F417676
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 348 | 205 | 348 | 132 |
Family's Representative Sequence
| Representative Sequence | 3300046557|Ga0495622_0073191|Ga0495622_0073191_949_1422 |
| Length | 149 |
| Sequence | MRLHNLVNVKGAVHRKKRVGCGEGGGHGKTSGRSGSSIRIGFEGGQMPLIRRIPKRGFNNARFATRYVAVNVSDLNKFDDGAKVDEVALRAIGLANGRSTGVKILGDGELSKKLTVRANAFSESAKQKIEAKGGTCEVVVRKPAEPAKA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 2 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 4 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 19 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 26 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 27 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 29 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 30 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 31 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 32 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 33 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 34 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 35 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 37 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 38 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 39 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 40 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 78 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 79 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 80 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 81 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 82 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 83 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 84 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 85 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 86 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 87 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 88 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 89 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 90 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 91 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 92 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 93 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 94 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 95 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 96 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 97 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 98 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 99 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 100 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 101 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 102 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 103 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 104 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 105 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 106 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 107 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 108 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 109 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 110 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 111 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 112 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 113 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 114 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 115 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 116 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 117 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 118 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 119 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 120 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 121 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 122 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 123 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 124 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 125 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 126 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 127 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 128 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 129 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 130 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 131 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 132 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 133 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 134 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 135 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 136 | 3300042123 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 | Metagenome | Rhizosphere |
| 137 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 138 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 139 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 140 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 141 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 142 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 143 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 144 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 145 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 172 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 173 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 174 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 175 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 176 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 177 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 178 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 179 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 180 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 181 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 182 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 183 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 184 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 185 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 186 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 187 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 188 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 189 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 190 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 191 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 192 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 193 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 194 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 195 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 196 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 197 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 198 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 199 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 200 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 201 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 202 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 203 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 204 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 205 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.7 |
