F417946

General Info

Members Datasets Scaffolds Average Seq Length
349 211 698 189

Family's Representative Sequence

Representative Sequence 3300032005|Ga0307411_10353783|Ga0307411_103537832
Length 221
Sequence MALRSTHSLETMVRQDPASRDDAGAVHGNGEDERMATAHATQTATWQLDPTHSSVEFSVKHMMMTTVRGRFKEISATLTADEEHPEGCCVEVALQTASLDTGVADRDAHLRSADFFDAEHYPQITFTSKRVEGKFAKEGDRFRMVGDLTIRDTTMEITLECEFSGRGQDPWGKERAGFTARGDIDRREWGLKWNQVIESGGVLVANKVRIEAEVQFVKQEG

Samples

Sample ID Description Type Environment
1 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
127 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
128 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
129 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
130 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
131 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
132 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
133 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
136 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
137 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
138 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
139 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
140 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
141 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
142 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
143 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
144 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
145 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
146 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
147 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
148 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
149 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
150 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
151 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
152 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
153 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
154 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
155 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
156 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
157 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
158 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
159 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
160 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
161 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
162 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
163 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
164 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
165 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
166 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
172 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
173 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
174 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
175 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
176 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
177 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
178 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
179 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
180 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
181 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
182 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
183 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
184 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
185 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
186 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
187 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
188 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
189 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
190 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
191 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
192 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
