F417676

General Info

Members Datasets Scaffolds Average Seq Length
348 205 348 132

Family's Representative Sequence

Representative Sequence 3300046557|Ga0495622_0073191|Ga0495622_0073191_949_1422
Length 149
Sequence MRLHNLVNVKGAVHRKKRVGCGEGGGHGKTSGRSGSSIRIGFEGGQMPLIRRIPKRGFNNARFATRYVAVNVSDLNKFDDGAKVDEVALRAIGLANGRSTGVKILGDGELSKKLTVRANAFSESAKQKIEAKGGTCEVVVRKPAEPAKA

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
52 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
53 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
78 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
79 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
80 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
81 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
82 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
83 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
84 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
85 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
86 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
87 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
88 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
89 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
90 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
91 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
92 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
93 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
94 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
95 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
96 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
97 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
98 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
99 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
100 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
101 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
102 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
103 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
104 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
105 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
106 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
107 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
108 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
109 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
110 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
111 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
112 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
113 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
114 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
115 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
116 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
117 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
118 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
119 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
120 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
121 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
122 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
123 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
124 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
125 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
126 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
127 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
128 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
129 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
130 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
131 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
132 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
133 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
134 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
135 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
136 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
137 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
138 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
139 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
140 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
141 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
142 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
143 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
144 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
145 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
146 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
147 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
148 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
149 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
150 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
151 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
152 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
153 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
154 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
155 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
156 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
157 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
158 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
159 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
160 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
161 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
162 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
163 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
164 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
165 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
166 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
167 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
168 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
169 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