| Metatranscriptomes | 2.3 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.29 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 98.85 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.86 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10011452 | 3300003323 | Bacteria | 12825 |
| 2 | Ga0065714_10126941 | 3300005288 | Bacteria | 1287 |
| 3 | Ga0065712_10146816 | 3300005290 | Bacteria | 1379 |
| 4 | Ga0065715_10166952 | 3300005293 | Bacteria | 1578 |
| 5 | Ga0070683_100176940 | 3300005329 | Bacteria | 2025 |
| 6 | Ga0070690_100082565 | 3300005330 | Bacteria | 2104 |
| 7 | Ga0070670_100004112 | 3300005331 | Bacteria | 12158 |
| 8 | Ga0070670_102076190 | 3300005331 | Bacteria | 524 |
| 9 | Ga0068869_100069995 | 3300005334 | Bacteria | 2595 |
| 10 | Ga0070689_100092578 | 3300005340 | Bacteria | 2384 |
| 11 | Ga0070689_100149080 | 3300005340 | Bacteria | 1886 |
| 12 | Ga0070691_10452699 | 3300005341 | Bacteria | 733 |
| 13 | Ga0070688_100002613 | 3300005365 | Bacteria | 9140 |
| 14 | Ga0070701_10248487 | 3300005438 | Bacteria | 1073 |
| 15 | Ga0070711_100006330 | 3300005439 | Bacteria | 7129 |
| 16 | Ga0070705_100221310 | 3300005440 | Bacteria | 1311 |
| 17 | Ga0070700_100182447 | 3300005441 | Bacteria | 1462 |
| 18 | Ga0070700_100212450 | 3300005441 | Bacteria | 1366 |
| 19 | Ga0070708_100072631 | 3300005445 | Bacteria | 3100 |
| 20 | Ga0070681_10420650 | 3300005458 | Bacteria | 1248 |
| 21 | Ga0068867_100156978 | 3300005459 | Bacteria | 1792 |
| 22 | Ga0070685_10073746 | 3300005466 | Bacteria | 2029 |
| 23 | Ga0070685_10111006 | 3300005466 | Bacteria | 1689 |
| 24 | Ga0070707_101208923 | 3300005468 | Bacteria | 722 |
| 25 | Ga0070698_100491166 | 3300005471 | Bacteria | 1165 |
| 26 | Ga0070698_101653466 | 3300005471 | Bacteria | 593 |
| 27 | Ga0070699_100743323 | 3300005518 | Bacteria | 897 |
| 28 | Ga0070679_100012053 | 3300005530 | Bacteria | 8254 |
| 29 | Ga0070697_100779019 | 3300005536 | Bacteria | 846 |
| 30 | Ga0068853_100737567 | 3300005539 | Unclassified | 941 |
| 31 | Ga0068855_100031040 | 3300005563 | Bacteria | 6386 |
| 32 | Ga0070664_100535722 | 3300005564 | Bacteria | 1082 |
| 33 | Ga0068857_100012236 | 3300005577 | Bacteria | 7466 |
| 34 | Ga0068859_100111842 | 3300005617 | Bacteria | 2794 |
| 35 | Ga0068859_100382606 | 3300005617 | Bacteria | 1503 |
| 36 | Ga0068864_100069385 | 3300005618 | Bacteria | 3065 |
| 37 | Ga0068866_10408242 | 3300005718 | Bacteria | 878 |
| 38 | Ga0068861_100643876 | 3300005719 | Bacteria | 978 |
| 39 | Ga0068863_100005833 | 3300005841 | Bacteria | 12068 |
| 40 | Ga0068863_100237481 | 3300005841 | Bacteria | 1759 |
| 41 | Ga0068862_100245044 | 3300005844 | Bacteria | 1631 |
| 42 | Ga0070717_10000003 | 3300006028 | Bacteria | 370103 |
| 43 | Ga0075428_100352375 | 3300006844 | Bacteria | 1580 |
| 44 | Ga0075434_100894325 | 3300006871 | Bacteria | 903 |
| 45 | Ga0068865_100087049 | 3300006881 | Bacteria | 2257 |
| 46 | Ga0075436_101198206 | 3300006914 | Bacteria | 573 |
| 47 | Ga0097620_100111843 | 3300006931 | Bacteria | 2794 |
| 48 | Ga0097620_100382591 | 3300006931 | Bacteria | 1503 |
| 49 | Ga0105240_10048597 | 3300009093 | Bacteria | 5361 |
| 50 | Ga0111539_10117291 | 3300009094 | Bacteria | 3121 |
| 51 | Ga0111539_10259268 | 3300009094 | Bacteria | 2024 |
| 52 | Ga0111539_10391535 | 3300009094 | Bacteria | 1618 |
| 53 | Ga0105242_10006482 | 3300009176 | Bacteria | 9013 |
| 54 | Ga0105248_10834222 | 3300009177 | Bacteria | 1040 |
| 55 | Ga0105238_10294462 | 3300009551 | Bacteria | 1606 |
| 56 | Ga0105246_10570254 | 3300011119 | Bacteria | 973 |
| 57 | Ga0157378_10791270 | 3300013297 | Bacteria | 974 |
| 58 | Ga0157372_10732983 | 3300013307 | Bacteria | 1149 |
| 59 | Ga0157372_11129745 | 3300013307 | Unclassified | 906 |
| 60 | Ga0157375_11978615 | 3300013308 | Bacteria | 692 |
| 61 | Ga0157375_12252569 | 3300013308 | Bacteria | 649 |
| 62 | Ga0163163_10173661 | 3300014325 | Bacteria | 2201 |
| 63 | Ga0163163_11301563 | 3300014325 | Bacteria | 789 |
| 64 | Ga0157380_10422209 | 3300014326 | Bacteria | 1272 |
| 65 | Ga0157377_10017579 | 3300014745 | Bacteria | 3699 |
| 66 | Ga0157377_11022490 | 3300014745 | Bacteria | 627 |
| 67 | Ga0207653_10111588 | 3300025885 | Bacteria | 976 |
| 68 | Ga0207642_10298603 | 3300025899 | Bacteria | 933 |
| 69 | Ga0207643_10025012 | 3300025908 | Bacteria | 3298 |
| 70 | Ga0207695_10035918 | 3300025913 | Bacteria | 5364 |
| 71 | Ga0207663_10090704 | 3300025916 | Bacteria | 2027 |
| 72 | Ga0207652_10162217 | 3300025921 | Bacteria | 2004 |
| 73 | Ga0207694_10256823 | 3300025924 | Bacteria | 1431 |
| 74 | Ga0207650_10017211 | 3300025925 | Bacteria | 5059 |
| 75 | Ga0207686_10310502 | 3300025934 | Bacteria | 1174 |
| 76 | Ga0207670_10081755 | 3300025936 | Bacteria | 2262 |
| 77 | Ga0207670_10369746 | 3300025936 | Bacteria | 1139 |
| 78 | Ga0207704_10227467 | 3300025938 | Bacteria | 1385 |
| 79 | Ga0207691_10799361 | 3300025940 | Unclassified | 793 |
| 80 | Ga0207711_11045247 | 3300025941 | Unclassified | 757 |
| 81 | Ga0207689_10091955 | 3300025942 | Bacteria | 2492 |
| 82 | Ga0207661_10100921 | 3300025944 | Bacteria | 2423 |
| 83 | Ga0207667_10025777 | 3300025949 | Bacteria | 6432 |
| 84 | Ga0207677_10656189 | 3300026023 | Bacteria | 926 |
| 85 | Ga0207703_11832540 | 3300026035 | Unclassified | 583 |
| 86 | Ga0207702_10039402 | 3300026078 | Bacteria | 3958 |
| 87 | Ga0207641_10018981 | 3300026088 | Bacteria | 5640 |
| 88 | Ga0207674_10018919 | 3300026116 | Bacteria | 7468 |
| 89 | Ga0209999_1017218 | 3300027543 | Bacteria | 1318 |
| 90 | Ga0209971_1013375 | 3300027682 | Bacteria | 1945 |
| 91 | Ga0209974_10001132 | 3300027876 | Bacteria | 9471 |
| 92 | Ga0265337_1001120 | 3300028556 | Bacteria | 13707 |
| 93 | Ga0265337_1004262 | 3300028556 | Bacteria | 5971 |
| 94 | Ga0265337_1019752 | 3300028556 | Bacteria | 2119 |
| 95 | Ga0265337_1029574 | 3300028556 | Bacteria | 1637 |
| 96 | Ga0265337_1046647 | 3300028556 | Bacteria | 1230 |
| 97 | Ga0265326_10016196 | 3300028558 | Bacteria | 2157 |
