F417795

General Info

Members Datasets Scaffolds Average Seq Length
349 182 698 208

Family's Representative Sequence

Representative Sequence 3300005337|Ga0070682_100165017|Ga0070682_1001650172
Length 250
Sequence MYCRGRPSVAALGWTRDSRSDGFGFGEHDLNQGLPRRAAPTVRMTLIKICGITNLDDAVAAVAAGADALGFNFYKPSPRYITPQSAREIIEQLPVSVLKVGVFVNEELGIVRTITAEAGLTALQLHGDESPAYCSKLVNQYVIKVLAVSDDFDRQLPKRYQVQAIMLDTKHNKLRGGTGRAFNWCVAQQVSKVVPRLYLAGGLSPENVAEAIETVRPYAVDACSSLEDQPGTKNHDRMHAFITEVKSVKP

Samples

Sample ID Description Type Environment
1 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
114 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
117 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
118 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
119 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
120 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
121 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
122 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
123 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
124 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
125 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
126 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
127 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
128 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
129 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
130 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
131 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
132 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
133 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
134 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
135 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
136 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
137 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
138 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
139 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
140 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
141 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
142 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
143 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
144 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
145 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
147 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
148 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
149 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
150 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
151 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
152 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
153 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
154 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
155 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
156 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
157 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
158 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
159 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
160 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
161 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
162 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
163 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
164 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
165 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
166 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
167 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
168 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
169 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
170 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
171 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
172 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
173 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
174 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
175 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