170 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
171 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
188 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
189 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
190 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
191 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
192 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
193 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
194 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
195 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
196 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
197 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
198 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
200 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
201 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
202 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
203 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
204 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
205 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.7
Metatranscriptomes 2.3
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.29
Nodule 0
Rhizoplane 0
Rhizosphere 98.85
Stem 0
Stem Tuber 0
Unclassified 0.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10011452 3300003323 Bacteria 12825
2 Ga0065714_10126941 3300005288 Bacteria 1287
3 Ga0065712_10146816 3300005290 Bacteria 1379
4 Ga0065715_10166952 3300005293 Bacteria 1578
5 Ga0070683_100176940 3300005329 Bacteria 2025
6 Ga0070690_100082565 3300005330 Bacteria 2104
7 Ga0070670_100004112 3300005331 Bacteria 12158
8 Ga0070670_102076190 3300005331 Bacteria 524
9 Ga0068869_100069995 3300005334 Bacteria 2595
10 Ga0070689_100092578 3300005340 Bacteria 2384
11 Ga0070689_100149080 3300005340 Bacteria 1886
12 Ga0070691_10452699 3300005341 Bacteria 733
13 Ga0070688_100002613 3300005365 Bacteria 9140
14 Ga0070701_10248487 3300005438 Bacteria 1073
15 Ga0070711_100006330 3300005439 Bacteria 7129
16 Ga0070705_100221310 3300005440 Bacteria 1311
17 Ga0070700_100182447 3300005441 Bacteria 1462
18 Ga0070700_100212450 3300005441 Bacteria 1366
19 Ga0070708_100072631 3300005445 Bacteria 3100
20 Ga0070681_10420650 3300005458 Bacteria 1248
21 Ga0068867_100156978 3300005459 Bacteria 1792
22 Ga0070685_10073746 3300005466 Bacteria 2029
23 Ga0070685_10111006 3300005466 Bacteria 1689
24 Ga0070707_101208923 3300005468 Bacteria 722
25 Ga0070698_100491166 3300005471 Bacteria 1165
26 Ga0070698_101653466 3300005471 Bacteria 593
27 Ga0070699_100743323 3300005518 Bacteria 897
28 Ga0070679_100012053 3300005530 Bacteria 8254
29 Ga0070697_100779019 3300005536 Bacteria 846
30 Ga0068853_100737567 3300005539 Unclassified 941
31 Ga0068855_100031040 3300005563 Bacteria 6386
32 Ga0070664_100535722 3300005564 Bacteria 1082
33 Ga0068857_100012236 3300005577 Bacteria 7466
34 Ga0068859_100111842 3300005617 Bacteria 2794
35 Ga0068859_100382606 3300005617 Bacteria 1503
36 Ga0068864_100069385 3300005618 Bacteria 3065
37 Ga0068866_10408242 3300005718 Bacteria 878
38 Ga0068861_100643876 3300005719 Bacteria 978
39 Ga0068863_100005833 3300005841 Bacteria 12068
40 Ga0068863_100237481 3300005841 Bacteria 1759
41 Ga0068862_100245044 3300005844 Bacteria 1631
42 Ga0070717_10000003 3300006028 Bacteria 370103
43 Ga0075428_100352375 3300006844 Bacteria 1580
44 Ga0075434_100894325 3300006871 Bacteria 903
45 Ga0068865_100087049 3300006881 Bacteria 2257
46 Ga0075436_101198206 3300006914 Bacteria 573
47 Ga0097620_100111843 3300006931 Bacteria 2794
48 Ga0097620_100382591 3300006931 Bacteria 1503
49 Ga0105240_10048597 3300009093 Bacteria 5361
50 Ga0111539_10117291 3300009094 Bacteria 3121
51 Ga0111539_10259268 3300009094 Bacteria 2024
52 Ga0111539_10391535 3300009094 Bacteria 1618
53 Ga0105242_10006482 3300009176 Bacteria 9013
54 Ga0105248_10834222 3300009177 Bacteria 1040
55 Ga0105238_10294462 3300009551 Bacteria 1606
56 Ga0105246_10570254 3300011119 Bacteria 973
57 Ga0157378_10791270 3300013297 Bacteria 974
58 Ga0157372_10732983 3300013307 Bacteria 1149
59 Ga0157372_11129745 3300013307 Unclassified 906
60 Ga0157375_11978615 3300013308 Bacteria 692
61 Ga0157375_12252569 3300013308 Bacteria 649
62 Ga0163163_10173661 3300014325 Bacteria 2201
63 Ga0163163_11301563 3300014325 Bacteria 789
64 Ga0157380_10422209 3300014326 Bacteria 1272
65 Ga0157377_10017579 3300014745 Bacteria 3699
66 Ga0157377_11022490 3300014745 Bacteria 627
67 Ga0207653_10111588 3300025885 Bacteria 976
68 Ga0207642_10298603 3300025899 Bacteria 933
69 Ga0207643_10025012 3300025908 Bacteria 3298
70 Ga0207695_10035918 3300025913 Bacteria 5364
71 Ga0207663_10090704 3300025916 Bacteria 2027
72 Ga0207652_10162217 3300025921 Bacteria 2004
73 Ga0207694_10256823 3300025924 Bacteria 1431
74 Ga0207650_10017211 3300025925 Bacteria 5059
75 Ga0207686_10310502 3300025934 Bacteria 1174
76 Ga0207670_10081755 3300025936 Bacteria 2262
77 Ga0207670_10369746 3300025936 Bacteria 1139
78 Ga0207704_10227467 3300025938 Bacteria 1385
79 Ga0207691_10799361 3300025940 Unclassified 793
80 Ga0207711_11045247 3300025941 Unclassified 757
81 Ga0207689_10091955 3300025942 Bacteria 2492
82 Ga0207661_10100921 3300025944 Bacteria 2423
83 Ga0207667_10025777 3300025949 Bacteria 6432
84 Ga0207677_10656189 3300026023 Bacteria 926
85 Ga0207703_11832540 3300026035 Unclassified 583
86 Ga0207702_10039402 3300026078 Bacteria 3958
87 Ga0207641_10018981 3300026088 Bacteria 5640
88 Ga0207674_10018919 3300026116 Bacteria 7468
89 Ga0209999_1017218 3300027543 Bacteria 1318
90 Ga0209971_1013375 3300027682 Bacteria 1945
91 Ga0209974_10001132 3300027876 Bacteria 9471
92 Ga0265337_1001120 3300028556 Bacteria 13707
93 Ga0265337_1004262 3300028556 Bacteria 5971
94 Ga0265337_1019752 3300028556 Bacteria 2119
95 Ga0265337_1029574 3300028556 Bacteria 1637
96 Ga0265337_1046647 3300028556 Bacteria 1230