193 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
194 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
195 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
196 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
197 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
198 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
199 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
200 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
201 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
202 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
203 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
204 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.28
Metatranscriptomes 3.72
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.3
Rhizosphere 95.7
Stem 0
Stem Tuber 0
Unclassified 20.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307411_10353783 3300032005 Bacteria 1198
2 Ga0058863_11947968 3300004799 Unclassified 757
3 Ga0058861_10064372 3300004800 Bacteria 1324
4 Ga0058861_11426477 3300004800 Unclassified 1285
5 Ga0058861_11822680 3300004800 Unclassified 650
6 Ga0058862_10095049 3300004803 Bacteria 829
7 Ga0065715_10213542 3300005293 Bacteria 1303
8 Ga0070676_10197627 3300005328 Bacteria 1316
9 Ga0070683_100015512 3300005329 Bacteria 6696
10 Ga0070683_100067214 3300005329 Bacteria 3339
11 Ga0070683_100210971 3300005329 Bacteria 1845
12 Ga0070690_100006731 3300005330 Bacteria 6530
13 Ga0070690_100405644 3300005330 Bacteria 1002
14 Ga0070670_100005962 3300005331 Bacteria 10308
15 Ga0070670_100044680 3300005331 Bacteria 3808
16 Ga0068869_100001575 3300005334 Bacteria 13557
17 Ga0070666_10150227 3300005335 Unclassified 1625
18 Ga0070680_100014027 3300005336 Bacteria 6256
19 Ga0070680_100026588 3300005336 Unclassified 4629
20 Ga0070680_100071640 3300005336 Unclassified 2848
21 Ga0070680_100219580 3300005336 Bacteria 1604
22 Ga0070680_100529757 3300005336 Unclassified 1009
23 Ga0070682_100017276 3300005337 Unclassified 4205
24 Ga0068868_100031638 3300005338 Unclassified 4066
25 Ga0068868_100072866 3300005338 Bacteria 2741
26 Ga0070660_100022387 3300005339 Unclassified 4673
27 Ga0070660_100257273 3300005339 Bacteria 1425
28 Ga0070661_100006406 3300005344 Bacteria 8117
29 Ga0070692_10011827 3300005345 Unclassified 4021
30 Ga0070692_10270805 3300005345 Bacteria 1025
31 Ga0070668_100212985 3300005347 Bacteria 1590
32 Ga0070669_100005383 3300005353 Bacteria 9234
33 Ga0070669_100413160 3300005353 Bacteria 1106
34 Ga0070675_100003920 3300005354 Bacteria 11270
35 Ga0070675_100020655 3300005354 Bacteria 5255
36 Ga0070671_100320906 3300005355 Unclassified 1320
37 Ga0070674_100048148 3300005356 Bacteria 2925
38 Ga0070673_100178465 3300005364 Bacteria 1817
39 Ga0070673_100285864 3300005364 Unclassified 1448
40 Ga0070673_100447880 3300005364 Bacteria 1161
41 Ga0070659_100016916 3300005366 Bacteria 5481
42 Ga0070709_10711303 3300005434 Bacteria 782
43 Ga0070701_10041287 3300005438 Bacteria 2350
44 Ga0070694_100084203 3300005444 Bacteria 2218
45 Ga0070694_101092039 3300005444 Bacteria 665
46 Ga0070678_100433366 3300005456 Bacteria 1148
47 Ga0070662_100006425 3300005457 Bacteria 7577
48 Ga0070662_100241137 3300005457 Bacteria 1450
49 Ga0070662_100671805 3300005457 Bacteria 875
50 Ga0070681_10008222 3300005458 Bacteria 10207
51 Ga0070681_10008959 3300005458 Bacteria 9839
52 Ga0070681_10088409 3300005458 Bacteria 3050
53 Ga0070681_10345772 3300005458 Unclassified 1397
54 Ga0070681_10588416 3300005458 Unclassified 1027
55 Ga0068867_100668551 3300005459 Bacteria 913
56 Ga0070679_100024089 3300005530 Bacteria 5963
57 Ga0070684_100028104 3300005535 Bacteria 4754
58 Ga0070684_100420016 3300005535 Bacteria 1234
59 Ga0068853_100536420 3300005539 Bacteria 1107
60 Ga0070672_100048858 3300005543 Bacteria 3289
61 Ga0070672_100503873 3300005543 Bacteria 1047
62 Ga0070686_100315934 3300005544 Bacteria 1163
