Bacteria 1855
262 Ga0496102_0008309 3300048905 Bacteria 8892
263 Ga0496102_0008898 3300048905 Bacteria 8617
264 Ga0496102_0028952 3300048905 Bacteria 4952
265 Ga0496102_0041258 3300048905 Bacteria 4177
266 Ga0496102_0062372 3300048905 Bacteria 3413
267 Ga0496102_0104794 3300048905 Bacteria 2631
268 Ga0496103_0026332 3300048906 Bacteria 3521
269 Ga0496104_0000992 3300048907 Bacteria 24270
270 Ga0496104_0028178 3300048907 Bacteria 5205
271 Ga0496105_0000598 3300048908 Bacteria 24057
272 Ga0496105_0002662 3300048908 Bacteria 13010
273 Ga0496105_0003424 3300048908 Bacteria 11740
274 Ga0496106_0013706 3300048909 Bacteria 5987
275 Ga0496107_0016159 3300048910 Bacteria 5237
276 Ga0496108_0002650 3300048911 Bacteria 14342
277 Ga0496108_0049346 3300048911 Bacteria 3520
278 Ga0496108_0080178 3300048911 Bacteria 2765
279 Ga0496109_0002918 3300048912 Bacteria 14290
280 Ga0496109_0009730 3300048912 Bacteria 8207
281 Ga0496109_0035600 3300048912 Bacteria 4492
282 Ga0496109_0077859 3300048912 Bacteria 3052
283 Ga0496110_0003337 3300048913 Bacteria 12268
284 Ga0496111_0000850 3300048914 Bacteria 16511
285 Ga0496111_0002022 3300048914 Bacteria 12073
286 Ga0496111_0020294 3300048914 Bacteria 4624
287 Ga0496112_0002299 3300048915 Bacteria 15308
288 Ga0496112_0122393 3300048915 Bacteria 2572
289 Ga0496112_0200014 3300048915 Bacteria 1958
290 Ga0496112_0265248 3300048915 Bacteria 1666
291 Ga0496113_0053905 3300048916 Bacteria 3008
292 Ga0496114_0001233 3300048917 Bacteria 19345
293 Ga0496114_0001632 3300048917 Bacteria 17022
294 Ga0496115_0070429 3300048918 Bacteria 2835
295 Ga0501031_0008778 3300049568 Bacteria 6574
296 Ga0501032_0049717 3300049569 Bacteria 2829
297 Ga0501036_0004126 3300049572 Bacteria 11685
298 Ga0501036_0008035 3300049572 Bacteria 8637
299 Ga0501039_0001806 3300049575 Bacteria 15825
300 Ga0501039_0040823 3300049575 Bacteria 3581
301 Ga0501040_0012541 3300049576 Bacteria 5555
302 Ga0501041_0004343 3300049577 Bacteria 8198
303 Ga0501042_0015517 3300049578 Bacteria 5217
304 Ga0501046_0010021 3300049580 Bacteria 8161
305 Ga0501046_0024148 3300049580 Bacteria 4992
306 Ga0501047_0039698 3300049581 Bacteria 4552
307 Ga0501047_0090680 3300049581 Bacteria 2934
308 Ga0501048_0007222 3300049582 Bacteria 8428
309 Ga0501067_0002721 3300049583 Bacteria 9723
310 Ga0501069_0005303 3300049585 Bacteria 6698
311 Ga0501070_0020922 3300049586 Bacteria 5488
312 Ga0501070_0041018 3300049586 Bacteria 3857
313 Ga0501071_0003574 3300049587 Bacteria 9732
314 Ga0501071_0047029 3300049587 Bacteria 3099
315 Ga0501072_0005504 3300049588 Bacteria 9639
316 Ga0501072_0053523 3300049588 Bacteria 3178
317 Ga0501072_0069233 3300049588 Bacteria 2786
318 Ga0501075_0003197 3300049591 Bacteria 10961
319 Ga0501075_0022042 3300049591 Bacteria 4650
320 Ga0501076_0033327 3300049592 Bacteria 4021
321 Ga0501076_0068697 3300049592 Bacteria 2830
322 Ga0501077_0000985 3300049593 Bacteria 17153
323 Ga0501077_0012690 3300049593 Bacteria 5277
324 Ga0501077_0037723 3300049593 Bacteria 3077
325 Ga0501079_0014046 3300049741 Bacteria 6106