176 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
177 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
178 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
179 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
180 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
181 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
182 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.86
Rhizosphere 98.28
Stem 0
Stem Tuber 0
Unclassified 19.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070682_100165017 3300005337 Bacteria 1533
2 MRS1b_contig_7356293 2162886011 Unclassified 1252
3 JGI24751J29686_10000074 3300002459 Bacteria 56035
4 rootL2_10219792 3300003322 Bacteria 2654
5 rootL2_10253393 3300003322 Unclassified 1469
6 Ga0065714_10064450 3300005288 Bacteria 77548
7 Ga0065704_10004492 3300005289 Bacteria 4390
8 Ga0065712_10005483 3300005290 Bacteria 3903
9 Ga0065712_10006759 3300005290 Unclassified 2543
10 Ga0065712_10067784 3300005290 Bacteria 36245
11 Ga0065712_10192134 3300005290 Unclassified 1144
12 Ga0065715_10090331 3300005293 Bacteria 7198
13 Ga0065715_10105114 3300005293 Bacteria 2866
14 Ga0065715_10155908 3300005293 Bacteria 1678
15 Ga0065715_10175824 3300005293 Bacteria 1512
16 Ga0065707_10001423 3300005295 Bacteria 6610
17 Ga0070670_100001763 3300005331 Bacteria 17603
18 Ga0070670_100103284 3300005331 Bacteria 2455
19 Ga0070670_100194125 3300005331 Bacteria 1764
20 Ga0068869_100382633 3300005334 Bacteria 1153
21 Ga0068869_100495885 3300005334 Bacteria 1019
22 Ga0070680_100198410 3300005336 Bacteria 1692
23 Ga0070680_101000513 3300005336 Unclassified 722
24 Ga0068868_100949091 3300005338 Unclassified 784
25 Ga0070689_100002181 3300005340 Bacteria 12680
26 Ga0070687_100041970 3300005343 Bacteria 2315
27 Ga0070692_10132705 3300005345 Bacteria 1401
28 Ga0070668_100110739 3300005347 Bacteria 2185
29 Ga0070673_100151409 3300005364 Bacteria 1965
30 Ga0070673_100160781 3300005364 Bacteria 1910
31 Ga0070688_100210000 3300005365 Unclassified 1366
32 Ga0070701_10102598 3300005438 Bacteria 1587
33 Ga0070701_10114323 3300005438 Bacteria 1512
34 Ga0070705_100008995 3300005440 Bacteria 4957
35 Ga0070705_100269067 3300005440 Bacteria 1206
36 Ga0070700_100000392 3300005441 Bacteria 22584
37 Ga0070700_100066274 3300005441 Bacteria 2292
38 Ga0070700_100269671 3300005441 Bacteria 1229
39 Ga0070694_100008672 3300005444 Bacteria 6227
40 Ga0070694_100056146 3300005444 Bacteria 2674
41 Ga0070694_100096533 3300005444 Bacteria 2084
42 Ga0070694_100102419 3300005444 Bacteria 2027
43 Ga0070662_100656103 3300005457 Unclassified 885
44 Ga0068867_100051937 3300005459 Bacteria 3024
45 Ga0068867_100059559 3300005459 Unclassified 2831
46 Ga0068867_100489291 3300005459 Bacteria 1055
47 Ga0070706_100000044 3300005467 Bacteria 146303
48 Ga0070698_100728882 3300005471 Unclassified 934
49 Ga0070699_100000990 3300005518 Bacteria 26429
50 Ga0070699_100262679 3300005518 Bacteria 1544
51 Ga0070679_100051616 3300005530 Bacteria 4096
52 Ga0070696_100097147 3300005546 Bacteria 2106
53 Ga0070696_100208140 3300005546 Bacteria 1463
54 Ga0070696_100407598 3300005546 Unclassified 1065
55 Ga0070693_100022009 3300005547 Bacteria 3383
56 Ga0070693_100092468 3300005547 Bacteria 1826
57 Ga0070693_100232319 3300005547 Bacteria 1214
58 Ga0068855_100140011 3300005563 Bacteria 2759
59 Ga0070664_100205463 3300005564 Unclassified 1759
60 Ga0068857_100443035 3300005577 Bacteria 1213
61 Ga0068857_100570745 3300005577 Bacteria 1067
62 Ga0068854_100052646 3300005578 Unclassified 2920
63 Ga0068854_100289799 3300005578 Bacteria 1321
64 Ga0068854_100516423 3300005578 Bacteria 1008
65 Ga0068854_100538238 3300005578 Bacteria 989
66 Ga0070702_100022124 3300005615 Bacteria 3356
67 Ga0070702_100072851 3300005615 Unclassified 2033
68 Ga0068852_100397079 3300005616 Bacteria 1356
69 Ga0068852_101055508 3300005616 Bacteria 832
70 Ga0068859_100067620 3300005617 Bacteria 3607
71 Ga0068859_100074471 3300005617 Unclassified 3434