97 Ga0265326_10016196 3300028558 Bacteria 2157
98 Ga0265326_10065325 3300028558 Bacteria 1029
99 Ga0265326_10066333 3300028558 Bacteria 1020
100 Ga0265319_1000019 3300028563 Bacteria 154537
101 Ga0265319_1002872 3300028563 Bacteria 9202
102 Ga0265319_1005249 3300028563 Bacteria 6250
103 Ga0265319_1027502 3300028563 Bacteria 2016
104 Ga0265319_1027556 3300028563 Bacteria 2014
105 Ga0265319_1105725 3300028563 Bacteria 882
106 Ga0265334_10001534 3300028573 Bacteria 11166
107 Ga0265334_10021751 3300028573 Bacteria 2618
108 Ga0265318_10000422 3300028577 Bacteria 32552
109 Ga0265318_10001452 3300028577 Bacteria 13930
110 Ga0265318_10014814 3300028577 Bacteria 3264
111 Ga0265318_10020864 3300028577 Bacteria 2637
112 Ga0265318_10036088 3300028577 Unclassified 1898
113 Ga0265318_10134714 3300028577 Bacteria 908
114 Ga0265323_10017621 3300028653 Bacteria 2772
115 Ga0265322_10033465 3300028654 Bacteria 1465
116 Ga0265336_10001049 3300028666 Bacteria 13508
117 Ga0265336_10010063 3300028666 Bacteria 3243
118 Ga0265336_10021362 3300028666 Bacteria 2070
119 Ga0265336_10023291 3300028666 Bacteria 1965
120 Ga0265336_10085686 3300028666 Bacteria 939
121 Ga0265338_10001116 3300028800 Bacteria 44580
122 Ga0265338_10001708 3300028800 Bacteria 34832
123 Ga0265338_10004347 3300028800 Bacteria 19195
124 Ga0265338_10036317 3300028800 Bacteria 4718
125 Ga0265338_10102880 3300028800 Bacteria 2321
126 Ga0265338_10118405 3300028800 Bacteria 2117
127 Ga0265338_10131360 3300028800 Bacteria 1976
128 Ga0265338_10294358 3300028800 Bacteria 1182
129 Ga0265338_10356766 3300028800 Bacteria 1050
130 Ga0265324_10000442 3300029957 Bacteria 29455
131 Ga0265324_10004423 3300029957 Bacteria 6364
132 Ga0265324_10030484 3300029957 Bacteria 1892
133 Ga0265324_10067824 3300029957 Bacteria 1216
134 Ga0265332_10018067 3300031238 Bacteria 3109
135 Ga0265332_10062132 3300031238 Bacteria 1596
136 Ga0265328_10052198 3300031239 Bacteria 1501
137 Ga0265320_10000430 3300031240 Bacteria 33126
138 Ga0265320_10006592 3300031240 Bacteria 7298
139 Ga0265320_10013095 3300031240 Bacteria 4785
140 Ga0265320_10036164 3300031240 Bacteria 2497
141 Ga0265320_10040309 3300031240 Bacteria 2329
142 Ga0265320_10057438 3300031240 Bacteria 1866
143 Ga0265320_10085524 3300031240 Bacteria 1468
144 Ga0265320_10113647 3300031240 Bacteria 1239
145 Ga0265325_10004414 3300031241 Bacteria 8894
146 Ga0265325_10075007 3300031241 Bacteria 1690
147 Ga0265325_10101618 3300031241 Bacteria 1406
148 Ga0265340_10031140 3300031247 Bacteria 2670
149 Ga0265340_10056515 3300031247 Bacteria 1887
150 Ga0265340_10060297 3300031247 Bacteria 1818
151 Ga0265339_10289177 3300031249 Bacteria 784
152 Ga0265327_10002314 3300031251 Bacteria 20368
153 Ga0265327_10009740 3300031251 Bacteria 6875
154 Ga0265327_10463467 3300031251 Bacteria 547
155 Ga0265316_10010207 3300031344 Bacteria 8574
156 Ga0265316_10013603 3300031344 Bacteria 7219
157 Ga0265316_10075585 3300031344 Bacteria 2590
158 Ga0265316_10094336 3300031344 Bacteria 2280
159 Ga0265316_10149061 3300031344 Bacteria 1753
160 Ga0265316_10168857 3300031344 Bacteria 1633
161 Ga0265316_10251325 3300031344 Bacteria 1298
162 Ga0265316_10256352 3300031344 Bacteria 1283
163 Ga0307408_100708916 3300031548 Bacteria 905
164 Ga0265313_10000667 3300031595 Bacteria 35343
165 Ga0265313_10000967 3300031595 Bacteria 28455
166 Ga0265313_10087769 3300031595 Unclassified 1401
167 Ga0307508_10000276 3300031616 Bacteria 63298
168 Ga0265314_10003246 3300031711 Bacteria 15899
169 Ga0265314_10003296 3300031711 Bacteria 15770
170 Ga0265314_10059556 3300031711 Bacteria 2611
171 Ga0265314_10118511 3300031711 Bacteria 1670
172 Ga0265314_10175740 3300031711 Bacteria 1288
173 Ga0265314_10318821 3300031711 Bacteria 865
174 Ga0265342_10061321 3300031712 Bacteria 2216
175 Ga0265342_10100669 3300031712 Bacteria 1646
176 Ga0265342_10101085 3300031712 Bacteria 1642
177 Ga0265342_10230188 3300031712 Bacteria 996
178 Ga0307405_10545943 3300031731 Bacteria 937
179 Ga0307405_10595344 3300031731 Bacteria 901
180 Ga0307410_10032583 3300031852 Bacteria 3356
181 Ga0307407_10399541 3300031903 Bacteria 985
182 Ga0307412_10019382 3300031911 Bacteria 4119
183 Ga0307409_100000037 3300031995 Bacteria 47029
184 Ga0307409_100214674 3300031995 Bacteria 1732
185 Ga0307409_100287149 3300031995 Bacteria 1524
186 Ga0307409_101273858 3300031995 Bacteria 760
187 Ga0307414_10067345 3300032004 Bacteria 2565
188 Ga0307414_10307608 3300032004 Bacteria 1344
189 Ga0307414_10486738 3300032004 Bacteria 1089
190 Ga0307411_10295276 3300032005 Bacteria 1297
191 Ga0307411_11724130 3300032005 Bacteria 580
192 Ga0307507_10271706 3300033179 Bacteria 1070
193 Ga0373950_0170736 3300034818 Bacteria 507
194 Ga0373938_0054640 3300034957 Bacteria 920
195 Ga0373928_0000445 3300035084 Bacteria 8163
196 Ga0373929_0000680 3300035085 Bacteria 6562
197 Ga0373944_0000109 3300035089 Bacteria 15141
198 Ga0373949_0000902 3300035090 Bacteria 9274
199 Ga0373951_0003696 3300035091 Bacteria 3691
200 Ga0373952_0076265 3300035092 Bacteria 847
201 Ga0373932_0000003 3300035112 Bacteria 459351
202 Ga0373939_0036742 3300035114 Bacteria 1451
203 Ga0373941_0060612 3300035115 Bacteria 1230
204 Ga0373941_0226132 3300035115 Bacteria 721
205 Ga0373945_0071495 3300035116 Bacteria 1314
206 Ga0373953_0117871 3300035117 Unclassified 1126
207 Ga0373954_0250052 3300035118 Bacteria 873
208 Ga0373956_0053773 3300035119 Unclassified 1813
209 Ga0373943_0092206 3300035170 Bacteria 1571
210 Ga0373943_0254705 3300035170 Bacteria 987
211 Ga0373955_0299850 3300035172 Unclassified 969
212 Ga0373942_0071020 3300035207 Bacteria 1017
213 Ga0373942_0158280 3300035207 Bacteria 731
214 Ga0373961_0062472 3300035241 Bacteria 1134
215 Ga0373962_0000069 3300035242 Bacteria 22606
216 Ga0373931_0000054 3300035691 Bacteria 58930
217 Ga0373931_0099434 3300035691 Bacteria 1634
218 Ga0373927_0062778 3300035695 Bacteria 2402