326 Ga0501079_0031909 3300049741 Bacteria 4048
327 Ga0501081_0002309 3300049743 Bacteria 12012
328 Ga0501081_0043045 3300049743 Bacteria 3096
329 Ga0501045_0007438 3300049824 Bacteria 7607
330 Ga0501045_0009945 3300049824 Bacteria 6653
331 nmdc:mga00v17_4654_c1 3300050491 Bacteria 7162
332 nmdc:mga05p37_22821_c1 3300050507 Bacteria 7589
333 nmdc:mga05p37_24026_c1 3300050507 Bacteria 7404
334 nmdc:mga08y16_81777_c1 3300050511 Bacteria 3367
335 nmdc:mga0a205_105805_c1 3300050515 Bacteria 2712
336 Ga0495601_0037244 3300053077 Bacteria 3040
337 Ga0495595_0025281 3300053084 Bacteria 2630
338 Ga0495595_0071637 3300053084 Bacteria 1639
339 Ga0495619_0043174 3300053085 Bacteria 2955
340 Ga0590075_001383 3300059424 Bacteria 6082
341 Ga0590077_000809 3300059426 Bacteria 8076
342 Ga0501082_0035450 3300060353 Bacteria 4300
343 Ga0501082_0054005 3300060353 Bacteria 3463
344 Ga0466962_0018681 3300061719 Bacteria 3333
345 Ga0466962_0058231 3300061719 Bacteria 1844
346 Ga0466962_0068885 3300061719 Bacteria 1690
347 Ga0530510_0002280 3300061734 Bacteria 13150
348 Ga0530510_0031456 3300061734 Bacteria 3815
349 2881101420 2881101125 Bacteria 4590519
350 Ga0466971_0040471
351 JGI25406J46586_10010847
352 Ga0070658_10031838
353 Ga0070683_100031346
354 Ga0070683_100050059
355 Ga0070683_100155611
356 Ga0070680_100023877
357 Ga0070660_100000819
358 Ga0070660_100015896
359 Ga0070660_100022520
360 Ga0070660_100034888
361 Ga0070660_100073668
362 Ga0070661_100022258
363 Ga0070661_100080353
364 Ga0070671_100082477
365 Ga0070674_100037055
366 Ga0070659_100007957
367 Ga0070678_100011659
368 Ga0070681_10000818
369 Ga0070681_10003368
370 Ga0070681_10005575
371 Ga0070681_10173840
372 Ga0070706_100192936
373 Ga0070707_100000243
374 Ga0070707_100036784
375 Ga0070698_100010455
376 Ga0070698_100016741
377 Ga0070698_100078896
378 Ga0070699_100000794
379 Ga0070699_100033471
380 Ga0070679_100043069
381 Ga0070679_100045088
382 Ga0070679_100118739
383 Ga0070679_100131685
384 Ga0070684_100004955
385 Ga0070684_100011479
386 Ga0070684_100043803
387 Ga0070684_100048478
388 Ga0070697_100000162
389 Ga0070695_100000108
390 Ga0070693_100010169
391 Ga0068855_100087026
392 Ga0068855_100117642
393 Ga0070664_100033411
394 Ga0068857_100041569
395 Ga0068852_100217535
396 Ga0081455_10003327
397 Ga0081455_10038323
398 Ga0081455_10051596
399 Ga0081455_10065455
400 Ga0081455_10079107
401 Ga0081538_10000195
402 Ga0081538_10025084
403 Ga0081538_10031386
404 Ga0081539_10006290
405 Ga0081539_10008764
406 Ga0070717_10058620
407 Ga0070717_10080849
408 Ga0075365_10102662
409 Ga0075364_10058178
410 Ga0070712_100054727
411 Ga0075431_100046520
412 Ga0075434_100006734
413 Ga0075434_100142386
414 Ga0075434_100197790
415 Ga0075436_100016740
416 Ga0075435_100020849
417 Ga0105240_10080831
418 Ga0111539_10067444
419 Ga0111539_10073223
420 Ga0111539_10302675
421 Ga0105245_10057025
422 Ga0114129_10039825
423 Ga0114129_10152737
424 Ga0105243_10123969
425 Ga0105238_10060705
426 Ga0157370_10006933
427 Ga0157370_10039573