63 Ga0070695_100417219 3300005545 Bacteria 1021
64 Ga0070693_100006964 3300005547 Bacteria 5501
65 Ga0070665_100155101 3300005548 Bacteria 2292
66 Ga0068855_100346011 3300005563 Unclassified 1638
67 Ga0070664_100021153 3300005564 Bacteria 5359
68 Ga0070664_100356817 3300005564 Bacteria 1331
69 Ga0068857_100015607 3300005577 Bacteria 6636
70 Ga0068857_100023124 3300005577 Bacteria 5467
71 Ga0068856_100623518 3300005614 Unclassified 1099
72 Ga0070702_100102701 3300005615 Unclassified 1757
73 Ga0068859_100255476 3300005617 Bacteria 1843
74 Ga0068864_100003146 3300005618 Bacteria 13641
75 Ga0068864_100403872 3300005618 Bacteria 1299
76 Ga0068861_100001759 3300005719 Bacteria 13928
77 Ga0068870_10020539 3300005840 Unclassified 3218
78 Ga0068870_10144610 3300005840 Bacteria 1394
79 Ga0068863_100062058 3300005841 Unclassified 3535
80 Ga0068863_100882644 3300005841 Bacteria 894
81 Ga0068858_100348720 3300005842 Archaea 1418
82 Ga0068860_100059591 3300005843 Unclassified 3628
83 Ga0068862_100012567 3300005844 Bacteria 7011
84 Ga0068862_100303297 3300005844 Bacteria 1470
85 Ga0097621_100201471 3300006237 Unclassified 1728
86 Ga0068871_100012908 3300006358 Bacteria 6186
87 Ga0068871_100380922 3300006358 Bacteria 1253
88 Ga0075428_101120880 3300006844 Bacteria 831
89 Ga0075430_100015178 3300006846 Bacteria 6558
90 Ga0075430_100039825 3300006846 Bacteria 3977
91 Ga0075430_100093694 3300006846 Bacteria 2511
92 Ga0075430_100186808 3300006846 Bacteria 1723
93 Ga0075430_100258328 3300006846 Bacteria 1443
94 Ga0075431_100004071 3300006847 Bacteria 14256
95 Ga0075431_100015060 3300006847 Bacteria 7831
96 Ga0075431_100020818 3300006847 Bacteria 6702
97 Ga0075431_100216681 3300006847 Bacteria 1954
98 Ga0075431_100220571 3300006847 Bacteria 1934
99 Ga0075433_10001818 3300006852 Bacteria 16033
100 Ga0075433_10077517 3300006852 Bacteria 2927
101 Ga0075434_100001675 3300006871 Bacteria 18917
102 Ga0068865_100154044 3300006881 Bacteria 1746
103 Ga0097620_100255482 3300006931 Bacteria 1843
104 Ga0075435_100080004 3300007076 Bacteria 2683
105 Ga0111539_10009666 3300009094 Bacteria 12171
106 Ga0111539_10082069 3300009094 Bacteria 3791
107 Ga0111539_10217811 3300009094 Bacteria 2223
108 Ga0111539_11292133 3300009094 Unclassified 847
109 Ga0105245_10000570 3300009098 Bacteria 33601
110 Ga0114129_10020315 3300009147 Bacteria 9448
111 Ga0114129_10220002 3300009147 Bacteria 2562
112 Ga0114129_10365145 3300009147 Bacteria 1909
113 Ga0114129_10366477 3300009147 Bacteria 1905
114 Ga0105241_10008931 3300009174 Bacteria 7370
115 Ga0105241_10539228 3300009174 Bacteria 1046
116 Ga0105248_10122348 3300009177 Bacteria 2935
117 Ga0105249_10001081 3300009553 Bacteria 24196
118 Ga0105246_10096190 3300011119 Bacteria 2146
119 Ga0157373_10223657 3300013100 Bacteria 1328
120 Ga0157373_10249881 3300013100 Unclassified 1254
121 Ga0157371_10731990 3300013102 Unclassified 742
122 Ga0157370_10470324 3300013104 Unclassified 1155
123 Ga0157369_10375373 3300013105 Bacteria 1476
124 Ga0163162_10002062 3300013306 Bacteria 18887
125 Ga0157372_10453343 3300013307 Bacteria 1495
126 Ga0157375_10126473 3300013308 Bacteria 2671
127 Ga0157380_10032402 3300014326 Bacteria 4019
128 Ga0182008_10061504 3300014497 Unclassified 1851
129 Ga0157377_10095026 3300014745 Bacteria 1766
130 Ga0157376_10182741 3300014969 Unclassified 1918
131 Ga0206352_10602935 3300020078 Unclassified 1554
132 Ga0207680_10129404 3300025903 Unclassified 1662
133 Ga0207645_10816082 3300025907 Bacteria 634
134 Ga0207643_10147290 3300025908 Archaea 1409
135 Ga0207707_10008564 3300025912 Bacteria 8868
136 Ga0207707_10014761 3300025912 Bacteria 6805
137 Ga0207660_10190807 3300025917 Unclassified 1595
138 Ga0207660_10233370 3300025917 Bacteria 1447
139 Ga0207662_10102946 3300025918 Unclassified 1771
140 Ga0207657_10016996 3300025919 Bacteria 6998
141 Ga0207657_10509611 3300025919 Bacteria 942
142 Ga0207649_10073648 3300025920 Unclassified 2188
143 Ga0207649_10337363 3300025920 Bacteria 1112