| 98 | Ga0265326_10065325 | 3300028558 | Bacteria | 1029 |
| 99 | Ga0265326_10066333 | 3300028558 | Bacteria | 1020 |
| 100 | Ga0265319_1000019 | 3300028563 | Bacteria | 154537 |
| 101 | Ga0265319_1002872 | 3300028563 | Bacteria | 9202 |
| 102 | Ga0265319_1005249 | 3300028563 | Bacteria | 6250 |
| 103 | Ga0265319_1027502 | 3300028563 | Bacteria | 2016 |
| 104 | Ga0265319_1027556 | 3300028563 | Bacteria | 2014 |
| 105 | Ga0265319_1105725 | 3300028563 | Bacteria | 882 |
| 106 | Ga0265334_10001534 | 3300028573 | Bacteria | 11166 |
| 107 | Ga0265334_10021751 | 3300028573 | Bacteria | 2618 |
| 108 | Ga0265318_10000422 | 3300028577 | Bacteria | 32552 |
| 109 | Ga0265318_10001452 | 3300028577 | Bacteria | 13930 |
| 110 | Ga0265318_10014814 | 3300028577 | Bacteria | 3264 |
| 111 | Ga0265318_10020864 | 3300028577 | Bacteria | 2637 |
| 112 | Ga0265318_10036088 | 3300028577 | Unclassified | 1898 |
| 113 | Ga0265318_10134714 | 3300028577 | Bacteria | 908 |
| 114 | Ga0265323_10017621 | 3300028653 | Bacteria | 2772 |
| 115 | Ga0265322_10033465 | 3300028654 | Bacteria | 1465 |
| 116 | Ga0265336_10001049 | 3300028666 | Bacteria | 13508 |
| 117 | Ga0265336_10010063 | 3300028666 | Bacteria | 3243 |
| 118 | Ga0265336_10021362 | 3300028666 | Bacteria | 2070 |
| 119 | Ga0265336_10023291 | 3300028666 | Bacteria | 1965 |
| 120 | Ga0265336_10085686 | 3300028666 | Bacteria | 939 |
| 121 | Ga0265338_10001116 | 3300028800 | Bacteria | 44580 |
| 122 | Ga0265338_10001708 | 3300028800 | Bacteria | 34832 |
| 123 | Ga0265338_10004347 | 3300028800 | Bacteria | 19195 |
| 124 | Ga0265338_10036317 | 3300028800 | Bacteria | 4718 |
| 125 | Ga0265338_10102880 | 3300028800 | Bacteria | 2321 |
| 126 | Ga0265338_10118405 | 3300028800 | Bacteria | 2117 |
| 127 | Ga0265338_10131360 | 3300028800 | Bacteria | 1976 |
| 128 | Ga0265338_10294358 | 3300028800 | Bacteria | 1182 |
| 129 | Ga0265338_10356766 | 3300028800 | Bacteria | 1050 |
| 130 | Ga0265324_10000442 | 3300029957 | Bacteria | 29455 |
| 131 | Ga0265324_10004423 | 3300029957 | Bacteria | 6364 |
| 132 | Ga0265324_10030484 | 3300029957 | Bacteria | 1892 |
| 133 | Ga0265324_10067824 | 3300029957 | Bacteria | 1216 |
| 134 | Ga0265332_10018067 | 3300031238 | Bacteria | 3109 |
| 135 | Ga0265332_10062132 | 3300031238 | Bacteria | 1596 |
| 136 | Ga0265328_10052198 | 3300031239 | Bacteria | 1501 |
| 137 | Ga0265320_10000430 | 3300031240 | Bacteria | 33126 |
| 138 | Ga0265320_10006592 | 3300031240 | Bacteria | 7298 |
| 139 | Ga0265320_10013095 | 3300031240 | Bacteria | 4785 |
| 140 | Ga0265320_10036164 | 3300031240 | Bacteria | 2497 |
| 141 | Ga0265320_10040309 | 3300031240 | Bacteria | 2329 |
| 142 | Ga0265320_10057438 | 3300031240 | Bacteria | 1866 |
| 143 | Ga0265320_10085524 | 3300031240 | Bacteria | 1468 |
| 144 | Ga0265320_10113647 | 3300031240 | Bacteria | 1239 |
| 145 | Ga0265325_10004414 | 3300031241 | Bacteria | 8894 |
| 146 | Ga0265325_10075007 | 3300031241 | Bacteria | 1690 |
| 147 | Ga0265325_10101618 | 3300031241 | Bacteria | 1406 |
| 148 | Ga0265340_10031140 | 3300031247 | Bacteria | 2670 |
| 149 | Ga0265340_10056515 | 3300031247 | Bacteria | 1887 |
| 150 | Ga0265340_10060297 | 3300031247 | Bacteria | 1818 |
| 151 | Ga0265339_10289177 | 3300031249 | Bacteria | 784 |
| 152 | Ga0265327_10002314 | 3300031251 | Bacteria | 20368 |
| 153 | Ga0265327_10009740 | 3300031251 | Bacteria | 6875 |
| 154 | Ga0265327_10463467 | 3300031251 | Bacteria | 547 |
| 155 | Ga0265316_10010207 | 3300031344 | Bacteria | 8574 |
| 156 | Ga0265316_10013603 | 3300031344 | Bacteria | 7219 |
| 157 | Ga0265316_10075585 | 3300031344 | Bacteria | 2590 |
| 158 | Ga0265316_10094336 | 3300031344 | Bacteria | 2280 |
| 159 | Ga0265316_10149061 | 3300031344 | Bacteria | 1753 |
| 160 | Ga0265316_10168857 | 3300031344 | Bacteria | 1633 |
| 161 | Ga0265316_10251325 | 3300031344 | Bacteria | 1298 |
| 162 | Ga0265316_10256352 | 3300031344 | Bacteria | 1283 |
| 163 | Ga0307408_100708916 | 3300031548 | Bacteria | 905 |
| 164 | Ga0265313_10000667 | 3300031595 | Bacteria | 35343 |
| 165 | Ga0265313_10000967 | 3300031595 | Bacteria | 28455 |
| 166 | Ga0265313_10087769 | 3300031595 | Unclassified | 1401 |
| 167 | Ga0307508_10000276 | 3300031616 | Bacteria | 63298 |
| 168 | Ga0265314_10003246 | 3300031711 | Bacteria | 15899 |
| 169 | Ga0265314_10003296 | 3300031711 | Bacteria | 15770 |
| 170 | Ga0265314_10059556 | 3300031711 | Bacteria | 2611 |
| 171 | Ga0265314_10118511 | 3300031711 | Bacteria | 1670 |
| 172 | Ga0265314_10175740 | 3300031711 | Bacteria | 1288 |
| 173 | Ga0265314_10318821 | 3300031711 | Bacteria | 865 |
| 174 | Ga0265342_10061321 | 3300031712 | Bacteria | 2216 |
| 175 | Ga0265342_10100669 | 3300031712 | Bacteria | 1646 |
| 176 | Ga0265342_10101085 | 3300031712 | Bacteria | 1642 |
| 177 | Ga0265342_10230188 | 3300031712 | Bacteria | 996 |
| 178 | Ga0307405_10545943 | 3300031731 | Bacteria | 937 |
| 179 | Ga0307405_10595344 | 3300031731 | Bacteria | 901 |
| 180 | Ga0307410_10032583 | 3300031852 | Bacteria | 3356 |
| 181 | Ga0307407_10399541 | 3300031903 | Bacteria | 985 |
| 182 | Ga0307412_10019382 | 3300031911 | Bacteria | 4119 |
| 183 | Ga0307409_100000037 | 3300031995 | Bacteria | 47029 |
| 184 | Ga0307409_100214674 | 3300031995 | Bacteria | 1732 |
| 185 | Ga0307409_100287149 | 3300031995 | Bacteria | 1524 |
| 186 | Ga0307409_101273858 | 3300031995 | Bacteria | 760 |
| 187 | Ga0307414_10067345 | 3300032004 | Bacteria | 2565 |
| 188 | Ga0307414_10307608 | 3300032004 | Bacteria | 1344 |
| 189 | Ga0307414_10486738 | 3300032004 | Bacteria | 1089 |
| 190 | Ga0307411_10295276 | 3300032005 | Bacteria | 1297 |
| 191 | Ga0307411_11724130 | 3300032005 | Bacteria | 580 |
| 192 | Ga0307507_10271706 | 3300033179 | Bacteria | 1070 |
| 193 | Ga0373950_0170736 | 3300034818 | Bacteria | 507 |
| 194 | Ga0373938_0054640 | 3300034957 | Bacteria | 920 |
| 195 | Ga0373928_0000445 | 3300035084 | Bacteria | 8163 |
| 196 | Ga0373929_0000680 | 3300035085 | Bacteria | 6562 |
| 197 | Ga0373944_0000109 | 3300035089 | Bacteria | 15141 |
| 198 | Ga0373949_0000902 | 3300035090 | Bacteria | 9274 |
| 199 | Ga0373951_0003696 | 3300035091 | Bacteria | 3691 |
| 200 | Ga0373952_0076265 | 3300035092 | Bacteria | 847 |
| 201 | Ga0373932_0000003 | 3300035112 | Bacteria | 459351 |
| 202 | Ga0373939_0036742 | 3300035114 | Bacteria | 1451 |
| 203 | Ga0373941_0060612 | 3300035115 | Bacteria | 1230 |
| 204 | Ga0373941_0226132 | 3300035115 | Bacteria | 721 |
| 205 | Ga0373945_0071495 | 3300035116 | Bacteria | 1314 |
| 206 | Ga0373953_0117871 | 3300035117 | Unclassified | 1126 |
| 207 | Ga0373954_0250052 | 3300035118 | Bacteria | 873 |