72 Ga0068859_100085182 3300005617 Unclassified 3206
73 Ga0068859_100095500 3300005617 Bacteria 3025
74 Ga0068859_100096069 3300005617 Bacteria 3016
75 Ga0068859_100119134 3300005617 Bacteria 2706
76 Ga0068859_100168200 3300005617 Bacteria 2272
77 Ga0068864_100015017 3300005618 Bacteria 6437
78 Ga0068864_100050554 3300005618 Bacteria 3578
79 Ga0068864_100529950 3300005618 Bacteria 1136
80 Ga0068851_10018018 3300005834 Bacteria 3399
81 Ga0068870_10147286 3300005840 Bacteria 1383
82 Ga0068863_100039386 3300005841 Bacteria 4497
83 Ga0068863_100257817 3300005841 Bacteria 1685
84 Ga0068863_100316776 3300005841 Bacteria 1515
85 Ga0068858_100020225 3300005842 Bacteria 6225
86 Ga0068858_100097001 3300005842 Bacteria 2747
87 Ga0068858_100109624 3300005842 Unclassified 2577
88 Ga0068858_100152716 3300005842 Unclassified 2171
89 Ga0068858_100195064 3300005842 Bacteria 1914
90 Ga0068860_100043060 3300005843 Bacteria 4309
91 Ga0068860_100054119 3300005843 Bacteria 3815
92 Ga0068860_100307008 3300005843 Bacteria 1555
93 Ga0068860_100635731 3300005843 Bacteria 1074
94 Ga0068860_100670932 3300005843 Unclassified 1045
95 Ga0068862_100059449 3300005844 Bacteria 3282
96 Ga0068862_100398853 3300005844 Unclassified 1286
97 Ga0068862_100743195 3300005844 Bacteria 954
98 Ga0070716_100043069 3300006173 Bacteria 2522
99 Ga0097621_100130290 3300006237 Bacteria 2141
100 Ga0068871_100653922 3300006358 Bacteria 960
101 Ga0075428_100290495 3300006844 Unclassified 1759
102 Ga0075428_100720093 3300006844 Bacteria 1063
103 Ga0075430_100338320 3300006846 Unclassified 1243
104 Ga0075430_100400740 3300006846 Bacteria 1133
105 Ga0075433_10058043 3300006852 Bacteria 3384
106 Ga0075433_10095662 3300006852 Unclassified 2628
107 Ga0075434_100076047 3300006871 Bacteria 3352
108 Ga0075434_101039001 3300006871 Bacteria 833
109 Ga0097620_100067619 3300006931 Bacteria 3607
110 Ga0097620_100074473 3300006931 Unclassified 3434
111 Ga0097620_100085180 3300006931 Unclassified 3206
112 Ga0097620_100095496 3300006931 Bacteria 3025
113 Ga0097620_100096069 3300006931 Bacteria 3016
114 Ga0097620_100119134 3300006931 Bacteria 2706
115 Ga0097620_100168207 3300006931 Bacteria 2272
116 Ga0105251_10236722 3300009011 Bacteria 822
117 Ga0105240_10113336 3300009093 Bacteria 3277
118 Ga0105240_10770585 3300009093 Bacteria 1044
119 Ga0111539_10003046 3300009094 Bacteria 22201
120 Ga0111539_10025223 3300009094 Bacteria 7288
121 Ga0111539_10322466 3300009094 Bacteria 1798
122 Ga0105247_10075706 3300009101 Bacteria 2113
123 Ga0105247_10302853 3300009101 Bacteria 1109
124 Ga0114129_10003346 3300009147 Bacteria 22523
125 Ga0114129_10032380 3300009147 Bacteria 7388
126 Ga0114129_10279559 3300009147 Bacteria 2230
127 Ga0114129_10482008 3300009147 Bacteria 1623
128 Ga0114129_10493017 3300009147 Bacteria 1601
129 Ga0114129_10746963 3300009147 Bacteria 1253
130 Ga0114129_10985486 3300009147 Bacteria 1062
131 Ga0105243_10017500 3300009148 Bacteria 5419
132 Ga0105243_10027472 3300009148 Bacteria 4361
133 Ga0105243_10281002 3300009148 Bacteria 1499
134 Ga0105243_10305620 3300009148 Bacteria 1443
135 Ga0105243_10306750 3300009148 Unclassified 1441
136 Ga0105241_10119416 3300009174 Bacteria 2121
137 Ga0105241_10294001 3300009174 Bacteria 1392
138 Ga0105241_10451260 3300009174 Bacteria 1137
139 Ga0105241_10476127 3300009174 Unclassified 1109
140 Ga0105241_10754935 3300009174 Bacteria 892
141 Ga0105242_10045282 3300009176 Bacteria 3565
142 Ga0105248_10010497 3300009177 Bacteria 10200
143 Ga0105248_10045575 3300009177 Bacteria 4916
144 Ga0105248_10100955 3300009177 Bacteria 3252
145 Ga0105248_10113469 3300009177 Bacteria 3056
146 Ga0105248_10125287 3300009177 Bacteria 2898
147 Ga0105248_10279700 3300009177 Bacteria 1879
148 Ga0105248_10467976 3300009177 Bacteria 1421
149 Ga0105248_10911241 3300009177 Unclassified 993
150 Ga0105237_10001285 3300009545 Bacteria 33426
151 Ga0105237_10152397 3300009545 Bacteria 2308
152 Ga0105238_10021636 3300009551 Bacteria 6551