219 Ga0373927_0477403 3300035695 Bacteria 824
220 Ga0373933_0187576 3300035724 Unclassified 1320
221 Ga0373947_0212482 3300035725 Bacteria 1269
222 Ga0373937_0002552 3300036401 Bacteria 15128
223 Ga0373937_0289137 3300036401 Bacteria 1548
224 Ga0373925_0002791 3300037068 Bacteria 13798
225 Ga0373925_0045201 3300037068 Bacteria 3271
226 Ga0373925_0819351 3300037068 Bacteria 767
227 Ga0395905_0103171 3300037471 Bacteria 2677
228 Ga0395901_0273026 3300038443 Unclassified 1758
229 Ga0450921_004735 3300042123 Bacteria 1007
230 Ga0439446_0078056 3300042156 Bacteria 1022
231 Ga0451577_0000025 3300042876 Bacteria 403632
232 Ga0451577_0005406 3300042876 Bacteria 13101
233 Ga0451577_0031287 3300042876 Bacteria 4803
234 Ga0451577_0059811 3300042876 Bacteria 3397
235 Ga0451577_0183847 3300042876 Bacteria 1885
236 Ga0451577_0259131 3300042876 Bacteria 1575
237 Ga0451577_1213786 3300042876 Bacteria 672
238 Ga0453683_0114982 3300044673 Bacteria 1692
239 Ga0453683_0669445 3300044673 Bacteria 679
240 Ga0466966_0052170 3300044684 Bacteria 2599
241 Ga0466961_0054970 3300044693 Bacteria 2539
242 Ga0453684_0000266 3300044712 Bacteria 225447
243 Ga0453684_0030738 3300044712 Bacteria 7576
244 Ga0453684_0031372 3300044712 Bacteria 7472
245 Ga0453684_0102565 3300044712 Bacteria 3498
246 Ga0466959_0269172 3300045049 Bacteria 1171
247 Ga0451576_0024779 3300045051 Bacteria 6475
248 Ga0451576_0072026 3300045051 Bacteria 3597
249 Ga0451576_0082442 3300045051 Bacteria 3345
250 Ga0451576_0103863 3300045051 Bacteria 2956
251 Ga0451576_0124749 3300045051 Bacteria 2683
252 Ga0451576_0205553 3300045051 Bacteria 2056
253 Ga0451576_0230436 3300045051 Bacteria 1935
254 Ga0451576_0566447 3300045051 Unclassified 1193
255 Ga0451576_0830168 3300045051 Bacteria 970
256 Ga0495629_0006700 3300046459 Bacteria 8518
257 Ga0495580_0141505 3300046472 Bacteria 1667
258 Ga0495582_0011324 3300046473 Bacteria 4914
259 Ga0495639_0056972 3300046475 Bacteria 1785
260 Ga0495664_0463675 3300046477 Bacteria 758
261 Ga0495594_0633488 3300046499 Bacteria 606
262 Ga0495608_0054440 3300046511 Bacteria 2645
263 Ga0495618_0001918 3300046514 Bacteria 13659
264 Ga0495618_0346433 3300046514 Bacteria 916
265 Ga0495630_0012873 3300046517 Bacteria 6077
266 Ga0495630_0051867 3300046517 Bacteria 3071
267 Ga0495630_0588916 3300046517 Bacteria 853
268 Ga0495666_0351468 3300046526 Bacteria 664
269 Ga0495640_0059273 3300046533 Bacteria 2608
270 Ga0495640_0069095 3300046533 Unclassified 2376
271 Ga0495640_0119474 3300046533 Bacteria 1715
272 Ga0495586_0001064 3300046535 Bacteria 15493
273 Ga0495586_0012494 3300046535 Bacteria 4505
274 Ga0495586_0197974 3300046535 Bacteria 1138
275 Ga0495622_0073191 3300046557 Bacteria 1581
276 Ga0495667_0068829 3300046559 Bacteria 2311
277 Ga0495667_0161834 3300046559 Bacteria 1439
278 Ga0495634_0003274 3300046642 Bacteria 13068
279 Ga0495635_0072538 3300046663 Unclassified 2359
280 Ga0495657_0219859 3300046675 Bacteria 1152
281 Ga0495657_0221150 3300046675 Bacteria 1148
282 Ga0495657_0513245 3300046675 Unclassified 698
283 Ga0495646_0380844 3300046680 Bacteria 736
284 Ga0495647_0137907 3300046681 Unclassified 1038
285 Ga0495613_0003460 3300046689 Bacteria 11805
286 Ga0495613_0687782 3300046689 Bacteria 674
287 Ga0495581_0585743 3300047315 Unclassified 646
288 Ga0495604_0988364 3300047317 Bacteria 521
289 Ga0495674_0129505 3300047319 Unclassified 2127
290 Ga0495680_0002262 3300047322 Bacteria 19840
291 Ga0495680_0160438 3300047322 Bacteria 1633
292 Ga0495675_0362768 3300047444 Bacteria 850
293 Ga0495684_0011576 3300047471 Bacteria 6810
294 Ga0501309_002850 3300049129 Bacteria 1911
295 Ga0501305_000001 3300049161 Bacteria 19709
296 Ga0501305_000061 3300049161 Bacteria 6159
297 Ga0501305_016276 3300049161 Bacteria 1059
298 Ga0501307_000001 3300049162 Bacteria 10981
299 Ga0501312_000001 3300049528 Bacteria 18666
300 Ga0501312_001427 3300049528 Bacteria 2342
301 Ga0501312_003794 3300049528 Bacteria 1743
302 Ga0501032_0000512 3300049569 Bacteria 31496
303 Ga0501032_0004293 3300049569 Bacteria 10761
304 Ga0501033_0006719 3300049570 Bacteria 8988
305 Ga0501033_0649115 3300049570 Bacteria 721
306 Ga0501034_0127451 3300049571 Bacteria 2530
307 Ga0501036_0262155 3300049572 Bacteria 1448
308 Ga0501036_1397680 3300049572 Bacteria 567
309 Ga0501037_0018702 3300049573 Bacteria 5106
310 Ga0501038_0119634 3300049574 Bacteria 2174
311 Ga0501039_1151662 3300049575 Bacteria 600
312 Ga0501042_0311547 3300049578 Bacteria 1137
313 Ga0501043_0161793 3300049579 Bacteria 1749
314 Ga0501043_0505470 3300049579 Bacteria 902
315 Ga0501046_0005999 3300049580 Bacteria 10806
316 Ga0501046_0155426 3300049580 Bacteria 1723
317 Ga0501047_0042858 3300049581 Bacteria 4372
318 Ga0501047_0086476 3300049581 Bacteria 3012
319 Ga0501047_0099688 3300049581 Bacteria 2784
320 Ga0501047_0277133 3300049581 Bacteria 1522
321 Ga0501048_0015870 3300049582 Bacteria 5558
322 Ga0501048_0374219 3300049582 Bacteria 1017
323 Ga0501070_0033242 3300049586 Bacteria 4316
324 Ga0501070_0797645 3300049586 Bacteria 742
325 Ga0501071_0300523 3300049587 Bacteria 1217
326 Ga0501075_0118681 3300049591 Bacteria 2012
327 Ga0501217_195821 3300049661 Bacteria 627
328 Ga0501222_020784 3300049662 Bacteria 879
329 Ga0501257_093411 3300049686 Bacteria 784
330 Ga0501229_007518 3300049706 Bacteria 1357
331 Ga0501079_0346438 3300049741 Bacteria 1164
332 Ga0501080_0872021 3300049742 Bacteria 786
333 Ga0501083_0029020 3300049744 Bacteria 3810
334 Ga0501083_0029090 3300049744 Bacteria 3804
335 Ga0501268_058850 3300049765 Bacteria 758
336 Ga0501035_0159308 3300049822 Bacteria 1955
337 Ga0501044_0000188 3300049823 Bacteria 77610
338 Ga0501044_0041030 3300049823 Bacteria 4818
339 Ga0501044_0275081 3300049823 Bacteria 1619
340 nmdc:mga08y16_191003_c1 3300050511 Bacteria 2124
341 nmdc:mga08y16_279504_c1 3300050511 Bacteria 1722
342 nmdc:mga08y16_331212_c1 3300050511 Bacteria 1566