428 Ga0157370_10044751
429 Ga0157369_10001003
430 Ga0157369_10014601
431 Ga0163162_10208086
432 Ga0163163_10030481
433 Ga0197907_10195995
434 Ga0206356_11759133
435 Ga0206353_11616165
436 Ga0207705_10042722
437 Ga0207705_10045932
438 Ga0207705_10047426
439 Ga0207684_10134512
440 Ga0207707_10010499
441 Ga0207707_10012886
442 Ga0207707_10030281
443 Ga0207695_10095992
444 Ga0207693_10068012
445 Ga0207693_10077668
446 Ga0207657_10000046
447 Ga0207657_10001876
448 Ga0207657_10009260
449 Ga0207657_10037496
450 Ga0207652_10028518
451 Ga0207652_10055509
452 Ga0207652_10091869
453 Ga0207652_10093403
454 Ga0207646_10001088
455 Ga0207646_10001751
456 Ga0207646_10002797
457 Ga0207665_10043370
458 Ga0207661_10010994
459 Ga0207661_10044915
460 Ga0207661_10136602
461 Ga0207679_10030869
462 Ga0207702_10042312
463 Ga0207674_10104943
464 Ga0207683_10009335
465 Ga0209967_1000471
466 Ga0207428_10078108
467 Ga0268266_10104499
468 Ga0265318_10010396
469 Ga0265336_10001276
470 Ga0265338_10002226
471 Ga0265338_10024348
472 Ga0265338_10043586
473 Ga0265338_10045778
474 Ga0265342_10038035
475 Ga0307407_10043179
476 Ga0307409_100042537
477 Ga0307414_10089829
478 Ga0307415_100005561
479 Ga0373944_0002673
480 Ga0373945_0017863
481 Ga0373943_0001869
482 Ga0373943_0006483
483 Ga0373946_0007592
484 Ga0373935_0043487
485 Ga0373927_0042846
486 Ga0373947_0000658
487 Ga0373925_0011642
488 Ga0373925_0023734
489 Ga0373925_0107152
490 Ga0395899_0005121
491 Ga0395899_0005857
492 Ga0395899_0014612
493 Ga0395899_0053022
494 Ga0395899_0063740
495 Ga0395899_0068765
496 Ga0395900_0001698
497 Ga0395900_0011379
498 Ga0395900_0085265
499 Ga0395900_0165051
500 Ga0395900_0177006
501 Ga0395900_0198454
502 Ga0395898_0002320
503 Ga0395898_0009510
504 Ga0395898_0116512
505 Ga0395898_0184644
506 Ga0395905_0006116
507 Ga0395905_0088782
508 Ga0395901_0000915
509 Ga0395901_0017241
510 Ga0395901_0024475
511 Ga0395901_0062184
512 Ga0395901_0076251
513 Ga0395901_0078405
514 Ga0395901_0096778
515 Ga0395901_0144403
516 Ga0395901_0162662
517 Ga0436365_0204409
518 Ga0436365_0888470
519 Ga0451804_0318762
520 Ga0451835_0164844
521 Ga0451839_0366569
522 Ga0439432_018441
523 Ga0439451_003163
524 Ga0466966_0089158
525 Ga0466961_0005612
526 Ga0466961_0014292
527 Ga0466961_0033292
528 Ga0466963_0003298
529 Ga0466963_0003999
530 Ga0466963_0009729
531 Ga0466963_0010394
532 Ga0466963_0014440
533 Ga0466963_0031965
534 Ga0466964_0003514
535 Ga0466964_0032410
536 Ga0466971_0019350
537 Ga0466968_0006895
538 Ga0466968_0020152
539 Ga0466957_0002576
540 Ga0466959_0002397
541 Ga0466959_0041391
542 Ga0466959_0048991
543 Ga0466959_0079008
544 Ga0466958_0000188
545 Ga0466958_0004864
546 Ga0466958_0007496
547 Ga0466958_0054816
548 Ga0466967_0003469
549 Ga0466967_0007075
550 Ga0466967_0012413
551 Ga0466967_0019892
552 Ga0466967_0025955
553 Ga0466967_0055223
554 Ga0466967_0124632
555 Ga0466967_0140743
556 Ga0466967_0258674
557 Ga0495592_0025584
558 Ga0495592_0064609
559 Ga0495603_0012452
560 Ga0495629_0000159
561 Ga0495629_0016241
562 Ga0495641_0003425