153 Ga0105249_10000369 3300009553 Bacteria 44503
154 Ga0105249_10069864 3300009553 Bacteria 3242
155 Ga0105249_10822737 3300009553 Unclassified 993
156 Ga0105249_11028973 3300009553 Bacteria 893
157 Ga0105239_10974227 3300010375 Bacteria 975
158 Ga0105246_10218951 3300011119 Bacteria 1491
159 Ga0105246_10442992 3300011119 Bacteria 1090
160 Ga0105246_10590955 3300011119 Bacteria 958
161 Ga0157373_10030235 3300013100 Bacteria 3897
162 Ga0157373_10097556 3300013100 Bacteria 2069
163 Ga0163162_10000019 3300013306 Bacteria 220603
164 Ga0163162_10170776 3300013306 Bacteria 2299
165 Ga0157372_10016718 3300013307 Bacteria 7875
166 Ga0157372_10661754 3300013307 Bacteria 1216
167 Ga0157372_10906626 3300013307 Bacteria 1023
168 Ga0157375_10304284 3300013308 Bacteria 1758
169 Ga0163163_10000773 3300014325 Bacteria 27136
170 Ga0163163_10053429 3300014325 Bacteria 3987
171 Ga0163163_10086541 3300014325 Bacteria 3143
172 Ga0163163_10957317 3300014325 Bacteria 919
173 Ga0157380_10090626 3300014326 Bacteria 2523
174 Ga0157380_10465037 3300014326 Bacteria 1219
175 Ga0157380_10508333 3300014326 Bacteria 1172
176 Ga0157380_10518471 3300014326 Unclassified 1162
177 Ga0157377_10031526 3300014745 Bacteria 2881
178 Ga0157377_10663637 3300014745 Bacteria 752
179 Ga0157379_10148376 3300014968 Bacteria 2115
180 Ga0157379_10439735 3300014968 Bacteria 1202
181 Ga0157379_10594533 3300014968 Bacteria 1032
182 Ga0207656_10007246 3300025321 Bacteria 4030
183 Ga0207653_10000852 3300025885 Bacteria 10185
184 Ga0207710_10001033 3300025900 Bacteria 14417
185 Ga0207710_10151260 3300025900 Bacteria 1126
186 Ga0207647_10166245 3300025904 Bacteria 1286
187 Ga0207645_10017803 3300025907 Bacteria 4684
188 Ga0207643_10001012 3300025908 Bacteria 16739
189 Ga0207684_10000085 3300025910 Bacteria 175922
190 Ga0207654_10074050 3300025911 Bacteria 2031
191 Ga0207707_10202102 3300025912 Unclassified 1732
192 Ga0207695_10221521 3300025913 Bacteria 1799
193 Ga0207671_10008344 3300025914 Bacteria 8796
194 Ga0207694_10019645 3300025924 Bacteria 5111
195 Ga0207650_10000028 3300025925 Bacteria 236867
196 Ga0207650_10073641 3300025925 Bacteria 2573
197 Ga0207659_10457156 3300025926 Bacteria 1076
198 Ga0207686_10378896 3300025934 Unclassified 1072
199 Ga0207709_10032322 3300025935 Bacteria 3063
200 Ga0207709_10107569 3300025935 Bacteria 1857
201 Ga0207709_10372362 3300025935 Bacteria 1084
202 Ga0207670_10006139 3300025936 Bacteria 6646
203 Ga0207665_10029516 3300025939 Bacteria 3625
204 Ga0207691_10223030 3300025940 Bacteria 1634
205 Ga0207711_10006211 3300025941 Bacteria 10089
206 Ga0207711_10014080 3300025941 Bacteria 6644
207 Ga0207711_10175938 3300025941 Bacteria 1944
208 Ga0207711_10204553 3300025941 Unclassified 1802
209 Ga0207711_10390803 3300025941 Bacteria 1291
210 Ga0207711_10470315 3300025941 Unclassified 1171
211 Ga0207689_10099202 3300025942 Bacteria 2393
212 Ga0207689_10320105 3300025942 Bacteria 1287
213 Ga0207679_10236028 3300025945 Bacteria 1547
214 Ga0207667_10142490 3300025949 Unclassified 2468
215 Ga0207651_10131840 3300025960 Bacteria 1915
216 Ga0207712_10002100 3300025961 Bacteria 13049
217 Ga0207712_10003678 3300025961 Bacteria 9671
218 Ga0207668_10003574 3300025972 Bacteria 9133
219 Ga0207640_10210216 3300025981 Bacteria 1482
220 Ga0207640_10457808 3300025981 Bacteria 1053
221 Ga0207677_10442118 3300026023 Bacteria 1112
222 Ga0207703_10179820 3300026035 Bacteria 1866
223 Ga0207703_10223945 3300026035 Bacteria 1683
224 Ga0207703_10240146 3300026035 Bacteria 1628
225 Ga0207703_10558572 3300026035 Bacteria 1080
226 Ga0207639_10268792 3300026041 Bacteria 1495
227 Ga0207639_10345533 3300026041 Bacteria 1327
228 Ga0207708_10000426 3300026075 Bacteria 32859
229 Ga0207708_10008143 3300026075 Bacteria 7763
230 Ga0207708_10064570 3300026075 Bacteria 2797
231 Ga0207708_10091505 3300026075 Bacteria 2346
232 Ga0207708_10503674 3300026075 Bacteria 1015
233 Ga0207641_10306997 3300026088 Bacteria 1500
234 Ga0207641_10407928 3300026088 Bacteria 1306