144 Ga0207652_10000748 3300025921 Bacteria 31263
145 Ga0207652_10113884 3300025921 Unclassified 2401
146 Ga0207681_10000568 3300025923 Bacteria 25233
147 Ga0207650_10010027 3300025925 Bacteria 6486
148 Ga0207650_10051221 3300025925 Unclassified 3055
149 Ga0207659_10008861 3300025926 Bacteria 6269
150 Ga0207659_10140028 3300025926 Bacteria 1877
151 Ga0207659_10538398 3300025926 Bacteria 992
152 Ga0207687_10017408 3300025927 Unclassified 4732
153 Ga0207644_10517970 3300025931 Unclassified 985
154 Ga0207690_10181684 3300025932 Unclassified 1584
155 Ga0207706_10011051 3300025933 Bacteria 8228
156 Ga0207706_10172502 3300025933 Bacteria 1900
157 Ga0207691_10002912 3300025940 Bacteria 16702
158 Ga0207691_10083294 3300025940 Bacteria 2872
159 Ga0207711_10186308 3300025941 Unclassified 1889
160 Ga0207711_10597611 3300025941 Bacteria 1029
161 Ga0207689_10000178 3300025942 Bacteria 55729
162 Ga0207661_10015899 3300025944 Bacteria 5543
163 Ga0207661_10252087 3300025944 Bacteria 1569
164 Ga0207661_10411694 3300025944 Bacteria 1227
165 Ga0207679_10256863 3300025945 Bacteria 1488
166 Ga0207679_10363052 3300025945 Unclassified 1265
167 Ga0207667_10106677 3300025949 Bacteria 2889
168 Ga0207651_10082999 3300025960 Bacteria 2316
169 Ga0207651_10306637 3300025960 Unclassified 1322
170 Ga0207651_10382209 3300025960 Bacteria 1193
171 Ga0207712_10008948 3300025961 Bacteria 6332
172 Ga0207668_10048950 3300025972 Bacteria 2903
173 Ga0207658_11139282 3300025986 Bacteria 713
174 Ga0207677_10004375 3300026023 Bacteria 7567
175 Ga0207677_10108055 3300026023 Bacteria 2065
176 Ga0207703_10454613 3300026035 Unclassified 1197
177 Ga0207708_10215869 3300026075 Bacteria 1535
178 Ga0207641_10449195 3300026088 Unclassified 1245
179 Ga0207648_10568309 3300026089 Bacteria 1043
180 Ga0207676_10045503 3300026095 Unclassified 3391
181 Ga0207674_10000096 3300026116 Bacteria 98870
182 Ga0207675_100032195 3300026118 Bacteria 4885
183 Ga0209969_1005496 3300027360 Unclassified 1779
184 Ga0209981_1011949 3300027378 Unclassified 1199
185 Ga0209984_1010154 3300027424 Bacteria 1205
186 Ga0210000_1053012 3300027462 Unclassified 652
187 Ga0209968_1011667 3300027526 Unclassified 1365
188 Ga0209999_1019548 3300027543 Bacteria 1241
189 Ga0209966_1002267 3300027695 Unclassified 3211
190 Ga0209974_10018496 3300027876 Bacteria 2312
191 Ga0209974_10031317 3300027876 Unclassified 1761
192 Ga0268265_10002696 3300028380 Bacteria 13148
193 Ga0268264_10495193 3300028381 Unclassified 1191
194 Ga0307408_100024643 3300031548 Unclassified 4112
195 Ga0307408_100324864 3300031548 Bacteria 1297
196 Ga0307405_10061389 3300031731 Bacteria 2376
197 Ga0307405_10210833 3300031731 Bacteria 1418
198 Ga0307405_10224219 3300031731 Bacteria 1381
199 Ga0307405_10718690 3300031731 Bacteria 829
200 Ga0307413_10072245 3300031824 Bacteria 2177
201 Ga0307413_10145294 3300031824 Bacteria 1645
202 Ga0307413_10301911 3300031824 Bacteria 1214
203 Ga0307413_10391381 3300031824 Bacteria 1086
204 Ga0307413_10536636 3300031824 Bacteria 946
205 Ga0307410_10146397 3300031852 Bacteria 1753
206 Ga0307410_10208646 3300031852 Bacteria 1495
207 Ga0307410_10266438 3300031852 Bacteria 1338
208 Ga0307410_10300326 3300031852 Unclassified 1267
209 Ga0307410_10441655 3300031852 Bacteria 1059
210 Ga0307410_11048310 3300031852 Bacteria 705
211 Ga0307406_10037810 3300031901 Bacteria 2984
212 Ga0307406_10106573 3300031901 Bacteria 1920
213 Ga0307406_10768350 3300031901 Bacteria 810
214 Ga0307407_10050430 3300031903 Bacteria 2381
215 Ga0307407_10253763 3300031903 Bacteria 1206
216 Ga0307412_10143424 3300031911 Bacteria 1752
217 Ga0307412_10159199 3300031911 Unclassified 1675
218 Ga0307412_10221349 3300031911 Bacteria 1451
219 Ga0307409_100066924 3300031995 Bacteria 2835
220 Ga0307409_100226842 3300031995 Bacteria 1690
221 Ga0307409_100249746 3300031995 Unclassified 1621
222 Ga0307409_100476139 3300031995 Bacteria 1210
223 Ga0307409_100599593 3300031995 Bacteria 1088