343 nmdc:mga0n895_822902_c1 3300050512 Bacteria 918
344 nmdc:mga0rr50_673721_c1 3300050513 Bacteria 883
345 nmdc:mga08x19_970254_c1 3300050514 Bacteria 604
346 Ga0500636_0152455 3300053177 Bacteria 1268
347 Ga0501084_0836536 3300054114 Bacteria 775
348 Ga0501084_1780565 3300054114 Bacteria 514

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031344 Ga0265316_10251325 Ga0265316_102513252 110
2 3300036401 Ga0373937_0289137 Ga0373937_0289137_1068_1538 112
3 3300037471 Ga0395905_0103171 Ga0395905_0103171_642_1232 113
4 3300038443 Ga0395901_0273026 Ga0395901_0273026_59_649 113
5 3300049742 Ga0501080_0872021 Ga0501080_0872021_10_420 113
6 3300009093 Ga0105240_10048597 Ga0105240_100485975 116
7 3300025913 Ga0207695_10035918 Ga0207695_100359187 116
8 3300028558 Ga0265326_10016196 Ga0265326_100161961 116
9 3300029957 Ga0265324_10004423 Ga0265324_100044239 116
10 3300031241 Ga0265325_10004414 Ga0265325_100044143 116
11 3300031344 Ga0265316_10256352 Ga0265316_102563522 116
12 3300035084 Ga0373928_0000445 Ga0373928_0000445_528_1001 116
13 3300035085 Ga0373929_0000680 Ga0373929_0000680_4707_5180 116
14 3300035089 Ga0373944_0000109 Ga0373944_0000109_7315_7788 116
15 3300035090 Ga0373949_0000902 Ga0373949_0000902_1737_2210 116
16 3300035091 Ga0373951_0003696 Ga0373951_0003696_437_910 116
17 3300035112 Ga0373932_0000003 Ga0373932_0000003_264359_264832 116
18 3300035116 Ga0373945_0071495 Ga0373945_0071495_220_693 116
19 3300035170 Ga0373943_0092206 Ga0373943_0092206_66_539 116
20 3300035207 Ga0373942_0158280 Ga0373942_0158280_115_588 116
21 3300035241 Ga0373961_0062472 Ga0373961_0062472_283_756 116
22 3300035242 Ga0373962_0000069 Ga0373962_0000069_9031_9504 116
23 3300035691 Ga0373931_0000054 Ga0373931_0000054_5124_5597 116
24 3300035695 Ga0373927_0062778 Ga0373927_0062778_282_755 116
25 3300035725 Ga0373947_0212482 Ga0373947_0212482_72_545 116
26 3300037068 Ga0373925_0002791 Ga0373925_0002791_11059_11532 116
27 3300045051 Ga0451576_0024779 Ga0451576_0024779_2225_2695 116
28 3300053177 Ga0500636_0152455 Ga0500636_0152455_648_1124 116
29 3300005340 Ga0070689_100092578 Ga0070689_1000925782 117
30 3300005439 Ga0070711_100006330 Ga0070711_1000063303 117
31 3300005440 Ga0070705_100221310 Ga0070705_1002213102 117
32 3300005445 Ga0070708_100072631 Ga0070708_1000726313 117
33 3300005466 Ga0070685_10073746 Ga0070685_100737462 117
34 3300005468 Ga0070707_101208923 Ga0070707_1012089232 117
35 3300005471 Ga0070698_101653466 Ga0070698_1016534661 117
36 3300005518 Ga0070699_100743323 Ga0070699_1007433232 117
37 3300005536 Ga0070697_100779019 Ga0070697_1007790192 117
38 3300005539 Ga0068853_100737567 Ga0068853_1007375672 117
39 3300005617 Ga0068859_100111842 Ga0068859_1001118424 117
40 3300005841 Ga0068863_100005833 Ga0068863_10000583310 117
41 3300006844 Ga0075428_100352375 Ga0075428_1003523752 117
42 3300006871 Ga0075434_100894325 Ga0075434_1008943252 117
43 3300006931 Ga0097620_100111843 Ga0097620_1001118434 117
44 3300009094 Ga0111539_10117291 Ga0111539_101172915 117
45 3300009094 Ga0111539_10259268 Ga0111539_102592682 117
46 3300009094 Ga0111539_10391535 Ga0111539_103915352 117
47 3300009177 Ga0105248_10834222 Ga0105248_108342222 117
48 3300013307 Ga0157372_10732983 Ga0157372_107329832 117
49 3300013307 Ga0157372_11129745 Ga0157372_111297452 117
50 3300013308 Ga0157375_11978615 Ga0157375_119786151 117
51 3300025885 Ga0207653_10111588 Ga0207653_101115881 117
52 3300025916 Ga0207663_10090704 Ga0207663_100907043 117
53 3300025936 Ga0207670_10081755 Ga0207670_100817554 117
54 3300025936 Ga0207670_10369746 Ga0207670_103697462 117
55 3300025940 Ga0207691_10799361 Ga0207691_107993612 117
56 3300025941 Ga0207711_11045247 Ga0207711_110452472 117
57 3300026023 Ga0207677_10656189 Ga0207677_106561892 117
58 3300026035 Ga0207703_11832540 Ga0207703_118325401 117
59 3300026088 Ga0207641_10018981 Ga0207641_100189813 117
60 3300028556 Ga0265337_1001120 Ga0265337_100112015 117
61 3300028556 Ga0265337_1019752 Ga0265337_10197522 117
62 3300028556 Ga0265337_1029574 Ga0265337_10295742 117
63 3300028556 Ga0265337_1046647 Ga0265337_10466472 117
64 3300028563 Ga0265319_1000019 Ga0265319_1000019159 117
65 3300028563 Ga0265319_1027502 Ga0265319_10275022 117
66 3300028563 Ga0265319_1027556 Ga0265319_10275564 117
67 3300028573 Ga0265334_10021751 Ga0265334_100217515 117
68 3300028577 Ga0265318_10014814 Ga0265318_100148143 117
69 3300028577 Ga0265318_10036088 Ga0265318_100360882 117
70 3300028653 Ga0265323_10017621 Ga0265323_100176212 117
71 3300028666 Ga0265336_10010063 Ga0265336_100100632 117
72 3300028666 Ga0265336_10021362 Ga0265336_100213622 117
73 3300028666 Ga0265336_10023291 Ga0265336_100232912 117
74 3300028666 Ga0265336_10085686 Ga0265336_100856862 117
75 3300028800 Ga0265338_10001116 Ga0265338_1000111631 117
76 3300028800 Ga0265338_10004347 Ga0265338_1000434715 117
77 3300028800 Ga0265338_10036317 Ga0265338_100363174 117
78 3300028800 Ga0265338_10102880 Ga0265338_101028802 117
79 3300028800 Ga0265338_10131360 Ga0265338_101313602 117
80 3300028800 Ga0265338_10294358 Ga0265338_102943582 117
81 3300028800 Ga0265338_10356766 Ga0265338_103567662 117
82 3300029957 Ga0265324_10030484 Ga0265324_100304842 117
83 3300031240 Ga0265320_10036164 Ga0265320_100361642 117
84 3300031240 Ga0265320_10040309 Ga0265320_100403092 117
85 3300031240 Ga0265320_10057438 Ga0265320_100574382 117
86 3300031240 Ga0265320_10113647 Ga0265320_101136472 117
87 3300031241 Ga0265325_10101618 Ga0265325_101016183 117
88 3300031247 Ga0265340_10031140 Ga0265340_100311404 117
89 3300031247 Ga0265340_10056515 Ga0265340_100565151 117
90 3300031247 Ga0265340_10060297 Ga0265340_100602972 117
91 3300031249 Ga0265339_10289177 Ga0265339_102891771 117
92 3300031344 Ga0265316_10013603 Ga0265316_100136034 117
93 3300031344 Ga0265316_10075585 Ga0265316_100755854 117
94 3300031344 Ga0265316_10094336 Ga0265316_100943363 117