| 208 | Ga0373956_0053773 | 3300035119 | Unclassified | 1813 |
| 209 | Ga0373943_0092206 | 3300035170 | Bacteria | 1571 |
| 210 | Ga0373943_0254705 | 3300035170 | Bacteria | 987 |
| 211 | Ga0373955_0299850 | 3300035172 | Unclassified | 969 |
| 212 | Ga0373942_0071020 | 3300035207 | Bacteria | 1017 |
| 213 | Ga0373942_0158280 | 3300035207 | Bacteria | 731 |
| 214 | Ga0373961_0062472 | 3300035241 | Bacteria | 1134 |
| 215 | Ga0373962_0000069 | 3300035242 | Bacteria | 22606 |
| 216 | Ga0373931_0000054 | 3300035691 | Bacteria | 58930 |
| 217 | Ga0373931_0099434 | 3300035691 | Bacteria | 1634 |
| 218 | Ga0373927_0062778 | 3300035695 | Bacteria | 2402 |
| 219 | Ga0373927_0477403 | 3300035695 | Bacteria | 824 |
| 220 | Ga0373933_0187576 | 3300035724 | Unclassified | 1320 |
| 221 | Ga0373947_0212482 | 3300035725 | Bacteria | 1269 |
| 222 | Ga0373937_0002552 | 3300036401 | Bacteria | 15128 |
| 223 | Ga0373937_0289137 | 3300036401 | Bacteria | 1548 |
| 224 | Ga0373925_0002791 | 3300037068 | Bacteria | 13798 |
| 225 | Ga0373925_0045201 | 3300037068 | Bacteria | 3271 |
| 226 | Ga0373925_0819351 | 3300037068 | Bacteria | 767 |
| 227 | Ga0395905_0103171 | 3300037471 | Bacteria | 2677 |
| 228 | Ga0395901_0273026 | 3300038443 | Unclassified | 1758 |
| 229 | Ga0450921_004735 | 3300042123 | Bacteria | 1007 |
| 230 | Ga0439446_0078056 | 3300042156 | Bacteria | 1022 |
| 231 | Ga0451577_0000025 | 3300042876 | Bacteria | 403632 |
| 232 | Ga0451577_0005406 | 3300042876 | Bacteria | 13101 |
| 233 | Ga0451577_0031287 | 3300042876 | Bacteria | 4803 |
| 234 | Ga0451577_0059811 | 3300042876 | Bacteria | 3397 |
| 235 | Ga0451577_0183847 | 3300042876 | Bacteria | 1885 |
| 236 | Ga0451577_0259131 | 3300042876 | Bacteria | 1575 |
| 237 | Ga0451577_1213786 | 3300042876 | Bacteria | 672 |
| 238 | Ga0453683_0114982 | 3300044673 | Bacteria | 1692 |
| 239 | Ga0453683_0669445 | 3300044673 | Bacteria | 679 |
| 240 | Ga0466966_0052170 | 3300044684 | Bacteria | 2599 |
| 241 | Ga0466961_0054970 | 3300044693 | Bacteria | 2539 |
| 242 | Ga0453684_0000266 | 3300044712 | Bacteria | 225447 |
| 243 | Ga0453684_0030738 | 3300044712 | Bacteria | 7576 |
| 244 | Ga0453684_0031372 | 3300044712 | Bacteria | 7472 |
| 245 | Ga0453684_0102565 | 3300044712 | Bacteria | 3498 |
| 246 | Ga0466959_0269172 | 3300045049 | Bacteria | 1171 |
| 247 | Ga0451576_0024779 | 3300045051 | Bacteria | 6475 |
| 248 | Ga0451576_0072026 | 3300045051 | Bacteria | 3597 |
| 249 | Ga0451576_0082442 | 3300045051 | Bacteria | 3345 |
| 250 | Ga0451576_0103863 | 3300045051 | Bacteria | 2956 |
| 251 | Ga0451576_0124749 | 3300045051 | Bacteria | 2683 |
| 252 | Ga0451576_0205553 | 3300045051 | Bacteria | 2056 |
| 253 | Ga0451576_0230436 | 3300045051 | Bacteria | 1935 |
| 254 | Ga0451576_0566447 | 3300045051 | Unclassified | 1193 |
| 255 | Ga0451576_0830168 | 3300045051 | Bacteria | 970 |
| 256 | Ga0495629_0006700 | 3300046459 | Bacteria | 8518 |
| 257 | Ga0495580_0141505 | 3300046472 | Bacteria | 1667 |
| 258 | Ga0495582_0011324 | 3300046473 | Bacteria | 4914 |
| 259 | Ga0495639_0056972 | 3300046475 | Bacteria | 1785 |
| 260 | Ga0495664_0463675 | 3300046477 | Bacteria | 758 |
| 261 | Ga0495594_0633488 | 3300046499 | Bacteria | 606 |
| 262 | Ga0495608_0054440 | 3300046511 | Bacteria | 2645 |
| 263 | Ga0495618_0001918 | 3300046514 | Bacteria | 13659 |
| 264 | Ga0495618_0346433 | 3300046514 | Bacteria | 916 |
| 265 | Ga0495630_0012873 | 3300046517 | Bacteria | 6077 |
| 266 | Ga0495630_0051867 | 3300046517 | Bacteria | 3071 |
| 267 | Ga0495630_0588916 | 3300046517 | Bacteria | 853 |
| 268 | Ga0495666_0351468 | 3300046526 | Bacteria | 664 |
| 269 | Ga0495640_0059273 | 3300046533 | Bacteria | 2608 |
| 270 | Ga0495640_0069095 | 3300046533 | Unclassified | 2376 |
| 271 | Ga0495640_0119474 | 3300046533 | Bacteria | 1715 |
| 272 | Ga0495586_0001064 | 3300046535 | Bacteria | 15493 |
| 273 | Ga0495586_0012494 | 3300046535 | Bacteria | 4505 |
| 274 | Ga0495586_0197974 | 3300046535 | Bacteria | 1138 |
| 275 | Ga0495622_0073191 | 3300046557 | Bacteria | 1581 |
| 276 | Ga0495667_0068829 | 3300046559 | Bacteria | 2311 |
| 277 | Ga0495667_0161834 | 3300046559 | Bacteria | 1439 |
| 278 | Ga0495634_0003274 | 3300046642 | Bacteria | 13068 |
| 279 | Ga0495635_0072538 | 3300046663 | Unclassified | 2359 |
| 280 | Ga0495657_0219859 | 3300046675 | Bacteria | 1152 |
| 281 | Ga0495657_0221150 | 3300046675 | Bacteria | 1148 |
| 282 | Ga0495657_0513245 | 3300046675 | Unclassified | 698 |
| 283 | Ga0495646_0380844 | 3300046680 | Bacteria | 736 |
| 284 | Ga0495647_0137907 | 3300046681 | Unclassified | 1038 |
| 285 | Ga0495613_0003460 | 3300046689 | Bacteria | 11805 |
| 286 | Ga0495613_0687782 | 3300046689 | Bacteria | 674 |
| 287 | Ga0495581_0585743 | 3300047315 | Unclassified | 646 |
| 288 | Ga0495604_0988364 | 3300047317 | Bacteria | 521 |
| 289 | Ga0495674_0129505 | 3300047319 | Unclassified | 2127 |
| 290 | Ga0495680_0002262 | 3300047322 | Bacteria | 19840 |
| 291 | Ga0495680_0160438 | 3300047322 | Bacteria | 1633 |
| 292 | Ga0495675_0362768 | 3300047444 | Bacteria | 850 |
| 293 | Ga0495684_0011576 | 3300047471 | Bacteria | 6810 |
| 294 | Ga0501309_002850 | 3300049129 | Bacteria | 1911 |
| 295 | Ga0501305_000001 | 3300049161 | Bacteria | 19709 |
| 296 | Ga0501305_000061 | 3300049161 | Bacteria | 6159 |
| 297 | Ga0501305_016276 | 3300049161 | Bacteria | 1059 |
| 298 | Ga0501307_000001 | 3300049162 | Bacteria | 10981 |
| 299 | Ga0501312_000001 | 3300049528 | Bacteria | 18666 |
| 300 | Ga0501312_001427 | 3300049528 | Bacteria | 2342 |
| 301 | Ga0501312_003794 | 3300049528 | Bacteria | 1743 |
| 302 | Ga0501032_0000512 | 3300049569 | Bacteria | 31496 |
| 303 | Ga0501032_0004293 | 3300049569 | Bacteria | 10761 |
| 304 | Ga0501033_0006719 | 3300049570 | Bacteria | 8988 |
| 305 | Ga0501033_0649115 | 3300049570 | Bacteria | 721 |
| 306 | Ga0501034_0127451 | 3300049571 | Bacteria | 2530 |
| 307 | Ga0501036_0262155 | 3300049572 | Bacteria | 1448 |
| 308 | Ga0501036_1397680 | 3300049572 | Bacteria | 567 |
| 309 | Ga0501037_0018702 | 3300049573 | Bacteria | 5106 |
| 310 | Ga0501038_0119634 | 3300049574 | Bacteria | 2174 |
| 311 | Ga0501039_1151662 | 3300049575 | Bacteria | 600 |
| 312 | Ga0501042_0311547 | 3300049578 | Bacteria | 1137 |
| 313 | Ga0501043_0161793 | 3300049579 | Bacteria | 1749 |
| 314 | Ga0501043_0505470 | 3300049579 | Bacteria | 902 |
| 315 | Ga0501046_0005999 | 3300049580 | Bacteria | 10806 |
| 316 | Ga0501046_0155426 | 3300049580 | Bacteria | 1723 |
| 317 | Ga0501047_0042858 | 3300049581 | Bacteria | 4372 |
| 318 | Ga0501047_0086476 | 3300049581 | Bacteria | 3012 |
| 319 | Ga0501047_0099688 | 3300049581 | Bacteria | 2784 |