224 Ga0307416_100052140 3300032002 Bacteria 3273
225 Ga0307416_100058205 3300032002 Bacteria 3132
226 Ga0307416_100317967 3300032002 Bacteria 1557
227 Ga0307416_100421172 3300032002 Bacteria 1379
228 Ga0307416_100493326 3300032002 Bacteria 1287
229 Ga0307416_100527109 3300032002 Bacteria 1251
230 Ga0307416_100719595 3300032002 Bacteria 1089
231 Ga0307416_101737622 3300032002 Bacteria 728
232 Ga0307414_10122606 3300032004 Bacteria 2001
233 Ga0307414_10157730 3300032004 Bacteria 1799
234 Ga0307414_10279412 3300032004 Bacteria 1402
235 Ga0307411_10034755 3300032005 Bacteria 3140
236 Ga0307411_10043492 3300032005 Unclassified 2874
237 Ga0307411_10061626 3300032005 Bacteria 2498
238 Ga0307411_10065677 3300032005 Bacteria 2434
239 Ga0307411_10098092 3300032005 Bacteria 2064
240 Ga0307411_10106432 3300032005 Bacteria 1996
241 Ga0307415_100020040 3300032126 Bacteria 4073
242 Ga0307415_100041687 3300032126 Bacteria 3050
243 Ga0307415_100282238 3300032126 Unclassified 1366
244 Ga0307415_100294945 3300032126 Bacteria 1340
245 Ga0307415_100365336 3300032126 Unclassified 1220
246 Ga0307415_100541489 3300032126 Bacteria 1026
247 Ga0307415_100729617 3300032126 Bacteria 897
248 Ga0373928_0073780 3300035084 Bacteria 849
249 Ga0373932_0015685 3300035112 Bacteria 1924
250 Ga0373941_0008508 3300035115 Bacteria 2551
251 Ga0373927_0465975 3300035695 Bacteria 835
252 Ga0395905_0191900 3300037471 Bacteria 1916
253 Ga0395905_0238173 3300037471 Bacteria 1701
254 Ga0242419_001431 3300038698 Unclassified 1467
255 Ga0242420_014198 3300038996 Bacteria 1364
256 Ga0439435_0189248 3300042436 Bacteria 675
257 Ga0466966_0155269 3300044684 Bacteria 1394
258 Ga0466960_0488923 3300044901 Bacteria 720
259 Ga0466959_0038572 3300045049 Bacteria 3530
260 Ga0466959_0256212 3300045049 Bacteria 1206
261 Ga0466959_0470613 3300045049 Bacteria 851
262 Ga0466959_0560300 3300045049 Bacteria 770
263 Ga0451576_0438363 3300045051 Bacteria 1371
264 Ga0451576_0458372 3300045051 Unclassified 1339
265 Ga0466958_0147304 3300045836 Bacteria 1484
266 Ga0495603_0068395 3300046455 Bacteria 2090
267 Ga0495594_0562089 3300046499 Bacteria 647
268 Ga0495622_0132788 3300046557 Bacteria 1133
269 Ga0495669_0113726 3300046684 Bacteria 1265
270 Ga0496100_0357212 3300048903 Unclassified 1105
271 Ga0496102_0492204 3300048905 Bacteria 1148
272 Ga0496102_1219826 3300048905 Unclassified 672
273 Ga0496104_0752004 3300048907 Bacteria 882
274 Ga0496104_0901027 3300048907 Bacteria 789
275 Ga0496106_0089698 3300048909 Bacteria 2371
276 Ga0496106_0601382 3300048909 Bacteria 881
277 Ga0496108_0014996 3300048911 Bacteria 6325
278 Ga0496109_0144565 3300048912 Bacteria 2224
279 Ga0496110_0278069 3300048913 Bacteria 1524
280 Ga0496111_0240448 3300048914 Bacteria 1345
281 Ga0496112_0000926 3300048915 Bacteria 21217
282 Ga0496112_0103532 3300048915 Bacteria 2816
283 Ga0496113_0035864 3300048916 Bacteria 3630
284 Ga0496114_0547291 3300048917 Bacteria 1023
285 Ga0501291_012527 3300049514 Bacteria 1240
286 Ga0501031_0170747 3300049568 Bacteria 1421
287 Ga0501036_0140677 3300049572 Bacteria 2037
288 Ga0501040_0007644 3300049576 Bacteria 6996
289 Ga0501040_0669189 3300049576 Unclassified 750
290 Ga0501042_0048601 3300049578 Bacteria 3025
291 Ga0501042_0121979 3300049578 Unclassified 1876
292 Ga0501048_0035413 3300049582 Bacteria 3594
293 Ga0501067_0120109 3300049583 Bacteria 1462
294 Ga0501067_0388120 3300049583 Unclassified 778
295 Ga0501069_0087089 3300049585 Bacteria 1764
296 Ga0501071_0117681 3300049587 Bacteria 1968
297 Ga0501075_0095833 3300049591 Bacteria 2252
298 Ga0501075_0132573 3300049591 Bacteria 1898
299 Ga0501217_017387 3300049661 Bacteria 1658
300 Ga0501230_013321 3300049667 Bacteria 1333
301 Ga0501230_044255 3300049667 Unclassified 870
302 Ga0501233_010281 3300049668 Bacteria 1840
303 Ga0501235_002649 3300049669 Bacteria 3854
304 Ga0501235_031922 3300049669 Bacteria 1190
305 Ga0501239_011669 3300049672 Bacteria 985
306 Ga0501242_005806 3300049674 Bacteria 1397