95 3300031344 Ga0265316_10149061 Ga0265316_101490612 117
96 3300031548 Ga0307408_100708916 Ga0307408_1007089162 117
97 3300031595 Ga0265313_10000967 Ga0265313_100009673 117
98 3300031595 Ga0265313_10087769 Ga0265313_100877692 117
99 3300031711 Ga0265314_10175740 Ga0265314_101757402 117
100 3300031712 Ga0265342_10101085 Ga0265342_101010853 117
101 3300031712 Ga0265342_10230188 Ga0265342_102301882 117
102 3300031731 Ga0307405_10595344 Ga0307405_105953442 117
103 3300031852 Ga0307410_10032583 Ga0307410_100325834 117
104 3300031911 Ga0307412_10019382 Ga0307412_100193824 117
105 3300031995 Ga0307409_100214674 Ga0307409_1002146743 117
106 3300031995 Ga0307409_100287149 Ga0307409_1002871492 117
107 3300031995 Ga0307409_101273858 Ga0307409_1012738581 117
108 3300032004 Ga0307414_10307608 Ga0307414_103076083 117
109 3300032005 Ga0307411_11724130 Ga0307411_117241301 117
110 3300035117 Ga0373953_0117871 Ga0373953_0117871_282_755 117
111 3300035119 Ga0373956_0053773 Ga0373956_0053773_469_942 117
112 3300035170 Ga0373943_0254705 Ga0373943_0254705_481_954 117
113 3300035172 Ga0373955_0299850 Ga0373955_0299850_245_718 117
114 3300035695 Ga0373927_0477403 Ga0373927_0477403_96_581 117
115 3300035724 Ga0373933_0187576 Ga0373933_0187576_329_802 117
116 3300036401 Ga0373937_0002552 Ga0373937_0002552_4869_5342 117
117 3300037068 Ga0373925_0819351 Ga0373925_0819351_147_620 117
118 3300042876 Ga0451577_0031287 Ga0451577_0031287_2580_3056 117
119 3300045051 Ga0451576_0072026 Ga0451576_0072026_20_496 117
120 3300045051 Ga0451576_0082442 Ga0451576_0082442_331_804 117
121 3300045051 Ga0451576_0230436 Ga0451576_0230436_771_1244 117
122 3300045051 Ga0451576_0566447 Ga0451576_0566447_150_623 117
123 3300046459 Ga0495629_0006700 Ga0495629_0006700_767_1240 117
124 3300046511 Ga0495608_0054440 Ga0495608_0054440_1615_2100 117
125 3300046514 Ga0495618_0001918 Ga0495618_0001918_11528_12001 117
126 3300046517 Ga0495630_0012873 Ga0495630_0012873_4514_4999 117
127 3300046517 Ga0495630_0051867 Ga0495630_0051867_1173_1646 117
128 3300046517 Ga0495630_0588916 Ga0495630_0588916_98_604 117
129 3300046526 Ga0495666_0351468 Ga0495666_0351468_169_654 117
130 3300046533 Ga0495640_0059273 Ga0495640_0059273_256_741 117
131 3300046533 Ga0495640_0069095 Ga0495640_0069095_467_940 117
132 3300046533 Ga0495640_0119474 Ga0495640_0119474_162_647 117
133 3300046535 Ga0495586_0001064 Ga0495586_0001064_7749_8222 117
134 3300046535 Ga0495586_0197974 Ga0495586_0197974_541_1026 117
135 3300046559 Ga0495667_0068829 Ga0495667_0068829_779_1252 117
136 3300046559 Ga0495667_0161834 Ga0495667_0161834_752_1237 117
137 3300046642 Ga0495634_0003274 Ga0495634_0003274_4946_5419 117
138 3300046663 Ga0495635_0072538 Ga0495635_0072538_1605_2078 117
139 3300046675 Ga0495657_0219859 Ga0495657_0219859_601_1086 117
140 3300046675 Ga0495657_0221150 Ga0495657_0221150_25_498 117
141 3300046675 Ga0495657_0513245 Ga0495657_0513245_16_501 117
142 3300046680 Ga0495646_0380844 Ga0495646_0380844_241_714 117
143 3300046681 Ga0495647_0137907 Ga0495647_0137907_201_674 117
144 3300046689 Ga0495613_0003460 Ga0495613_0003460_4853_5326 117
145 3300046689 Ga0495613_0687782 Ga0495613_0687782_156_641 117
146 3300047315 Ga0495581_0585743 Ga0495581_0585743_156_629 117
147 3300047317 Ga0495604_0988364 Ga0495604_0988364_12_497 117
148 3300047319 Ga0495674_0129505 Ga0495674_0129505_1168_1641 117
149 3300047322 Ga0495680_0002262 Ga0495680_0002262_6504_6977 117
150 3300047322 Ga0495680_0160438 Ga0495680_0160438_17_502 117
151 3300047444 Ga0495675_0362768 Ga0495675_0362768_340_825 117
152 3300047471 Ga0495684_0011576 Ga0495684_0011576_373_846 117
153 3300049528 Ga0501312_003794 Ga0501312_003794_481_951 117
154 3300049571 Ga0501034_0127451 Ga0501034_0127451_708_1181 117
155 3300049575 Ga0501039_1151662 Ga0501039_1151662_96_569 117
156 3300049581 Ga0501047_0099688 Ga0501047_0099688_1776_2249 117
157 3300049661 Ga0501217_195821 Ga0501217_195821_64_534 117
158 3300049662 Ga0501222_020784 Ga0501222_020784_305_775 117
159 3300049765 Ga0501268_058850 Ga0501268_058850_46_516 117
160 3300049822 Ga0501035_0159308 Ga0501035_0159308_945_1418 117
161 3300049823 Ga0501044_0275081 Ga0501044_0275081_1079_1552 117
162 3300050511 nmdc:mga08y16_191003_c1 nmdc:mga08y16_191003_c1_720_1193 117
163 3300050511 nmdc:mga08y16_279504_c1 nmdc:mga08y16_279504_c1_538_1011 117
164 3300050511 nmdc:mga08y16_331212_c1 nmdc:mga08y16_331212_c1_346_819 117
165 3300050512 nmdc:mga0n895_822902_c1 nmdc:mga0n895_822902_c1_191_664 117
166 3300005330 Ga0070690_100082565 Ga0070690_1000825654 118
167 3300005563 Ga0068855_100031040 Ga0068855_1000310402 118
168 3300005841 Ga0068863_100237481 Ga0068863_1002374812 118
169 3300009551 Ga0105238_10294462 Ga0105238_102944622 118
170 3300025924 Ga0207694_10256823 Ga0207694_102568232 118
171 3300025949 Ga0207667_10025777 Ga0207667_1002577714 118
172 3300026078 Ga0207702_10039402 Ga0207702_100394022 118
173 3300028800 Ga0265338_10118405 Ga0265338_101184052 118
174 3300034957 Ga0373938_0054640 Ga0373938_0054640_435_908 118
175 3300035115 Ga0373941_0060612 Ga0373941_0060612_93_566 118
176 3300045051 Ga0451576_0103863 Ga0451576_0103863_496_981 118
177 3300037068 Ga0373925_0045201 Ga0373925_0045201_2034_2486 119
178 3300046473 Ga0495582_0011324 Ga0495582_0011324_163_615 119
179 3300046475 Ga0495639_0056972 Ga0495639_0056972_1198_1650 119
180 3300046535 Ga0495586_0012494 Ga0495586_0012494_1371_1823 119
181 3300035118 Ga0373954_0250052 Ga0373954_0250052_35_520 120
182 3300005441 Ga0070700_100212450 Ga0070700_1002124502 121
183 3300006914 Ga0075436_101198206 Ga0075436_1011982061 121
184 3300035092 Ga0373952_0076265 Ga0373952_0076265_250_702 121
185 3300035114 Ga0373939_0036742 Ga0373939_0036742_57_509 121
186 3300035691 Ga0373931_0099434 Ga0373931_0099434_183_635 121
187 3300044673 Ga0453683_0669445 Ga0453683_0669445_79_531 121
188 3300045051 Ga0451576_0830168 Ga0451576_0830168_440_892 121