235 Ga0207648_10090807 3300026089 Unclassified 2669
236 Ga0207648_10220661 3300026089 Bacteria 1685
237 Ga0207648_10262564 3300026089 Bacteria 1541
238 Ga0207676_10040057 3300026095 Bacteria 3588
239 Ga0207676_10132487 3300026095 Bacteria 2122
240 Ga0207674_10199347 3300026116 Bacteria 1951
241 Ga0207674_10306508 3300026116 Bacteria 1537
242 Ga0207674_10360549 3300026116 Bacteria 1405
243 Ga0207675_100984130 3300026118 Bacteria 862
244 Ga0207698_10301404 3300026142 Bacteria 1492
245 Ga0207698_10573816 3300026142 Unclassified 1109
246 Ga0207428_10013038 3300027907 Bacteria 7279
247 Ga0207428_10085292 3300027907 Bacteria 2460
248 Ga0268265_10402291 3300028380 Bacteria 1266
249 Ga0268265_10507237 3300028380 Unclassified 1138
250 Ga0268264_10110633 3300028381 Unclassified 2405
251 Ga0268264_11224824 3300028381 Bacteria 760
252 Ga0307513_10062851 3300031456 Unclassified 3922
253 Ga0307408_100001988 3300031548 Bacteria 14764
254 Ga0307408_100178034 3300031548 Bacteria 1703
255 Ga0307408_100462489 3300031548 Unclassified 1103
256 Ga0307413_10018256 3300031824 Bacteria 3675
257 Ga0307410_10005343 3300031852 Bacteria 6788
258 Ga0307410_10684495 3300031852 Unclassified 863
259 Ga0307406_10002653 3300031901 Bacteria 9745
260 Ga0307412_10022397 3300031911 Bacteria 3872
261 Ga0307412_10221657 3300031911 Unclassified 1450
262 Ga0307412_10232199 3300031911 Bacteria 1421
263 Ga0307412_10655495 3300031911 Unclassified 896
264 Ga0307409_100136152 3300031995 Bacteria 2108
265 Ga0307416_100017446 3300032002 Bacteria 5025
266 Ga0307416_101131478 3300032002 Unclassified 888
267 Ga0307416_101202578 3300032002 Unclassified 863
268 Ga0307414_10012380 3300032004 Bacteria 5041
269 Ga0307414_10092760 3300032004 Bacteria 2249
270 Ga0307414_10301453 3300032004 Bacteria 1356
271 Ga0307411_10128163 3300032005 Bacteria 1850
272 Ga0307415_100000724 3300032126 Bacteria 14783
273 Ga0373949_0094613 3300035090 Unclassified 812
274 Ga0373952_0066194 3300035092 Unclassified 894
275 Ga0373942_0006681 3300035207 Bacteria 2664
276 Ga0373931_0025286 3300035691 Bacteria 3016
277 Ga0395900_0141062 3300037418 Unclassified 2468
278 Ga0395898_0192883 3300037466 Bacteria 1947
279 Ga0395898_0254388 3300037466 Bacteria 1675
280 Ga0395898_0550645 3300037466 Bacteria 1096
281 Ga0395905_0293356 3300037471 Bacteria 1513
282 Ga0395901_0256551 3300038443 Bacteria 1821
283 Ga0395901_0378304 3300038443 Bacteria 1458
284 Ga0439448_0079554 3300042005 Bacteria 1099
285 Ga0439458_0004465 3300042157 Bacteria 3209
286 Ga0451576_0496842 3300045051 Unclassified 1282
287 Ga0495604_0031095 3300047317 Bacteria 4237
288 Ga0496108_0273975 3300048911 Unclassified 1469
289 Ga0496112_0095133 3300048915 Bacteria 2950
290 Ga0496112_0136401 3300048915 Bacteria 2424
291 Ga0501291_006068 3300049514 Bacteria 1600
292 Ga0501292_015749 3300049515 Unclassified 1184
293 Ga0501293_009015 3300049516 Unclassified 846
294 Ga0501298_003068 3300049521 Unclassified 2576
295 Ga0501298_047497 3300049521 Unclassified 883
296 Ga0501038_0002266 3300049574 Bacteria 17902
297 Ga0501198_000495 3300049649 Bacteria 4895
298 Ga0501199_008406 3300049650 Bacteria 1080
299 Ga0501206_007786 3300049653 Bacteria 1409
300 Ga0501207_000133 3300049654 Bacteria 6668
301 Ga0501207_023280 3300049654 Bacteria 1004
302 Ga0501217_012646 3300049661 Bacteria 1883
303 Ga0501217_013625 3300049661 Bacteria 1827
304 Ga0501223_000326 3300049663 Bacteria 11788
305 Ga0501223_009341 3300049663 Unclassified 1989
306 Ga0501224_004181 3300049664 Bacteria 2040
307 Ga0501227_013489 3300049665 Bacteria 1800
308 Ga0501230_018537 3300049667 Bacteria 1189
309 Ga0501233_010771 3300049668 Bacteria 1807
310 Ga0501233_011906 3300049668 Bacteria 1737
311 Ga0501235_006021 3300049669 Bacteria 2640
312 Ga0501238_033858 3300049671 Unclassified 742
313 Ga0501240_020506 3300049673 Unclassified 990
314 Ga0501249_009889 3300049679 Bacteria 1987
315 Ga0501250_013297 3300049680 Bacteria 985
316 Ga0501253_015685 3300049683 Bacteria 1249