307 Ga0501243_002280 3300049675 Bacteria 2798
308 Ga0501252_010293 3300049682 Bacteria 1104
309 Ga0501253_006669 3300049683 Bacteria 1576
310 Ga0501260_005003 3300049689 Bacteria 1237
311 Ga0501261_015746 3300049690 Bacteria 1045
312 Ga0501221_003352 3300049704 Bacteria 2634
313 Ga0501225_0000530 3300049705 Bacteria 11922
314 Ga0501079_0279929 3300049741 Unclassified 1304
315 Ga0501079_0524861 3300049741 Bacteria 931
316 Ga0501263_004958 3300049760 Bacteria 1487
317 Ga0501266_010579 3300049763 Bacteria 1176
318 Ga0501268_077041 3300049765 Bacteria 683
319 Ga0501270_031061 3300049767 Bacteria 882
320 Ga0501270_051022 3300049767 Bacteria 750
321 Ga0501045_0038390 3300049824 Bacteria 3483
322 nmdc:mga05p37_1183131_c1 3300050507 Bacteria 792
323 nmdc:mga05p37_512833_c1 3300050507 Bacteria 1373
324 nmdc:mga09592_280065_c1 3300050508 Bacteria 1446
325 nmdc:mga09592_674110_c1 3300050508 Unclassified 881
326 nmdc:mga0qj67_172147_c1 3300050509 Bacteria 1758
327 nmdc:mga0qj67_18870_c1 3300050509 Bacteria 5261
328 nmdc:mga0qj67_93190_c1 3300050509 Unclassified 2422
329 nmdc:mga06r32_119064_c1 3300050510 Bacteria 2604
330 nmdc:mga06r32_137300_c1 3300050510 Bacteria 2420
331 nmdc:mga06r32_493109_c1 3300050510 Bacteria 1202
332 nmdc:mga08y16_248174_c1 3300050511 Bacteria 1839
333 nmdc:mga08y16_560426_c1 3300050511 Bacteria 1155
334 nmdc:mga08y16_73223_c1 3300050511 Bacteria 3569
335 nmdc:mga0n895_100379_c1 3300050512 Bacteria 2903
336 nmdc:mga0n895_42525_c1 3300050512 Bacteria 4421
337 nmdc:mga0rr50_182459_c1 3300050513 Bacteria 1716
338 nmdc:mga0a205_80391_c1 3300050515 Bacteria 3150
339 nmdc:mga0a205_96014_c1 3300050515 Bacteria 2863
340 Ga0501084_0899909 3300054114 Bacteria 744
341 Ga0590071_067438 3300059421 Bacteria 879
342 Ga0587073_0012763 3300059492 Bacteria 1462
343 Ga0587083_0034304 3300059505 Bacteria 1029
344 Ga0587088_067129 3300059508 Bacteria 740
345 Ga0587113_004488 3300059625 Bacteria 1112
346 Ga0587115_010429 3300059626 Bacteria 1157
347 Ga0587128_043430 3300059630 Bacteria 795
348 Ga0587114_007986 3300059655 Bacteria 1230
349 Ga0501082_0290076 3300060353 Unclassified 1425
350 Ga0307411_10353783
351 Ga0058863_11947968
352 Ga0058861_10064372
353 Ga0058861_11426477
354 Ga0058861_11822680
355 Ga0058862_10095049
356 Ga0065715_10213542
357 Ga0070676_10197627
358 Ga0070683_100015512
359 Ga0070683_100067214
360 Ga0070683_100210971
361 Ga0070690_100006731
362 Ga0070690_100405644
363 Ga0070670_100005962
364 Ga0070670_100044680
365 Ga0068869_100001575
366 Ga0070666_10150227
367 Ga0070680_100014027
368 Ga0070680_100026588
369 Ga0070680_100071640
370 Ga0070680_100219580
371 Ga0070680_100529757
372 Ga0070682_100017276
373 Ga0068868_100031638
374 Ga0068868_100072866
375 Ga0070660_100022387
376 Ga0070660_100257273
377 Ga0070661_100006406
378 Ga0070692_10011827
379 Ga0070692_10270805
380 Ga0070668_100212985
381 Ga0070669_100005383
382 Ga0070669_100413160
383 Ga0070675_100003920
384 Ga0070675_100020655
385 Ga0070671_100320906
386 Ga0070674_100048148
387 Ga0070673_100178465
388 Ga0070673_100285864
389 Ga0070673_100447880
390 Ga0070659_100016916
391 Ga0070709_10711303
392 Ga0070701_10041287
393 Ga0070694_100084203
394 Ga0070694_101092039
395 Ga0070678_100433366
396 Ga0070662_100006425
397 Ga0070662_100241137
398 Ga0070662_100671805
399 Ga0070681_10008222
400 Ga0070681_10008959
401 Ga0070681_10088409
402 Ga0070681_10345772
403 Ga0070681_10588416
404 Ga0068867_100668551
405 Ga0070679_100024089
406 Ga0070684_100028104
407 Ga0070684_100420016
408 Ga0068853_100536420
409 Ga0070672_100048858
410 Ga0070672_100503873
411 Ga0070686_100315934
412 Ga0070695_100417219
413 Ga0070693_100006964
414 Ga0070665_100155101
415 Ga0068855_100346011
416 Ga0070664_100021153
417 Ga0070664_100356817
418 Ga0068857_100015607
419 Ga0068857_100023124
420 Ga0068856_100623518
421 Ga0070702_100102701
422 Ga0068859_100255476
423 Ga0068864_100003146
424 Ga0068864_100403872
425 Ga0068861_100001759