189 3300046472 Ga0495580_0141505 Ga0495580_0141505_408_860 121
190 3300046477 Ga0495664_0463675 Ga0495664_0463675_73_516 121
191 3300046514 Ga0495618_0346433 Ga0495618_0346433_75_518 121
192 3300050513 nmdc:mga0rr50_673721_c1 nmdc:mga0rr50_673721_c1_103_555 121
193 3300050514 nmdc:mga08x19_970254_c1 nmdc:mga08x19_970254_c1_85_537 121
194 3300049582 Ga0501048_0374219 Ga0501048_0374219_110_547 122
195 3300049587 Ga0501071_0300523 Ga0501071_0300523_767_1204 122
196 3300049591 Ga0501075_0118681 Ga0501075_0118681_439_876 122
197 3300044673 Ga0453683_0114982 Ga0453683_0114982_494_940 123
198 3300005471 Ga0070698_100491166 Ga0070698_1004911662 124
199 3300027543 Ga0209999_1017218 Ga0209999_10172182 124
200 3300027682 Ga0209971_1013375 Ga0209971_10133751 124
201 3300027876 Ga0209974_10001132 Ga0209974_1000113213 124
202 3300042123 Ga0450921_004735 Ga0450921_004735_127_579 124
203 3300042156 Ga0439446_0078056 Ga0439446_0078056_341_793 124
204 3300049578 Ga0501042_0311547 Ga0501042_0311547_288_740 124
205 3300049741 Ga0501079_0346438 Ga0501079_0346438_396_848 124
206 3300054114 Ga0501084_0836536 Ga0501084_0836536_34_486 124
207 3300054114 Ga0501084_1780565 Ga0501084_1780565_31_483 124
208 3300005288 Ga0065714_10126941 Ga0065714_101269412 125
209 3300005290 Ga0065712_10146816 Ga0065712_101468161 125
210 3300005293 Ga0065715_10166952 Ga0065715_101669522 125
211 3300005331 Ga0070670_100004112 Ga0070670_1000041126 125
212 3300005334 Ga0068869_100069995 Ga0068869_1000699952 125
213 3300005340 Ga0070689_100149080 Ga0070689_1001490804 125
214 3300005341 Ga0070691_10452699 Ga0070691_104526991 125
215 3300005365 Ga0070688_100002613 Ga0070688_1000026132 125
216 3300005438 Ga0070701_10248487 Ga0070701_102484872 125
217 3300005441 Ga0070700_100182447 Ga0070700_1001824473 125
218 3300005459 Ga0068867_100156978 Ga0068867_1001569782 125
219 3300005466 Ga0070685_10111006 Ga0070685_101110062 125
220 3300005564 Ga0070664_100535722 Ga0070664_1005357222 125
221 3300005577 Ga0068857_100012236 Ga0068857_1000122368 125
222 3300005617 Ga0068859_100382606 Ga0068859_1003826063 125
223 3300005618 Ga0068864_100069385 Ga0068864_1000693856 125
224 3300005718 Ga0068866_10408242 Ga0068866_104082422 125
225 3300005719 Ga0068861_100643876 Ga0068861_1006438761 125
226 3300005844 Ga0068862_100245044 Ga0068862_1002450444 125
227 3300006881 Ga0068865_100087049 Ga0068865_1000870493 125
228 3300006931 Ga0097620_100382591 Ga0097620_1003825912 125
229 3300009176 Ga0105242_10006482 Ga0105242_1000648210 125
230 3300013308 Ga0157375_12252569 Ga0157375_122525692 125
231 3300014326 Ga0157380_10422209 Ga0157380_104222092 125
232 3300014745 Ga0157377_10017579 Ga0157377_100175793 125
233 3300025899 Ga0207642_10298603 Ga0207642_102986031 125
234 3300025908 Ga0207643_10025012 Ga0207643_100250122 125
235 3300025925 Ga0207650_10017211 Ga0207650_100172116 125
236 3300025938 Ga0207704_10227467 Ga0207704_102274672 125
237 3300025942 Ga0207689_10091955 Ga0207689_100919553 125
238 3300026116 Ga0207674_10018919 Ga0207674_100189199 125
239 3300046499 Ga0495594_0633488 Ga0495594_0633488_80_532 125
240 3300028558 Ga0265326_10065325 Ga0265326_100653252 126
241 3300028563 Ga0265319_1002872 Ga0265319_10028727 126
242 3300028577 Ga0265318_10000422 Ga0265318_100004223 126
243 3300029957 Ga0265324_10067824 Ga0265324_100678242 126
244 3300031238 Ga0265332_10018067 Ga0265332_100180672 126
245 3300031240 Ga0265320_10000430 Ga0265320_1000043028 126
246 3300031251 Ga0265327_10463467 Ga0265327_104634671 126
247 3300031344 Ga0265316_10168857 Ga0265316_101688572 126
248 3300031711 Ga0265314_10318821 Ga0265314_103188212 126
249 3300031712 Ga0265342_10100669 Ga0265342_101006692 126
250 3300034818 Ga0373950_0170736 Ga0373950_0170736_19_465 126
251 3300035207 Ga0373942_0071020 Ga0373942_0071020_189_635 126
252 3300042876 Ga0451577_0000025 Ga0451577_0000025_150524_150970 126
253 3300042876 Ga0451577_0183847 Ga0451577_0183847_725_1171 126
254 3300044684 Ga0466966_0052170 Ga0466966_0052170_1907_2353 126
255 3300044693 Ga0466961_0054970 Ga0466961_0054970_2051_2497 126
256 3300044712 Ga0453684_0030738 Ga0453684_0030738_5599_6045 126
257 3300045049 Ga0466959_0269172 Ga0466959_0269172_77_523 126
258 3300045051 Ga0451576_0205553 Ga0451576_0205553_325_771 126
259 3300046557 Ga0495622_0073191 Ga0495622_0073191_949_1422 126
260 3300049570 Ga0501033_0649115 Ga0501033_0649115_205_651 126
261 3300049744 Ga0501083_0029020 Ga0501083_0029020_2785_3231 126
262 3300049744 Ga0501083_0029090 Ga0501083_0029090_3238_3684 126
263 3300003323 rootH1_10011452 rootH1_1001145222 127
264 3300005329 Ga0070683_100176940 Ga0070683_1001769402 127
265 3300005331 Ga0070670_102076190 Ga0070670_1020761901 127
266 3300005458 Ga0070681_10420650 Ga0070681_104206502 127
267 3300005530 Ga0070679_100012053 Ga0070679_10001205316 127
268 3300006028 Ga0070717_10000003 Ga0070717_10000003248 127
269 3300011119 Ga0105246_10570254 Ga0105246_105702542 127
270 3300013297 Ga0157378_10791270 Ga0157378_107912702 127
271 3300014325 Ga0163163_10173661 Ga0163163_101736613 127
272 3300014325 Ga0163163_11301563 Ga0163163_113015632 127
273 3300014745 Ga0157377_11022490 Ga0157377_110224901 127
274 3300025921 Ga0207652_10162217 Ga0207652_101622172 127
275 3300025934 Ga0207686_10310502 Ga0207686_103105022 127
276 3300025944 Ga0207661_10100921 Ga0207661_101009214 127
277 3300028556 Ga0265337_1004262 Ga0265337_10042624 127
278 3300028558 Ga0265326_10066333 Ga0265326_100663332 127
279 3300028563 Ga0265319_1005249 Ga0265319_10052494 127
280 3300028563 Ga0265319_1105725 Ga0265319_11057252 127
281 3300028573 Ga0265334_10001534 Ga0265334_100015347 127
282 3300028577 Ga0265318_10001452 Ga0265318_1000145212 127
283 3300028577 Ga0265318_10020864 Ga0265318_100208642 127
284 3300028577 Ga0265318_10134714 Ga0265318_101347141 127
285 3300028654 Ga0265322_10033465 Ga0265322_100334652 127