317 Ga0501253_031558 3300049683 Unclassified 1014
318 Ga0501256_001925 3300049685 Bacteria 1602
319 Ga0501257_003792 3300049686 Bacteria 3267
320 Ga0501261_012002 3300049690 Bacteria 1161
321 Ga0501219_006307 3300049703 Unclassified 849
322 Ga0501221_003156 3300049704 Unclassified 2709
323 Ga0501225_0007702 3300049705 Bacteria 3118
324 Ga0501225_0082470 3300049705 Bacteria 924
325 Ga0501229_002162 3300049706 Bacteria 2307
326 Ga0501234_007033 3300049707 Bacteria 1762
327 Ga0501234_032148 3300049707 Unclassified 849
328 Ga0501245_032179 3300049708 Unclassified 871
329 Ga0501265_004310 3300049762 Bacteria 1620
330 Ga0501268_032390 3300049765 Unclassified 952
331 Ga0501283_006285 3300049779 Bacteria 1660
332 Ga0501204_010258 3300049850 Bacteria 1096
333 Ga0501212_012672 3300049851 Bacteria 1229
334 Ga0501226_001895 3300049853 Bacteria 2620
335 nmdc:mga05p37_227989_c1 3300050507 Unclassified 2246
336 nmdc:mga05p37_89423_c1 3300050507 Bacteria 3795
337 nmdc:mga05p37_992089_c1 3300050507 Unclassified 893
338 nmdc:mga0qj67_339339_c1 3300050509 Bacteria 1215
339 nmdc:mga0qj67_698474_c1 3300050509 Unclassified 807
340 nmdc:mga06r32_287816_c1 3300050510 Bacteria 1630
341 nmdc:mga08y16_29165_c1 3300050511 Bacteria 5815
342 nmdc:mga08y16_8236_c1 3300050511 Bacteria 10905
343 nmdc:mga08y16_95628_c1 3300050511 Bacteria 3094
344 nmdc:mga0n895_190845_c1 3300050512 Unclassified 2080
345 nmdc:mga0n895_193093_c1 3300050512 Bacteria 2067
346 nmdc:mga0a205_125121_c1 3300050515 Bacteria 2470
347 nmdc:mga0a205_395193_c1 3300050515 Bacteria 1247
348 nmdc:mga0a205_602206_c1 3300050515 Unclassified 952
349 nmdc:mga0a205_672658_c1 3300050515 Bacteria 886
350 Ga0070682_100165017
351 MRS1b_contig_7356293
352 JGI24751J29686_10000074
353 rootL2_10219792
354 rootL2_10253393
355 Ga0065714_10064450
356 Ga0065704_10004492
357 Ga0065712_10005483
358 Ga0065712_10006759
359 Ga0065712_10067784
360 Ga0065712_10192134
361 Ga0065715_10090331
362 Ga0065715_10105114
363 Ga0065715_10155908
364 Ga0065715_10175824
365 Ga0065707_10001423
366 Ga0070670_100001763
367 Ga0070670_100103284
368 Ga0070670_100194125
369 Ga0068869_100382633
370 Ga0068869_100495885
371 Ga0070680_100198410
372 Ga0070680_101000513
373 Ga0068868_100949091
374 Ga0070689_100002181
375 Ga0070687_100041970
376 Ga0070692_10132705
377 Ga0070668_100110739
378 Ga0070673_100151409
379 Ga0070673_100160781
380 Ga0070688_100210000
381 Ga0070701_10102598
382 Ga0070701_10114323
383 Ga0070705_100008995
384 Ga0070705_100269067
385 Ga0070700_100000392
386 Ga0070700_100066274
387 Ga0070700_100269671
388 Ga0070694_100008672
389 Ga0070694_100056146
390 Ga0070694_100096533
391 Ga0070694_100102419
392 Ga0070662_100656103
393 Ga0068867_100051937
394 Ga0068867_100059559
395 Ga0068867_100489291
396 Ga0070706_100000044
397 Ga0070698_100728882
398 Ga0070699_100000990
399 Ga0070699_100262679
400 Ga0070679_100051616
401 Ga0070696_100097147
402 Ga0070696_100208140
403 Ga0070696_100407598
404 Ga0070693_100022009
405 Ga0070693_100092468
406 Ga0070693_100232319
407 Ga0068855_100140011
408 Ga0070664_100205463
409 Ga0068857_100443035
410 Ga0068857_100570745
411 Ga0068854_100052646
412 Ga0068854_100289799
413 Ga0068854_100516423
414 Ga0068854_100538238
415 Ga0070702_100022124
416 Ga0070702_100072851
417 Ga0068852_100397079
418 Ga0068852_101055508
419 Ga0068859_100067620
420 Ga0068859_100074471
421 Ga0068859_100085182
422 Ga0068859_100095500
423 Ga0068859_100096069
424 Ga0068859_100119134
425 Ga0068859_100168200
426 Ga0068864_100015017
427 Ga0068864_100050554
428 Ga0068864_100529950
429 Ga0068851_10018018
430 Ga0068870_10147286
431 Ga0068863_100039386
432 Ga0068863_100257817
433 Ga0068863_100316776
434 Ga0068858_100020225
435 Ga0068858_100097001
436 Ga0068858_100109624
437 Ga0068858_100152716
438 Ga0068858_100195064
439 Ga0068860_100043060
440 Ga0068860_100054119
441 Ga0068860_100307008
442 Ga0068860_100635731
443 Ga0068860_100670932
444 Ga0068862_100059449
445 Ga0068862_100398853
446 Ga0068862_100743195