426 Ga0068870_10020539
427 Ga0068870_10144610
428 Ga0068863_100062058
429 Ga0068863_100882644
430 Ga0068858_100348720
431 Ga0068860_100059591
432 Ga0068862_100012567
433 Ga0068862_100303297
434 Ga0097621_100201471
435 Ga0068871_100012908
436 Ga0068871_100380922
437 Ga0075428_101120880
438 Ga0075430_100015178
439 Ga0075430_100039825
440 Ga0075430_100093694
441 Ga0075430_100186808
442 Ga0075430_100258328
443 Ga0075431_100004071
444 Ga0075431_100015060
445 Ga0075431_100020818
446 Ga0075431_100216681
447 Ga0075431_100220571
448 Ga0075433_10001818
449 Ga0075433_10077517
450 Ga0075434_100001675
451 Ga0068865_100154044
452 Ga0097620_100255482
453 Ga0075435_100080004
454 Ga0111539_10009666
455 Ga0111539_10082069
456 Ga0111539_10217811
457 Ga0111539_11292133
458 Ga0105245_10000570
459 Ga0114129_10020315
460 Ga0114129_10220002
461 Ga0114129_10365145
462 Ga0114129_10366477
463 Ga0105241_10008931
464 Ga0105241_10539228
465 Ga0105248_10122348
466 Ga0105249_10001081
467 Ga0105246_10096190
468 Ga0157373_10223657
469 Ga0157373_10249881
470 Ga0157371_10731990
471 Ga0157370_10470324
472 Ga0157369_10375373
473 Ga0163162_10002062
474 Ga0157372_10453343
475 Ga0157375_10126473
476 Ga0157380_10032402
477 Ga0182008_10061504
478 Ga0157377_10095026
479 Ga0157376_10182741
480 Ga0206352_10602935
481 Ga0207680_10129404
482 Ga0207645_10816082
483 Ga0207643_10147290
484 Ga0207707_10008564
485 Ga0207707_10014761
486 Ga0207660_10190807
487 Ga0207660_10233370
488 Ga0207662_10102946
489 Ga0207657_10016996
490 Ga0207657_10509611
491 Ga0207649_10073648
492 Ga0207649_10337363
493 Ga0207652_10000748
494 Ga0207652_10113884
495 Ga0207681_10000568
496 Ga0207650_10010027
497 Ga0207650_10051221
498 Ga0207659_10008861
499 Ga0207659_10140028
500 Ga0207659_10538398
501 Ga0207687_10017408
502 Ga0207644_10517970
503 Ga0207690_10181684
504 Ga0207706_10011051
505 Ga0207706_10172502
506 Ga0207691_10002912
507 Ga0207691_10083294
508 Ga0207711_10186308
509 Ga0207711_10597611
510 Ga0207689_10000178
511 Ga0207661_10015899
512 Ga0207661_10252087
513 Ga0207661_10411694
514 Ga0207679_10256863
515 Ga0207679_10363052
516 Ga0207667_10106677
517 Ga0207651_10082999
518 Ga0207651_10306637
519 Ga0207651_10382209
520 Ga0207712_10008948
521 Ga0207668_10048950
522 Ga0207658_11139282
523 Ga0207677_10004375
524 Ga0207677_10108055
525 Ga0207703_10454613
526 Ga0207708_10215869
527 Ga0207641_10449195
528 Ga0207648_10568309
529 Ga0207676_10045503
530 Ga0207674_10000096
531 Ga0207675_100032195
532 Ga0209969_1005496
533 Ga0209981_1011949
534 Ga0209984_1010154
535 Ga0210000_1053012
536 Ga0209968_1011667
537 Ga0209999_1019548
538 Ga0209966_1002267
539 Ga0209974_10018496
540 Ga0209974_10031317
541 Ga0268265_10002696
542 Ga0268264_10495193
543 Ga0307408_100024643
544 Ga0307408_100324864
545 Ga0307405_10061389
546 Ga0307405_10210833
547 Ga0307405_10224219
548 Ga0307405_10718690
549 Ga0307413_10072245
550 Ga0307413_10145294
551 Ga0307413_10301911
552 Ga0307413_10391381
553 Ga0307413_10536636
554 Ga0307410_10146397
555 Ga0307410_10208646
556 Ga0307410_10266438
557 Ga0307410_10300326
558 Ga0307410_10441655
559 Ga0307410_11048310
560 Ga0307406_10037810
561 Ga0307406_10106573
562 Ga0307406_10768350
563 Ga0307407_10050430
564 Ga0307407_10253763
565 Ga0307412_10143424
566 Ga0307412_10159199
567 Ga0307412_10221349
568 Ga0307409_100066924
569 Ga0307409_100226842
570 Ga0307409_100249746
571 Ga0307409_100476139
572 Ga0307409_100599593
573 Ga0307416_100052140
574 Ga0307416_100058205
575 Ga0307416_100317967
576 Ga0307416_100421172
577 Ga0307416_100493326
578 Ga0307416_100527109
579 Ga0307416_100719595
580 Ga0307416_101737622
581 Ga0307414_10122606
582 Ga0307414_10157730
583 Ga0307414_10279412
584 Ga0307411_10034755
585 Ga0307411_10043492
586 Ga0307411_10061626
587 Ga0307411_10065677
588 Ga0307411_10098092
589 Ga0307411_10106432
590 Ga0307415_100020040
591 Ga0307415_100041687
592 Ga0307415_100282238
593 Ga0307415_100294945
594 Ga0307415_100365336