563 Ga0495651_0038600
564 Ga0495653_0108458
565 Ga0495582_0000183
566 Ga0495639_0005180
567 Ga0495662_0000220
568 Ga0495608_0038566
569 Ga0495618_0028679
570 Ga0495628_0034382
571 Ga0495630_0004113
572 Ga0495652_0065312
573 Ga0495652_0089436
574 Ga0495652_0179277
575 Ga0495665_0003082
576 Ga0495640_0081663
577 Ga0495587_0008243
578 Ga0495645_0035057
579 Ga0495645_0066240
580 Ga0495667_0002831
581 Ga0495667_0033511
582 Ga0495667_0045892
583 Ga0495634_0006252
584 Ga0495635_0037718
585 Ga0495657_0077347
586 Ga0495623_0117681
587 Ga0495646_0035262
588 Ga0495647_0003039
589 Ga0495658_0003812
590 Ga0495613_0018344
591 Ga0495624_0011284
592 Ga0495589_0031921
593 Ga0495600_0053152
594 Ga0495581_0002281
595 Ga0495604_0086060
596 Ga0495674_0003066
597 Ga0495674_0028946
598 Ga0495680_0004997
599 Ga0495680_0073454
600 Ga0495675_0034000
601 Ga0495602_0135542
602 Ga0495614_0004946
603 Ga0496100_0003593
604 Ga0496100_0009272
605 Ga0496100_0014502
606 Ga0496101_0003566
607 Ga0496101_0005078
608 Ga0496101_0042436
609 Ga0496101_0071457
610 Ga0496101_0138258
611 Ga0496102_0008309
612 Ga0496102_0008898
613 Ga0496102_0028952
614 Ga0496102_0041258
615 Ga0496102_0062372
616 Ga0496102_0104794
617 Ga0496103_0026332
618 Ga0496104_0000992
619 Ga0496104_0028178
620 Ga0496105_0000598
621 Ga0496105_0002662
622 Ga0496105_0003424
623 Ga0496106_0013706
624 Ga0496107_0016159
625 Ga0496108_0002650
626 Ga0496108_0049346
627 Ga0496108_0080178
628 Ga0496109_0002918
629 Ga0496109_0009730
630 Ga0496109_0035600
631 Ga0496109_0077859
632 Ga0496110_0003337
633 Ga0496111_0000850
634 Ga0496111_0002022
635 Ga0496111_0020294
636 Ga0496112_0002299
637 Ga0496112_0122393
638 Ga0496112_0200014
639 Ga0496112_0265248
640 Ga0496113_0053905
641 Ga0496114_0001233
642 Ga0496114_0001632
643 Ga0496115_0070429
644 Ga0501031_0008778
645 Ga0501032_0049717
646 Ga0501036_0004126
647 Ga0501036_0008035
648 Ga0501039_0001806
649 Ga0501039_0040823
650 Ga0501040_0012541
651 Ga0501041_0004343
652 Ga0501042_0015517
653 Ga0501046_0010021
654 Ga0501046_0024148
655 Ga0501047_0039698
656 Ga0501047_0090680
657 Ga0501048_0007222
658 Ga0501067_0002721
659 Ga0501069_0005303
660 Ga0501070_0020922
661 Ga0501070_0041018
662 Ga0501071_0003574
663 Ga0501071_0047029
664 Ga0501072_0005504
665 Ga0501072_0053523
666 Ga0501072_0069233
667 Ga0501075_0003197
668 Ga0501075_0022042
669 Ga0501076_0033327
670 Ga0501076_0068697
671 Ga0501077_0000985
672 Ga0501077_0012690
673 Ga0501077_0037723
674 Ga0501079_0014046
675 Ga0501079_0031909
676 Ga0501081_0002309
677 Ga0501081_0043045
678 Ga0501045_0007438
679 Ga0501045_0009945
680 nmdc:mga00v17_4654_c1
681 nmdc:mga05p37_22821_c1
682 nmdc:mga05p37_24026_c1
683 nmdc:mga08y16_81777_c1
684 nmdc:mga0a205_105805_c1
685 Ga0495601_0037244
686 Ga0495595_0025281
687 Ga0495595_0071637
688 Ga0495619_0043174
689 Ga0590075_001383
690 Ga0590077_000809
691 Ga0501082_0035450
692 Ga0501082_0054005
693 Ga0466962_0018681
694 Ga0466962_0058231
695 Ga0466962_0068885
696 Ga0530510_0002280
697 Ga0530510_0031456
698 2881101420