447 Ga0070716_100043069
448 Ga0097621_100130290
449 Ga0068871_100653922
450 Ga0075428_100290495
451 Ga0075428_100720093
452 Ga0075430_100338320
453 Ga0075430_100400740
454 Ga0075433_10058043
455 Ga0075433_10095662
456 Ga0075434_100076047
457 Ga0075434_101039001
458 Ga0097620_100067619
459 Ga0097620_100074473
460 Ga0097620_100085180
461 Ga0097620_100095496
462 Ga0097620_100096069
463 Ga0097620_100119134
464 Ga0097620_100168207
465 Ga0105251_10236722
466 Ga0105240_10113336
467 Ga0105240_10770585
468 Ga0111539_10003046
469 Ga0111539_10025223
470 Ga0111539_10322466
471 Ga0105247_10075706
472 Ga0105247_10302853
473 Ga0114129_10003346
474 Ga0114129_10032380
475 Ga0114129_10279559
476 Ga0114129_10482008
477 Ga0114129_10493017
478 Ga0114129_10746963
479 Ga0114129_10985486
480 Ga0105243_10017500
481 Ga0105243_10027472
482 Ga0105243_10281002
483 Ga0105243_10305620
484 Ga0105243_10306750
485 Ga0105241_10119416
486 Ga0105241_10294001
487 Ga0105241_10451260
488 Ga0105241_10476127
489 Ga0105241_10754935
490 Ga0105242_10045282
491 Ga0105248_10010497
492 Ga0105248_10045575
493 Ga0105248_10100955
494 Ga0105248_10113469
495 Ga0105248_10125287
496 Ga0105248_10279700
497 Ga0105248_10467976
498 Ga0105248_10911241
499 Ga0105237_10001285
500 Ga0105237_10152397
501 Ga0105238_10021636
502 Ga0105249_10000369
503 Ga0105249_10069864
504 Ga0105249_10822737
505 Ga0105249_11028973
506 Ga0105239_10974227
507 Ga0105246_10218951
508 Ga0105246_10442992
509 Ga0105246_10590955
510 Ga0157373_10030235
511 Ga0157373_10097556
512 Ga0163162_10000019
513 Ga0163162_10170776
514 Ga0157372_10016718
515 Ga0157372_10661754
516 Ga0157372_10906626
517 Ga0157375_10304284
518 Ga0163163_10000773
519 Ga0163163_10053429
520 Ga0163163_10086541
521 Ga0163163_10957317
522 Ga0157380_10090626
523 Ga0157380_10465037
524 Ga0157380_10508333
525 Ga0157380_10518471
526 Ga0157377_10031526
527 Ga0157377_10663637
528 Ga0157379_10148376
529 Ga0157379_10439735
530 Ga0157379_10594533
531 Ga0207656_10007246
532 Ga0207653_10000852
533 Ga0207710_10001033
534 Ga0207710_10151260
535 Ga0207647_10166245
536 Ga0207645_10017803
537 Ga0207643_10001012
538 Ga0207684_10000085
539 Ga0207654_10074050
540 Ga0207707_10202102
541 Ga0207695_10221521
542 Ga0207671_10008344
543 Ga0207694_10019645
544 Ga0207650_10000028
545 Ga0207650_10073641
546 Ga0207659_10457156
547 Ga0207686_10378896
548 Ga0207709_10032322
549 Ga0207709_10107569
550 Ga0207709_10372362
551 Ga0207670_10006139
552 Ga0207665_10029516
553 Ga0207691_10223030
554 Ga0207711_10006211
555 Ga0207711_10014080
556 Ga0207711_10175938
557 Ga0207711_10204553
558 Ga0207711_10390803
559 Ga0207711_10470315
560 Ga0207689_10099202
561 Ga0207689_10320105
562 Ga0207679_10236028
563 Ga0207667_10142490
564 Ga0207651_10131840
565 Ga0207712_10002100
566 Ga0207712_10003678
567 Ga0207668_10003574
568 Ga0207640_10210216
569 Ga0207640_10457808
570 Ga0207677_10442118
571 Ga0207703_10179820
572 Ga0207703_10223945
573 Ga0207703_10240146
574 Ga0207703_10558572
575 Ga0207639_10268792
576 Ga0207639_10345533
577 Ga0207708_10000426
578 Ga0207708_10008143
579 Ga0207708_10064570
580 Ga0207708_10091505
581 Ga0207708_10503674
582 Ga0207641_10306997
583 Ga0207641_10407928
584 Ga0207648_10090807
585 Ga0207648_10220661
586 Ga0207648_10262564
587 Ga0207676_10040057
588 Ga0207676_10132487
589 Ga0207674_10199347
590 Ga0207674_10306508
591 Ga0207674_10360549
592 Ga0207675_100984130
593 Ga0207698_10301404
594 Ga0207698_10573816
595 Ga0207428_10013038
596 Ga0207428_10085292
597 Ga0268265_10402291
598 Ga0268265_10507237
599 Ga0268264_10110633
600 Ga0268264_11224824
601 Ga0307513_10062851
602 Ga0307408_100001988
603 Ga0307408_100178034
604 Ga0307408_100462489
605 Ga0307413_10018256
606 Ga0307410_10005343
607 Ga0307410_10684495
608 Ga0307406_10002653
609 Ga0307412_10022397
610 Ga0307412_10221657
611 Ga0307412_10232199
612 Ga0307412_10655495
613 Ga0307409_100136152
614 Ga0307416_100017446
615 Ga0307416_101131478
616 Ga0307416_101202578
617 Ga0307414_10012380