595 Ga0307415_100541489
596 Ga0307415_100729617
597 Ga0373928_0073780
598 Ga0373932_0015685
599 Ga0373941_0008508
600 Ga0373927_0465975
601 Ga0395905_0191900
602 Ga0395905_0238173
603 Ga0242419_001431
604 Ga0242420_014198
605 Ga0439435_0189248
606 Ga0466966_0155269
607 Ga0466960_0488923
608 Ga0466959_0038572
609 Ga0466959_0256212
610 Ga0466959_0470613
611 Ga0466959_0560300
612 Ga0451576_0438363
613 Ga0451576_0458372
614 Ga0466958_0147304
615 Ga0495603_0068395
616 Ga0495594_0562089
617 Ga0495622_0132788
618 Ga0495669_0113726
619 Ga0496100_0357212
620 Ga0496102_0492204
621 Ga0496102_1219826
622 Ga0496104_0752004
623 Ga0496104_0901027
624 Ga0496106_0089698
625 Ga0496106_0601382
626 Ga0496108_0014996
627 Ga0496109_0144565
628 Ga0496110_0278069
629 Ga0496111_0240448
630 Ga0496112_0000926
631 Ga0496112_0103532
632 Ga0496113_0035864
633 Ga0496114_0547291
634 Ga0501291_012527
635 Ga0501031_0170747
636 Ga0501036_0140677
637 Ga0501040_0007644
638 Ga0501040_0669189
639 Ga0501042_0048601
640 Ga0501042_0121979
641 Ga0501048_0035413
642 Ga0501067_0120109
643 Ga0501067_0388120
644 Ga0501069_0087089
645 Ga0501071_0117681
646 Ga0501075_0095833
647 Ga0501075_0132573
648 Ga0501217_017387
649 Ga0501230_013321
650 Ga0501230_044255
651 Ga0501233_010281
652 Ga0501235_002649
653 Ga0501235_031922
654 Ga0501239_011669
655 Ga0501242_005806
656 Ga0501243_002280
657 Ga0501252_010293
658 Ga0501253_006669
659 Ga0501260_005003
660 Ga0501261_015746
661 Ga0501221_003352
662 Ga0501225_0000530
663 Ga0501079_0279929
664 Ga0501079_0524861
665 Ga0501263_004958
666 Ga0501266_010579
667 Ga0501268_077041
668 Ga0501270_031061
669 Ga0501270_051022
670 Ga0501045_0038390
671 nmdc:mga05p37_1183131_c1
672 nmdc:mga05p37_512833_c1
673 nmdc:mga09592_280065_c1
674 nmdc:mga09592_674110_c1
675 nmdc:mga0qj67_172147_c1
676 nmdc:mga0qj67_18870_c1
677 nmdc:mga0qj67_93190_c1
678 nmdc:mga06r32_119064_c1
679 nmdc:mga06r32_137300_c1
680 nmdc:mga06r32_493109_c1
681 nmdc:mga08y16_248174_c1
682 nmdc:mga08y16_560426_c1
683 nmdc:mga08y16_73223_c1
684 nmdc:mga0n895_100379_c1
685 nmdc:mga0n895_42525_c1
686 nmdc:mga0rr50_182459_c1
687 nmdc:mga0a205_80391_c1
688 nmdc:mga0a205_96014_c1
689 Ga0501084_0899909
690 Ga0590071_067438
691 Ga0587073_0012763
692 Ga0587083_0034304
693 Ga0587088_067129
694 Ga0587113_004488
695 Ga0587115_010429
696 Ga0587128_043430
697 Ga0587114_007986
698 Ga0501082_0290076

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04264

YceI

YceI-like domain

46

216

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bwl-assembly1.cif.gz_A structure of antibiotic sequester from pseudomonas aerurinosa 0.8964 13 187
1wub-assembly1.cif.gz_A crystal structure of the polyisoprenoid-binding protein, tt1927b, from thermus thermophilus hb8 0.8951 13 185
7bwl-assembly1.cif.gz_A structure of antibiotic sequester from pseudomonas aerurinosa 0.8862 13 187
5ixh-assembly1.cif.gz_A crystal structure of burkholderia cenocepacia bcna 0.878 16 183
1y0g-assembly2.cif.gz_D crystal structure of the escherichia coli ycei protein, structural genomics 0.8757 13 188
ID Description Score Start End Superfamily
1wubA00 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.8951 13 185 2.40.128.110
af_Q2FUS9_3_167_2.40.128.110 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.8913 16 184 2.40.128.110
5w2dA01 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.885 32 188 2.40.128.110
af_P0A8X2_23_191_2.40.128.110 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.8811 13 188 2.40.128.110
5w2dA01 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.8794 32 188 2.40.128.110
ID Description Score Start End GO Terms
AF-A0A4Q5VFD1-F1-model_v4 Polyisoprenoid-binding protein 0.9444 13 187
AF-A0A6C1NND6-F1-model_v4 Polyisoprenoid-binding protein 0.9406 11 189
AF-A0A6S7B8X8-F1-model_v4 Protein YceI 0.936 11 188
AF-A0A848X5E5-F1-model_v4 YceI family protein 0.9349 11 189
AF-A0A2G2QWN1-F1-model_v4 Polyisoprenoid-binding protein 0.9312 11 188

Map