| 320 | Ga0501047_0277133 | 3300049581 | Bacteria | 1522 |
| 321 | Ga0501048_0015870 | 3300049582 | Bacteria | 5558 |
| 322 | Ga0501048_0374219 | 3300049582 | Bacteria | 1017 |
| 323 | Ga0501070_0033242 | 3300049586 | Bacteria | 4316 |
| 324 | Ga0501070_0797645 | 3300049586 | Bacteria | 742 |
| 325 | Ga0501071_0300523 | 3300049587 | Bacteria | 1217 |
| 326 | Ga0501075_0118681 | 3300049591 | Bacteria | 2012 |
| 327 | Ga0501217_195821 | 3300049661 | Bacteria | 627 |
| 328 | Ga0501222_020784 | 3300049662 | Bacteria | 879 |
| 329 | Ga0501257_093411 | 3300049686 | Bacteria | 784 |
| 330 | Ga0501229_007518 | 3300049706 | Bacteria | 1357 |
| 331 | Ga0501079_0346438 | 3300049741 | Bacteria | 1164 |
| 332 | Ga0501080_0872021 | 3300049742 | Bacteria | 786 |
| 333 | Ga0501083_0029020 | 3300049744 | Bacteria | 3810 |
| 334 | Ga0501083_0029090 | 3300049744 | Bacteria | 3804 |
| 335 | Ga0501268_058850 | 3300049765 | Bacteria | 758 |
| 336 | Ga0501035_0159308 | 3300049822 | Bacteria | 1955 |
| 337 | Ga0501044_0000188 | 3300049823 | Bacteria | 77610 |
| 338 | Ga0501044_0041030 | 3300049823 | Bacteria | 4818 |
| 339 | Ga0501044_0275081 | 3300049823 | Bacteria | 1619 |
| 340 | nmdc:mga08y16_191003_c1 | 3300050511 | Bacteria | 2124 |
| 341 | nmdc:mga08y16_279504_c1 | 3300050511 | Bacteria | 1722 |
| 342 | nmdc:mga08y16_331212_c1 | 3300050511 | Bacteria | 1566 |
| 343 | nmdc:mga0n895_822902_c1 | 3300050512 | Bacteria | 918 |
| 344 | nmdc:mga0rr50_673721_c1 | 3300050513 | Bacteria | 883 |
| 345 | nmdc:mga08x19_970254_c1 | 3300050514 | Bacteria | 604 |
| 346 | Ga0500636_0152455 | 3300053177 | Bacteria | 1268 |
| 347 | Ga0501084_0836536 | 3300054114 | Bacteria | 775 |
| 348 | Ga0501084_1780565 | 3300054114 | Bacteria | 514 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031344 | Ga0265316_10251325 | Ga0265316_102513252 | 110 |
| 2 | 3300036401 | Ga0373937_0289137 | Ga0373937_0289137_1068_1538 | 112 |
| 3 | 3300037471 | Ga0395905_0103171 | Ga0395905_0103171_642_1232 | 113 |
| 4 | 3300038443 | Ga0395901_0273026 | Ga0395901_0273026_59_649 | 113 |
| 5 | 3300049742 | Ga0501080_0872021 | Ga0501080_0872021_10_420 | 113 |
| 6 | 3300009093 | Ga0105240_10048597 | Ga0105240_100485975 | 116 |
| 7 | 3300025913 | Ga0207695_10035918 | Ga0207695_100359187 | 116 |
| 8 | 3300028558 | Ga0265326_10016196 | Ga0265326_100161961 | 116 |
| 9 | 3300029957 | Ga0265324_10004423 | Ga0265324_100044239 | 116 |
| 10 | 3300031241 | Ga0265325_10004414 | Ga0265325_100044143 | 116 |
| 11 | 3300031344 | Ga0265316_10256352 | Ga0265316_102563522 | 116 |
| 12 | 3300035084 | Ga0373928_0000445 | Ga0373928_0000445_528_1001 | 116 |
| 13 | 3300035085 | Ga0373929_0000680 | Ga0373929_0000680_4707_5180 | 116 |
| 14 | 3300035089 | Ga0373944_0000109 | Ga0373944_0000109_7315_7788 | 116 |
| 15 | 3300035090 | Ga0373949_0000902 | Ga0373949_0000902_1737_2210 | 116 |
| 16 | 3300035091 | Ga0373951_0003696 | Ga0373951_0003696_437_910 | 116 |
| 17 | 3300035112 | Ga0373932_0000003 | Ga0373932_0000003_264359_264832 | 116 |
| 18 | 3300035116 | Ga0373945_0071495 | Ga0373945_0071495_220_693 | 116 |
| 19 | 3300035170 | Ga0373943_0092206 | Ga0373943_0092206_66_539 | 116 |
| 20 | 3300035207 | Ga0373942_0158280 | Ga0373942_0158280_115_588 | 116 |
| 21 | 3300035241 | Ga0373961_0062472 | Ga0373961_0062472_283_756 | 116 |
| 22 | 3300035242 | Ga0373962_0000069 | Ga0373962_0000069_9031_9504 | 116 |
| 23 | 3300035691 | Ga0373931_0000054 | Ga0373931_0000054_5124_5597 | 116 |
| 24 | 3300035695 | Ga0373927_0062778 | Ga0373927_0062778_282_755 | 116 |
| 25 | 3300035725 | Ga0373947_0212482 | Ga0373947_0212482_72_545 | 116 |
| 26 | 3300037068 | Ga0373925_0002791 | Ga0373925_0002791_11059_11532 | 116 |
| 27 | 3300045051 | Ga0451576_0024779 | Ga0451576_0024779_2225_2695 | 116 |
| 28 | 3300053177 | Ga0500636_0152455 | Ga0500636_0152455_648_1124 | 116 |
| 29 | 3300005340 | Ga0070689_100092578 | Ga0070689_1000925782 | 117 |
| 30 | 3300005439 | Ga0070711_100006330 | Ga0070711_1000063303 | 117 |
| 31 | 3300005440 | Ga0070705_100221310 | Ga0070705_1002213102 | 117 |
| 32 | 3300005445 | Ga0070708_100072631 | Ga0070708_1000726313 | 117 |
| 33 | 3300005466 | Ga0070685_10073746 | Ga0070685_100737462 | 117 |
| 34 | 3300005468 | Ga0070707_101208923 | Ga0070707_1012089232 | 117 |
| 35 | 3300005471 | Ga0070698_101653466 | Ga0070698_1016534661 | 117 |
| 36 | 3300005518 | Ga0070699_100743323 | Ga0070699_1007433232 | 117 |
| 37 | 3300005536 | Ga0070697_100779019 | Ga0070697_1007790192 | 117 |
| 38 | 3300005539 | Ga0068853_100737567 | Ga0068853_1007375672 | 117 |
| 39 | 3300005617 | Ga0068859_100111842 | Ga0068859_1001118424 | 117 |
| 40 | 3300005841 | Ga0068863_100005833 | Ga0068863_10000583310 | 117 |
| 41 | 3300006844 | Ga0075428_100352375 | Ga0075428_1003523752 | 117 |
| 42 | 3300006871 | Ga0075434_100894325 | Ga0075434_1008943252 | 117 |
| 43 | 3300006931 | Ga0097620_100111843 | Ga0097620_1001118434 | 117 |
| 44 | 3300009094 | Ga0111539_10117291 | Ga0111539_101172915 | 117 |
| 45 | 3300009094 | Ga0111539_10259268 | Ga0111539_102592682 | 117 |
| 46 | 3300009094 | Ga0111539_10391535 | Ga0111539_103915352 | 117 |
| 47 | 3300009177 | Ga0105248_10834222 | Ga0105248_108342222 | 117 |
| 48 | 3300013307 | Ga0157372_10732983 | Ga0157372_107329832 | 117 |
| 49 | 3300013307 | Ga0157372_11129745 | Ga0157372_111297452 | 117 |
| 50 | 3300013308 | Ga0157375_11978615 | Ga0157375_119786151 | 117 |
| 51 | 3300025885 | Ga0207653_10111588 | Ga0207653_101115881 | 117 |
| 52 | 3300025916 | Ga0207663_10090704 | Ga0207663_100907043 | 117 |
| 53 | 3300025936 | Ga0207670_10081755 | Ga0207670_100817554 | 117 |
| 54 | 3300025936 | Ga0207670_10369746 | Ga0207670_103697462 | 117 |
| 55 | 3300025940 | Ga0207691_10799361 | Ga0207691_107993612 | 117 |
| 56 | 3300025941 | Ga0207711_11045247 | Ga0207711_110452472 | 117 |
| 57 | 3300026023 | Ga0207677_10656189 | Ga0207677_106561892 | 117 |
| 58 | 3300026035 | Ga0207703_11832540 | Ga0207703_118325401 | 117 |
| 59 | 3300026088 | Ga0207641_10018981 | Ga0207641_100189813 | 117 |
| 60 | 3300028556 | Ga0265337_1001120 | Ga0265337_100112015 | 117 |
| 61 | 3300028556 | Ga0265337_1019752 | Ga0265337_10197522 | 117 |
| 62 | 3300028556 | Ga0265337_1029574 | Ga0265337_10295742 | 117 |
| 63 | 3300028556 | Ga0265337_1046647 | Ga0265337_10466472 | 117 |
| 64 | 3300028563 | Ga0265319_1000019 | Ga0265319_1000019159 | 117 |
| 65 | 3300028563 | Ga0265319_1027502 | Ga0265319_10275022 | 117 |
| 66 | 3300028563 | Ga0265319_1027556 | Ga0265319_10275564 | 117 |
| 67 | 3300028573 | Ga0265334_10021751 | Ga0265334_100217515 | 117 |
| 68 | 3300028577 | Ga0265318_10014814 | Ga0265318_100148143 | 117 |