618 Ga0307414_10092760
619 Ga0307414_10301453
620 Ga0307411_10128163
621 Ga0307415_100000724
622 Ga0373949_0094613
623 Ga0373952_0066194
624 Ga0373942_0006681
625 Ga0373931_0025286
626 Ga0395900_0141062
627 Ga0395898_0192883
628 Ga0395898_0254388
629 Ga0395898_0550645
630 Ga0395905_0293356
631 Ga0395901_0256551
632 Ga0395901_0378304
633 Ga0439448_0079554
634 Ga0439458_0004465
635 Ga0451576_0496842
636 Ga0495604_0031095
637 Ga0496108_0273975
638 Ga0496112_0095133
639 Ga0496112_0136401
640 Ga0501291_006068
641 Ga0501292_015749
642 Ga0501293_009015
643 Ga0501298_003068
644 Ga0501298_047497
645 Ga0501038_0002266
646 Ga0501198_000495
647 Ga0501199_008406
648 Ga0501206_007786
649 Ga0501207_000133
650 Ga0501207_023280
651 Ga0501217_012646
652 Ga0501217_013625
653 Ga0501223_000326
654 Ga0501223_009341
655 Ga0501224_004181
656 Ga0501227_013489
657 Ga0501230_018537
658 Ga0501233_010771
659 Ga0501233_011906
660 Ga0501235_006021
661 Ga0501238_033858
662 Ga0501240_020506
663 Ga0501249_009889
664 Ga0501250_013297
665 Ga0501253_015685
666 Ga0501253_031558
667 Ga0501256_001925
668 Ga0501257_003792
669 Ga0501261_012002
670 Ga0501219_006307
671 Ga0501221_003156
672 Ga0501225_0007702
673 Ga0501225_0082470
674 Ga0501229_002162
675 Ga0501234_007033
676 Ga0501234_032148
677 Ga0501245_032179
678 Ga0501265_004310
679 Ga0501268_032390
680 Ga0501283_006285
681 Ga0501204_010258
682 Ga0501212_012672
683 Ga0501226_001895
684 nmdc:mga05p37_227989_c1
685 nmdc:mga05p37_89423_c1
686 nmdc:mga05p37_992089_c1
687 nmdc:mga0qj67_339339_c1
688 nmdc:mga0qj67_698474_c1
689 nmdc:mga06r32_287816_c1
690 nmdc:mga08y16_29165_c1
691 nmdc:mga08y16_8236_c1
692 nmdc:mga08y16_95628_c1
693 nmdc:mga0n895_190845_c1
694 nmdc:mga0n895_193093_c1
695 nmdc:mga0a205_125121_c1
696 nmdc:mga0a205_395193_c1
697 nmdc:mga0a205_602206_c1
698 nmdc:mga0a205_672658_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00697

PRAI

N-(5'phosphoribosyl)anthranilate (PRA) isomerase

47

244

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1lbm-assembly1.cif.gz_A crystal structure of phosphoribosyl anthranilate isomerase (prai) in complex with reduced 1-(o-carboxyphenylamino)-1-deoxyribulose 5-phosphate (rcdrp) 0.9419 1 201
1nsj-assembly1.cif.gz_A-2 crystal structure of phosphoribosyl anthranilate isomerase from thermotoga maritima 0.9403 1 201
1dl3-assembly2.cif.gz_B crystal structure of mutually generated monomers of dimeric phosphoribosylantranilate isomerase from thermotoga maritima 0.9331 1 201
1lbm-assembly1.cif.gz_A crystal structure of phosphoribosyl anthranilate isomerase (prai) in complex with reduced 1-(o-carboxyphenylamino)-1-deoxyribulose 5-phosphate (rcdrp) 0.9277 1 201
1dl3-assembly2.cif.gz_B crystal structure of mutually generated monomers of dimeric phosphoribosylantranilate isomerase from thermotoga maritima 0.9192 1 201
ID Description Score Start End Superfamily
1dl3A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9092 1 202 3.20.20.70
1v5xB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9035 2 204 3.20.20.70
1dl3A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9001 1 202 3.20.20.70
1v5xB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8992 2 204 3.20.20.70
4wuiA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8702 1 203 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A533YXV2-F1-model_v4 N-(5'-phosphoribosyl)anthranilate isomerase (EC 5.3.1.24) 0.9786 1 91 GO:0000162
GO:0004640
GO:0006568
AF-A0A7C2Q5S4-F1-model_v4 N-(5'-phosphoribosyl)anthranilate isomerase (EC 5.3.1.24) 0.9632 1 117 GO:0000162
GO:0004640
GO:0006568
AF-A0A2E5ETL1-F1-model_v4 N-(5'-phosphoribosyl)anthranilate isomerase (PRAI) (EC 5.3.1.24) 0.9615 2 203 GO:0000162
GO:0004640
GO:0006568
AF-A0A7C2U7R7-F1-model_v4 N-(5'-phosphoribosyl)anthranilate isomerase (PRAI) (EC 5.3.1.24) 0.9599 1 203 GO:0000162
GO:0004640
GO:0006568
AF-A0A7W0G4K1-F1-model_v4 N-(5'-phosphoribosyl)anthranilate isomerase (PRAI) (EC 5.3.1.24) 0.9595 1 201 GO:0000162
GO:0004640
GO:0006568

Map