286 3300028666 Ga0265336_10001049 Ga0265336_100010492 127
287 3300028800 Ga0265338_10001708 Ga0265338_1000170825 127
288 3300029957 Ga0265324_10000442 Ga0265324_1000044228 127
289 3300031238 Ga0265332_10062132 Ga0265332_100621323 127
290 3300031239 Ga0265328_10052198 Ga0265328_100521983 127
291 3300031240 Ga0265320_10006592 Ga0265320_100065925 127
292 3300031240 Ga0265320_10013095 Ga0265320_100130953 127
293 3300031240 Ga0265320_10085524 Ga0265320_100855242 127
294 3300031241 Ga0265325_10075007 Ga0265325_100750073 127
295 3300031251 Ga0265327_10002314 Ga0265327_1000231416 127
296 3300031251 Ga0265327_10009740 Ga0265327_1000974014 127
297 3300031344 Ga0265316_10010207 Ga0265316_1001020710 127
298 3300031595 Ga0265313_10000667 Ga0265313_1000066737 127
299 3300031616 Ga0307508_10000276 Ga0307508_1000027628 127
300 3300031711 Ga0265314_10003246 Ga0265314_1000324613 127
301 3300031711 Ga0265314_10003296 Ga0265314_100032968 127
302 3300031711 Ga0265314_10059556 Ga0265314_100595562 127
303 3300031711 Ga0265314_10118511 Ga0265314_101185112 127
304 3300031712 Ga0265342_10061321 Ga0265342_100613212 127
305 3300031731 Ga0307405_10545943 Ga0307405_105459432 127
306 3300031903 Ga0307407_10399541 Ga0307407_103995411 127
307 3300031995 Ga0307409_100000037 Ga0307409_1000000372 127
308 3300032004 Ga0307414_10067345 Ga0307414_100673452 127
309 3300032004 Ga0307414_10486738 Ga0307414_104867382 127
310 3300032005 Ga0307411_10295276 Ga0307411_102952762 127
311 3300033179 Ga0307507_10271706 Ga0307507_102717061 127
312 3300035115 Ga0373941_0226132 Ga0373941_0226132_36_482 127
313 3300042876 Ga0451577_0005406 Ga0451577_0005406_12132_12578 127
314 3300042876 Ga0451577_0059811 Ga0451577_0059811_420_866 127
315 3300042876 Ga0451577_0259131 Ga0451577_0259131_316_762 127
316 3300042876 Ga0451577_1213786 Ga0451577_1213786_17_463 127
317 3300044712 Ga0453684_0000266 Ga0453684_0000266_98512_98958 127
318 3300044712 Ga0453684_0031372 Ga0453684_0031372_3631_4077 127
319 3300044712 Ga0453684_0102565 Ga0453684_0102565_1161_1607 127
320 3300045051 Ga0451576_0124749 Ga0451576_0124749_1092_1538 127
321 3300049129 Ga0501309_002850 Ga0501309_002850_1332_1778 127
322 3300049161 Ga0501305_000001 Ga0501305_000001_6330_6776 127
323 3300049161 Ga0501305_000061 Ga0501305_000061_5474_5923 127
324 3300049161 Ga0501305_016276 Ga0501305_016276_143_589 127
325 3300049162 Ga0501307_000001 Ga0501307_000001_10204_10650 127
326 3300049528 Ga0501312_000001 Ga0501312_000001_12927_13373 127
327 3300049528 Ga0501312_001427 Ga0501312_001427_402_851 127
328 3300049569 Ga0501032_0000512 Ga0501032_0000512_8962_9408 127
329 3300049569 Ga0501032_0004293 Ga0501032_0004293_7073_7519 127
330 3300049570 Ga0501033_0006719 Ga0501033_0006719_2991_3437 127
331 3300049572 Ga0501036_0262155 Ga0501036_0262155_966_1412 127
332 3300049572 Ga0501036_1397680 Ga0501036_1397680_48_494 127
333 3300049573 Ga0501037_0018702 Ga0501037_0018702_4627_5073 127
334 3300049574 Ga0501038_0119634 Ga0501038_0119634_44_490 127
335 3300049579 Ga0501043_0161793 Ga0501043_0161793_255_701 127
336 3300049579 Ga0501043_0505470 Ga0501043_0505470_414_860 127
337 3300049580 Ga0501046_0005999 Ga0501046_0005999_4111_4557 127
338 3300049580 Ga0501046_0155426 Ga0501046_0155426_706_1152 127
339 3300049581 Ga0501047_0042858 Ga0501047_0042858_1092_1538 127
340 3300049581 Ga0501047_0086476 Ga0501047_0086476_423_869 127
341 3300049581 Ga0501047_0277133 Ga0501047_0277133_469_915 127
342 3300049582 Ga0501048_0015870 Ga0501048_0015870_4518_4964 127
343 3300049586 Ga0501070_0033242 Ga0501070_0033242_3398_3844 127
344 3300049586 Ga0501070_0797645 Ga0501070_0797645_263_709 127
345 3300049686 Ga0501257_093411 Ga0501257_093411_20_466 127
346 3300049706 Ga0501229_007518 Ga0501229_007518_123_569 127
347 3300049823 Ga0501044_0000188 Ga0501044_0000188_64626_65072 127
348 3300049823 Ga0501044_0041030 Ga0501044_0041030_4069_4515 127

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00828

Ribosomal_L27A

Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A

19

137

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
2yx6-assembly3.cif.gz_D-3 crystal structure of ph0822 0.9371 103 126
6th6-assembly1.cif.gz_BR cryo-em structure of t. kodakarensis 70s ribosome 0.9189 55 126
1w2b-assembly1.cif.gz_N trigger factor ribosome binding domain in complex with 50s 0.8742 55 125
4v6u-assembly1.cif.gz_BP promiscuous behavior of proteins in archaeal ribosomes revealed by cryo-em: implications for evolution of eukaryotic ribosomes 0.8704 57 126
1p90-assembly1.cif.gz_A the three-dimensional structure of the core domain of nafy from azotobacter vinelandii determined at 1.8 resolution 0.8681 103 126
ID Description Score Start End Superfamily
af_P54022_5_121_3.100.10.10 Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; 0.924 55 126 3.100.10.10
5v7qL01 Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; 0.9116 56 124 3.100.10.10
af_P02413_75_144_3.100.10.10 Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; 0.9115 55 124 3.100.10.10
4qjsP01 Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; 0.9038 56 127 3.100.10.10
1jj2N00 Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; 0.8838 55 126 3.100.10.10
ID Description Score Start End GO Terms
AF-A0A4V1QUN6-F1-model_v4 50S ribosomal protein L15 0.9519 53 127 GO:0003735
GO:0005840
GO:0006412
GO:0016020
GO:0030313
GO:1990904
AF-A0A661D962-F1-model_v4 50S ribosomal protein L15 0.9462 54 125 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A7K0MKD2-F1-model_v4 50S ribosomal protein L15 0.9441 50 127 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A7Z9N4H0-F1-model_v4 50S ribosomal protein L15 0.9431 55 127 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A4Q3ZTU2-F1-model_v4 deleted 0.9429 54 124

Feature Viewer

pLDDT pTM Quality
78.1 0.57 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map