| 69 | 3300028577 | Ga0265318_10036088 | Ga0265318_100360882 | 117 |
| 70 | 3300028653 | Ga0265323_10017621 | Ga0265323_100176212 | 117 |
| 71 | 3300028666 | Ga0265336_10010063 | Ga0265336_100100632 | 117 |
| 72 | 3300028666 | Ga0265336_10021362 | Ga0265336_100213622 | 117 |
| 73 | 3300028666 | Ga0265336_10023291 | Ga0265336_100232912 | 117 |
| 74 | 3300028666 | Ga0265336_10085686 | Ga0265336_100856862 | 117 |
| 75 | 3300028800 | Ga0265338_10001116 | Ga0265338_1000111631 | 117 |
| 76 | 3300028800 | Ga0265338_10004347 | Ga0265338_1000434715 | 117 |
| 77 | 3300028800 | Ga0265338_10036317 | Ga0265338_100363174 | 117 |
| 78 | 3300028800 | Ga0265338_10102880 | Ga0265338_101028802 | 117 |
| 79 | 3300028800 | Ga0265338_10131360 | Ga0265338_101313602 | 117 |
| 80 | 3300028800 | Ga0265338_10294358 | Ga0265338_102943582 | 117 |
| 81 | 3300028800 | Ga0265338_10356766 | Ga0265338_103567662 | 117 |
| 82 | 3300029957 | Ga0265324_10030484 | Ga0265324_100304842 | 117 |
| 83 | 3300031240 | Ga0265320_10036164 | Ga0265320_100361642 | 117 |
| 84 | 3300031240 | Ga0265320_10040309 | Ga0265320_100403092 | 117 |
| 85 | 3300031240 | Ga0265320_10057438 | Ga0265320_100574382 | 117 |
| 86 | 3300031240 | Ga0265320_10113647 | Ga0265320_101136472 | 117 |
| 87 | 3300031241 | Ga0265325_10101618 | Ga0265325_101016183 | 117 |
| 88 | 3300031247 | Ga0265340_10031140 | Ga0265340_100311404 | 117 |
| 89 | 3300031247 | Ga0265340_10056515 | Ga0265340_100565151 | 117 |
| 90 | 3300031247 | Ga0265340_10060297 | Ga0265340_100602972 | 117 |
| 91 | 3300031249 | Ga0265339_10289177 | Ga0265339_102891771 | 117 |
| 92 | 3300031344 | Ga0265316_10013603 | Ga0265316_100136034 | 117 |
| 93 | 3300031344 | Ga0265316_10075585 | Ga0265316_100755854 | 117 |
| 94 | 3300031344 | Ga0265316_10094336 | Ga0265316_100943363 | 117 |
| 95 | 3300031344 | Ga0265316_10149061 | Ga0265316_101490612 | 117 |
| 96 | 3300031548 | Ga0307408_100708916 | Ga0307408_1007089162 | 117 |
| 97 | 3300031595 | Ga0265313_10000967 | Ga0265313_100009673 | 117 |
| 98 | 3300031595 | Ga0265313_10087769 | Ga0265313_100877692 | 117 |
| 99 | 3300031711 | Ga0265314_10175740 | Ga0265314_101757402 | 117 |
| 100 | 3300031712 | Ga0265342_10101085 | Ga0265342_101010853 | 117 |
| 101 | 3300031712 | Ga0265342_10230188 | Ga0265342_102301882 | 117 |
| 102 | 3300031731 | Ga0307405_10595344 | Ga0307405_105953442 | 117 |
| 103 | 3300031852 | Ga0307410_10032583 | Ga0307410_100325834 | 117 |
| 104 | 3300031911 | Ga0307412_10019382 | Ga0307412_100193824 | 117 |
| 105 | 3300031995 | Ga0307409_100214674 | Ga0307409_1002146743 | 117 |
| 106 | 3300031995 | Ga0307409_100287149 | Ga0307409_1002871492 | 117 |
| 107 | 3300031995 | Ga0307409_101273858 | Ga0307409_1012738581 | 117 |
| 108 | 3300032004 | Ga0307414_10307608 | Ga0307414_103076083 | 117 |
| 109 | 3300032005 | Ga0307411_11724130 | Ga0307411_117241301 | 117 |
| 110 | 3300035117 | Ga0373953_0117871 | Ga0373953_0117871_282_755 | 117 |
| 111 | 3300035119 | Ga0373956_0053773 | Ga0373956_0053773_469_942 | 117 |
| 112 | 3300035170 | Ga0373943_0254705 | Ga0373943_0254705_481_954 | 117 |
| 113 | 3300035172 | Ga0373955_0299850 | Ga0373955_0299850_245_718 | 117 |
| 114 | 3300035695 | Ga0373927_0477403 | Ga0373927_0477403_96_581 | 117 |
| 115 | 3300035724 | Ga0373933_0187576 | Ga0373933_0187576_329_802 | 117 |
| 116 | 3300036401 | Ga0373937_0002552 | Ga0373937_0002552_4869_5342 | 117 |
| 117 | 3300037068 | Ga0373925_0819351 | Ga0373925_0819351_147_620 | 117 |
| 118 | 3300042876 | Ga0451577_0031287 | Ga0451577_0031287_2580_3056 | 117 |
| 119 | 3300045051 | Ga0451576_0072026 | Ga0451576_0072026_20_496 | 117 |
| 120 | 3300045051 | Ga0451576_0082442 | Ga0451576_0082442_331_804 | 117 |
| 121 | 3300045051 | Ga0451576_0230436 | Ga0451576_0230436_771_1244 | 117 |
| 122 | 3300045051 | Ga0451576_0566447 | Ga0451576_0566447_150_623 | 117 |
| 123 | 3300046459 | Ga0495629_0006700 | Ga0495629_0006700_767_1240 | 117 |
| 124 | 3300046511 | Ga0495608_0054440 | Ga0495608_0054440_1615_2100 | 117 |
| 125 | 3300046514 | Ga0495618_0001918 | Ga0495618_0001918_11528_12001 | 117 |
| 126 | 3300046517 | Ga0495630_0012873 | Ga0495630_0012873_4514_4999 | 117 |
| 127 | 3300046517 | Ga0495630_0051867 | Ga0495630_0051867_1173_1646 | 117 |
| 128 | 3300046517 | Ga0495630_0588916 | Ga0495630_0588916_98_604 | 117 |
| 129 | 3300046526 | Ga0495666_0351468 | Ga0495666_0351468_169_654 | 117 |
| 130 | 3300046533 | Ga0495640_0059273 | Ga0495640_0059273_256_741 | 117 |
| 131 | 3300046533 | Ga0495640_0069095 | Ga0495640_0069095_467_940 | 117 |
| 132 | 3300046533 | Ga0495640_0119474 | Ga0495640_0119474_162_647 | 117 |
| 133 | 3300046535 | Ga0495586_0001064 | Ga0495586_0001064_7749_8222 | 117 |
| 134 | 3300046535 | Ga0495586_0197974 | Ga0495586_0197974_541_1026 | 117 |
| 135 | 3300046559 | Ga0495667_0068829 | Ga0495667_0068829_779_1252 | 117 |
| 136 | 3300046559 | Ga0495667_0161834 | Ga0495667_0161834_752_1237 | 117 |
| 137 | 3300046642 | Ga0495634_0003274 | Ga0495634_0003274_4946_5419 | 117 |
| 138 | 3300046663 | Ga0495635_0072538 | Ga0495635_0072538_1605_2078 | 117 |
| 139 | 3300046675 | Ga0495657_0219859 | Ga0495657_0219859_601_1086 | 117 |
| 140 | 3300046675 | Ga0495657_0221150 | Ga0495657_0221150_25_498 | 117 |
| 141 | 3300046675 | Ga0495657_0513245 | Ga0495657_0513245_16_501 | 117 |
| 142 | 3300046680 | Ga0495646_0380844 | Ga0495646_0380844_241_714 | 117 |
| 143 | 3300046681 | Ga0495647_0137907 | Ga0495647_0137907_201_674 | 117 |
| 144 | 3300046689 | Ga0495613_0003460 | Ga0495613_0003460_4853_5326 | 117 |
| 145 | 3300046689 | Ga0495613_0687782 | Ga0495613_0687782_156_641 | 117 |
| 146 | 3300047315 | Ga0495581_0585743 | Ga0495581_0585743_156_629 | 117 |
| 147 | 3300047317 | Ga0495604_0988364 | Ga0495604_0988364_12_497 | 117 |
| 148 | 3300047319 | Ga0495674_0129505 | Ga0495674_0129505_1168_1641 | 117 |
| 149 | 3300047322 | Ga0495680_0002262 | Ga0495680_0002262_6504_6977 | 117 |
| 150 | 3300047322 | Ga0495680_0160438 | Ga0495680_0160438_17_502 | 117 |
| 151 | 3300047444 | Ga0495675_0362768 | Ga0495675_0362768_340_825 | 117 |
| 152 | 3300047471 | Ga0495684_0011576 | Ga0495684_0011576_373_846 | 117 |
| 153 | 3300049528 | Ga0501312_003794 | Ga0501312_003794_481_951 | 117 |
| 154 | 3300049571 | Ga0501034_0127451 | Ga0501034_0127451_708_1181 | 117 |
| 155 | 3300049575 | Ga0501039_1151662 | Ga0501039_1151662_96_569 | 117 |
| 156 | 3300049581 | Ga0501047_0099688 | Ga0501047_0099688_1776_2249 | 117 |
| 157 | 3300049661 | Ga0501217_195821 | Ga0501217_195821_64_534 | 117 |
| 158 | 3300049662 | Ga0501222_020784 | Ga0501222_020784_305_775 | 117 |
| 159 | 3300049765 | Ga0501268_058850 | Ga0501268_058850_46_516 | 117 |