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13193

AMP-binding_C

AMP-binding enzyme C-terminal domain

464

539

0.98

PF00501

AMP-binding

AMP-binding enzyme

16

391

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ijb-assembly1.cif.gz_B structure of 3-methylmercaptopropionate coa ligase mutant k523a in complex with amp and mmpa 0.9038 1 537
6ijb-assembly1.cif.gz_B structure of 3-methylmercaptopropionate coa ligase mutant k523a in complex with amp and mmpa 0.8974 1 537
4u5y-assembly1.cif.gz_D crystal structure of the complex between the gnat domain of s. lividans pat and the acetyl-coa synthetase c-terminal domain of s. enterica 0.8926 448 539
3ivr-assembly1.cif.gz_B crystal structure of putative long-chain-fatty-acid coa ligase from rhodopseudomonas palustris cga009 0.891 6 434
3ipl-assembly3.cif.gz_C crystal structure of o-succinylbenzoic acid-coa ligase from staphylococcus aureus subsp. aureus mu50 0.8906 15 433
ID Description Score Start End Superfamily
1ultB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;ANL, N-terminal domain 0.9532 1 432 3.40.50.12780
af_O53406_1_431_3.40.50.12780 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;ANL, N-terminal domain 0.9505 1 434 3.40.50.12780
5upsA02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;ANL, C-terminal domain 0.9493 448 536 3.30.300.30
1ultB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;ANL, N-terminal domain 0.9466 1 432 3.40.50.12780
af_O53406_1_431_3.40.50.12780 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;ANL, N-terminal domain 0.9462 1 434 3.40.50.12780
ID Description Score Start End GO Terms
AF-A0A3D5MRC7-F1-model_v4 AMP-binding enzyme C-terminal domain-containing protein 0.9813 448 534 GO:0016405
AF-A0A0S8JBR2-F1-model_v4 AMP-binding enzyme C-terminal domain-containing protein 0.9663 448 534 GO:0016878
GO:0044550
GO:0046417
AF-A0A3D5W549-F1-model_v4 Long-chain fatty acid--CoA ligase 0.9607 2 377 GO:0016874
AF-A0A2K3LEK0-F1-model_v4 4-coumarate-CoA ligase 7-like protein 0.9449 446 537 GO:0016405
AF-A0A0U1DM87-F1-model_v4 Long-chain-fatty-acid-CoA ligase 0.9398 448 535 GO:0006631
GO:0031956

Map