| 160 | 3300049822 | Ga0501035_0159308 | Ga0501035_0159308_945_1418 | 117 |
| 161 | 3300049823 | Ga0501044_0275081 | Ga0501044_0275081_1079_1552 | 117 |
| 162 | 3300050511 | nmdc:mga08y16_191003_c1 | nmdc:mga08y16_191003_c1_720_1193 | 117 |
| 163 | 3300050511 | nmdc:mga08y16_279504_c1 | nmdc:mga08y16_279504_c1_538_1011 | 117 |
| 164 | 3300050511 | nmdc:mga08y16_331212_c1 | nmdc:mga08y16_331212_c1_346_819 | 117 |
| 165 | 3300050512 | nmdc:mga0n895_822902_c1 | nmdc:mga0n895_822902_c1_191_664 | 117 |
| 166 | 3300005330 | Ga0070690_100082565 | Ga0070690_1000825654 | 118 |
| 167 | 3300005563 | Ga0068855_100031040 | Ga0068855_1000310402 | 118 |
| 168 | 3300005841 | Ga0068863_100237481 | Ga0068863_1002374812 | 118 |
| 169 | 3300009551 | Ga0105238_10294462 | Ga0105238_102944622 | 118 |
| 170 | 3300025924 | Ga0207694_10256823 | Ga0207694_102568232 | 118 |
| 171 | 3300025949 | Ga0207667_10025777 | Ga0207667_1002577714 | 118 |
| 172 | 3300026078 | Ga0207702_10039402 | Ga0207702_100394022 | 118 |
| 173 | 3300028800 | Ga0265338_10118405 | Ga0265338_101184052 | 118 |
| 174 | 3300034957 | Ga0373938_0054640 | Ga0373938_0054640_435_908 | 118 |
| 175 | 3300035115 | Ga0373941_0060612 | Ga0373941_0060612_93_566 | 118 |
| 176 | 3300045051 | Ga0451576_0103863 | Ga0451576_0103863_496_981 | 118 |
| 177 | 3300037068 | Ga0373925_0045201 | Ga0373925_0045201_2034_2486 | 119 |
| 178 | 3300046473 | Ga0495582_0011324 | Ga0495582_0011324_163_615 | 119 |
| 179 | 3300046475 | Ga0495639_0056972 | Ga0495639_0056972_1198_1650 | 119 |
| 180 | 3300046535 | Ga0495586_0012494 | Ga0495586_0012494_1371_1823 | 119 |
| 181 | 3300035118 | Ga0373954_0250052 | Ga0373954_0250052_35_520 | 120 |
| 182 | 3300005441 | Ga0070700_100212450 | Ga0070700_1002124502 | 121 |
| 183 | 3300006914 | Ga0075436_101198206 | Ga0075436_1011982061 | 121 |
| 184 | 3300035092 | Ga0373952_0076265 | Ga0373952_0076265_250_702 | 121 |
| 185 | 3300035114 | Ga0373939_0036742 | Ga0373939_0036742_57_509 | 121 |
| 186 | 3300035691 | Ga0373931_0099434 | Ga0373931_0099434_183_635 | 121 |
| 187 | 3300044673 | Ga0453683_0669445 | Ga0453683_0669445_79_531 | 121 |
| 188 | 3300045051 | Ga0451576_0830168 | Ga0451576_0830168_440_892 | 121 |
| 189 | 3300046472 | Ga0495580_0141505 | Ga0495580_0141505_408_860 | 121 |
| 190 | 3300046477 | Ga0495664_0463675 | Ga0495664_0463675_73_516 | 121 |
| 191 | 3300046514 | Ga0495618_0346433 | Ga0495618_0346433_75_518 | 121 |
| 192 | 3300050513 | nmdc:mga0rr50_673721_c1 | nmdc:mga0rr50_673721_c1_103_555 | 121 |
| 193 | 3300050514 | nmdc:mga08x19_970254_c1 | nmdc:mga08x19_970254_c1_85_537 | 121 |
| 194 | 3300049582 | Ga0501048_0374219 | Ga0501048_0374219_110_547 | 122 |
| 195 | 3300049587 | Ga0501071_0300523 | Ga0501071_0300523_767_1204 | 122 |
| 196 | 3300049591 | Ga0501075_0118681 | Ga0501075_0118681_439_876 | 122 |
| 197 | 3300044673 | Ga0453683_0114982 | Ga0453683_0114982_494_940 | 123 |
| 198 | 3300005471 | Ga0070698_100491166 | Ga0070698_1004911662 | 124 |
| 199 | 3300027543 | Ga0209999_1017218 | Ga0209999_10172182 | 124 |
| 200 | 3300027682 | Ga0209971_1013375 | Ga0209971_10133751 | 124 |
| 201 | 3300027876 | Ga0209974_10001132 | Ga0209974_1000113213 | 124 |
| 202 | 3300042123 | Ga0450921_004735 | Ga0450921_004735_127_579 | 124 |
| 203 | 3300042156 | Ga0439446_0078056 | Ga0439446_0078056_341_793 | 124 |
| 204 | 3300049578 | Ga0501042_0311547 | Ga0501042_0311547_288_740 | 124 |
| 205 | 3300049741 | Ga0501079_0346438 | Ga0501079_0346438_396_848 | 124 |
| 206 | 3300054114 | Ga0501084_0836536 | Ga0501084_0836536_34_486 | 124 |
| 207 | 3300054114 | Ga0501084_1780565 | Ga0501084_1780565_31_483 | 124 |
| 208 | 3300005288 | Ga0065714_10126941 | Ga0065714_101269412 | 125 |
| 209 | 3300005290 | Ga0065712_10146816 | Ga0065712_101468161 | 125 |
| 210 | 3300005293 | Ga0065715_10166952 | Ga0065715_101669522 | 125 |
| 211 | 3300005331 | Ga0070670_100004112 | Ga0070670_1000041126 | 125 |
| 212 | 3300005334 | Ga0068869_100069995 | Ga0068869_1000699952 | 125 |
| 213 | 3300005340 | Ga0070689_100149080 | Ga0070689_1001490804 | 125 |
| 214 | 3300005341 | Ga0070691_10452699 | Ga0070691_104526991 | 125 |
| 215 | 3300005365 | Ga0070688_100002613 | Ga0070688_1000026132 | 125 |
| 216 | 3300005438 | Ga0070701_10248487 | Ga0070701_102484872 | 125 |
| 217 | 3300005441 | Ga0070700_100182447 | Ga0070700_1001824473 | 125 |
| 218 | 3300005459 | Ga0068867_100156978 | Ga0068867_1001569782 | 125 |
| 219 | 3300005466 | Ga0070685_10111006 | Ga0070685_101110062 | 125 |
| 220 | 3300005564 | Ga0070664_100535722 | Ga0070664_1005357222 | 125 |
| 221 | 3300005577 | Ga0068857_100012236 | Ga0068857_1000122368 | 125 |
| 222 | 3300005617 | Ga0068859_100382606 | Ga0068859_1003826063 | 125 |
| 223 | 3300005618 | Ga0068864_100069385 | Ga0068864_1000693856 | 125 |
| 224 | 3300005718 | Ga0068866_10408242 | Ga0068866_104082422 | 125 |
| 225 | 3300005719 | Ga0068861_100643876 | Ga0068861_1006438761 | 125 |
| 226 | 3300005844 | Ga0068862_100245044 | Ga0068862_1002450444 | 125 |
| 227 | 3300006881 | Ga0068865_100087049 | Ga0068865_1000870493 | 125 |
| 228 | 3300006931 | Ga0097620_100382591 | Ga0097620_1003825912 | 125 |
| 229 | 3300009176 | Ga0105242_10006482 | Ga0105242_1000648210 | 125 |
| 230 | 3300013308 | Ga0157375_12252569 | Ga0157375_122525692 | 125 |
| 231 | 3300014326 | Ga0157380_10422209 | Ga0157380_104222092 | 125 |
| 232 | 3300014745 | Ga0157377_10017579 | Ga0157377_100175793 | 125 |
| 233 | 3300025899 | Ga0207642_10298603 | Ga0207642_102986031 | 125 |
| 234 | 3300025908 | Ga0207643_10025012 | Ga0207643_100250122 | 125 |
| 235 | 3300025925 | Ga0207650_10017211 | Ga0207650_100172116 | 125 |
| 236 | 3300025938 | Ga0207704_10227467 | Ga0207704_102274672 | 125 |
| 237 | 3300025942 | Ga0207689_10091955 | Ga0207689_100919553 | 125 |
| 238 | 3300026116 | Ga0207674_10018919 | Ga0207674_100189199 | 125 |
| 239 | 3300046499 | Ga0495594_0633488 | Ga0495594_0633488_80_532 | 125 |
| 240 | 3300028558 | Ga0265326_10065325 | Ga0265326_100653252 | 126 |
| 241 | 3300028563 | Ga0265319_1002872 | Ga0265319_10028727 | 126 |
| 242 | 3300028577 | Ga0265318_10000422 | Ga0265318_100004223 | 126 |
| 243 | 3300029957 | Ga0265324_10067824 | Ga0265324_100678242 | 126 |
| 244 | 3300031238 | Ga0265332_10018067 | Ga0265332_100180672 | 126 |
| 245 | 3300031240 | Ga0265320_10000430 | Ga0265320_1000043028 | 126 |
| 246 | 3300031251 | Ga0265327_10463467 | Ga0265327_104634671 | 126 |
| 247 | 3300031344 | Ga0265316_10168857 | Ga0265316_101688572 | 126 |
| 248 | 3300031711 | Ga0265314_10318821 | Ga0265314_103188212 | 126 |
| 249 | 3300031712 | Ga0265342_10100669 | Ga0265342_101006692 | 126 |
| 250 | 3300034818 | Ga0373950_0170736 | Ga0373950_0170736_19_465 | 126 |
| 251 | 3300035207 | Ga0373942_0071020 | Ga0373942_0071020_189_635 | 126 |
| 252 | 3300042876 | Ga0451577_0000025 | Ga0451577_0000025_150524_150970 | 126 |
| 253 | 3300042876 | Ga0451577_0183847 | Ga0451577_0183847_725_1171 | 126 |
| 254 | 3300044684 | Ga0466966_0052170 | Ga0466966_0052170_1907_2353 | 126 |
| 255 | 3300044693 | Ga0466961_0054970 | Ga0466961_0054970_2051_2497 | 126 |
| 256 | 3300044712 | Ga0453684_0030738 | Ga0453684_0030738_5599_6045 | 126 |
| 257 | 3300045049 | Ga0466959_0269172 | Ga0466959_0269172_77_523 | 126 |
| 258 | 3300045051 | Ga0451576_0205553 | Ga0451576_0205553_325_771 | 126 |
| 259 | 3300046557 | Ga0495622_0073191 | Ga0495622_0073191_949_1422 | 126 |
| 260 | 3300049570 | Ga0501033_0649115 | Ga0501033_0649115_205_651 | 126 |
| 261 | 3300049744 | Ga0501083_0029020 | Ga0501083_0029020_2785_3231 | 126 |
| 262 | 3300049744 | Ga0501083_0029090 | Ga0501083_0029090_3238_3684 | 126 |
| 263 | 3300003323 | rootH1_10011452 | rootH1_1001145222 | 127 |
| 264 | 3300005329 | Ga0070683_100176940 | Ga0070683_1001769402 | 127 |
| 265 | 3300005331 | Ga0070670_102076190 | Ga0070670_1020761901 | 127 |
| 266 | 3300005458 | Ga0070681_10420650 | Ga0070681_104206502 | 127 |
| 267 | 3300005530 | Ga0070679_100012053 | Ga0070679_10001205316 | 127 |
| 268 | 3300006028 | Ga0070717_10000003 | Ga0070717_10000003248 | 127 |
| 269 | 3300011119 | Ga0105246_10570254 | Ga0105246_105702542 | 127 |
| 270 | 3300013297 | Ga0157378_10791270 | Ga0157378_107912702 | 127 |
| 271 | 3300014325 | Ga0163163_10173661 | Ga0163163_101736613 | 127 |
| 272 | 3300014325 | Ga0163163_11301563 | Ga0163163_113015632 | 127 |
| 273 | 3300014745 | Ga0157377_11022490 | Ga0157377_110224901 | 127 |
| 274 | 3300025921 | Ga0207652_10162217 | Ga0207652_101622172 | 127 |
| 275 | 3300025934 | Ga0207686_10310502 | Ga0207686_103105022 | 127 |
| 276 | 3300025944 | Ga0207661_10100921 | Ga0207661_101009214 | 127 |
| 277 | 3300028556 | Ga0265337_1004262 | Ga0265337_10042624 | 127 |
| 278 | 3300028558 | Ga0265326_10066333 | Ga0265326_100663332 | 127 |
| 279 | 3300028563 | Ga0265319_1005249 | Ga0265319_10052494 | 127 |
| 280 | 3300028563 | Ga0265319_1105725 | Ga0265319_11057252 | 127 |
| 281 | 3300028573 | Ga0265334_10001534 | Ga0265334_100015347 | 127 |
| 282 | 3300028577 | Ga0265318_10001452 | Ga0265318_1000145212 | 127 |
| 283 | 3300028577 | Ga0265318_10020864 | Ga0265318_100208642 | 127 |
| 284 | 3300028577 | Ga0265318_10134714 | Ga0265318_101347141 | 127 |
| 285 | 3300028654 | Ga0265322_10033465 | Ga0265322_100334652 | 127 |
| 286 | 3300028666 | Ga0265336_10001049 | Ga0265336_100010492 | 127 |
| 287 | 3300028800 | Ga0265338_10001708 | Ga0265338_1000170825 | 127 |
| 288 | 3300029957 | Ga0265324_10000442 | Ga0265324_1000044228 | 127 |
| 289 | 3300031238 | Ga0265332_10062132 | Ga0265332_100621323 | 127 |
| 290 | 3300031239 | Ga0265328_10052198 | Ga0265328_100521983 | 127 |
| 291 | 3300031240 | Ga0265320_10006592 | Ga0265320_100065925 | 127 |
| 292 | 3300031240 | Ga0265320_10013095 | Ga0265320_100130953 | 127 |
| 293 | 3300031240 | Ga0265320_10085524 | Ga0265320_100855242 | 127 |
| 294 | 3300031241 | Ga0265325_10075007 | Ga0265325_100750073 | 127 |
| 295 | 3300031251 | Ga0265327_10002314 | Ga0265327_1000231416 | 127 |
| 296 | 3300031251 | Ga0265327_10009740 | Ga0265327_1000974014 | 127 |
| 297 | 3300031344 | Ga0265316_10010207 | Ga0265316_1001020710 | 127 |
| 298 | 3300031595 | Ga0265313_10000667 | Ga0265313_1000066737 | 127 |
| 299 | 3300031616 | Ga0307508_10000276 | Ga0307508_1000027628 | 127 |
| 300 | 3300031711 | Ga0265314_10003246 | Ga0265314_1000324613 | 127 |
| 301 | 3300031711 | Ga0265314_10003296 | Ga0265314_100032968 | 127 |
| 302 | 3300031711 | Ga0265314_10059556 | Ga0265314_100595562 | 127 |
| 303 | 3300031711 | Ga0265314_10118511 | Ga0265314_101185112 | 127 |
| 304 | 3300031712 | Ga0265342_10061321 | Ga0265342_100613212 | 127 |
| 305 | 3300031731 | Ga0307405_10545943 | Ga0307405_105459432 | 127 |
| 306 | 3300031903 | Ga0307407_10399541 | Ga0307407_103995411 | 127 |
| 307 | 3300031995 | Ga0307409_100000037 | Ga0307409_1000000372 | 127 |
| 308 | 3300032004 | Ga0307414_10067345 | Ga0307414_100673452 | 127 |
| 309 | 3300032004 | Ga0307414_10486738 | Ga0307414_104867382 | 127 |
| 310 | 3300032005 | Ga0307411_10295276 | Ga0307411_102952762 | 127 |
| 311 | 3300033179 | Ga0307507_10271706 | Ga0307507_102717061 | 127 |
| 312 | 3300035115 | Ga0373941_0226132 | Ga0373941_0226132_36_482 | 127 |
| 313 | 3300042876 | Ga0451577_0005406 | Ga0451577_0005406_12132_12578 | 127 |
| 314 | 3300042876 | Ga0451577_0059811 | Ga0451577_0059811_420_866 | 127 |
| 315 | 3300042876 | Ga0451577_0259131 | Ga0451577_0259131_316_762 | 127 |
| 316 | 3300042876 | Ga0451577_1213786 | Ga0451577_1213786_17_463 | 127 |
| 317 | 3300044712 | Ga0453684_0000266 | Ga0453684_0000266_98512_98958 | 127 |
| 318 | 3300044712 | Ga0453684_0031372 | Ga0453684_0031372_3631_4077 | 127 |
| 319 | 3300044712 | Ga0453684_0102565 | Ga0453684_0102565_1161_1607 | 127 |
| 320 | 3300045051 | Ga0451576_0124749 | Ga0451576_0124749_1092_1538 | 127 |
| 321 | 3300049129 | Ga0501309_002850 | Ga0501309_002850_1332_1778 | 127 |
| 322 | 3300049161 | Ga0501305_000001 | Ga0501305_000001_6330_6776 | 127 |
| 323 | 3300049161 | Ga0501305_000061 | Ga0501305_000061_5474_5923 | 127 |
| 324 | 3300049161 | Ga0501305_016276 | Ga0501305_016276_143_589 | 127 |
| 325 | 3300049162 | Ga0501307_000001 | Ga0501307_000001_10204_10650 | 127 |
| 326 | 3300049528 | Ga0501312_000001 | Ga0501312_000001_12927_13373 | 127 |
| 327 | 3300049528 | Ga0501312_001427 | Ga0501312_001427_402_851 | 127 |
| 328 | 3300049569 | Ga0501032_0000512 | Ga0501032_0000512_8962_9408 | 127 |
| 329 | 3300049569 | Ga0501032_0004293 | Ga0501032_0004293_7073_7519 | 127 |
| 330 | 3300049570 | Ga0501033_0006719 | Ga0501033_0006719_2991_3437 | 127 |
| 331 | 3300049572 | Ga0501036_0262155 | Ga0501036_0262155_966_1412 | 127 |
| 332 | 3300049572 | Ga0501036_1397680 | Ga0501036_1397680_48_494 | 127 |
| 333 | 3300049573 | Ga0501037_0018702 | Ga0501037_0018702_4627_5073 | 127 |
| 334 | 3300049574 | Ga0501038_0119634 | Ga0501038_0119634_44_490 | 127 |
| 335 | 3300049579 | Ga0501043_0161793 | Ga0501043_0161793_255_701 | 127 |
| 336 | 3300049579 | Ga0501043_0505470 | Ga0501043_0505470_414_860 | 127 |
| 337 | 3300049580 | Ga0501046_0005999 | Ga0501046_0005999_4111_4557 | 127 |
| 338 | 3300049580 | Ga0501046_0155426 | Ga0501046_0155426_706_1152 | 127 |
| 339 | 3300049581 | Ga0501047_0042858 | Ga0501047_0042858_1092_1538 | 127 |
| 340 | 3300049581 | Ga0501047_0086476 | Ga0501047_0086476_423_869 | 127 |
| 341 | 3300049581 | Ga0501047_0277133 | Ga0501047_0277133_469_915 | 127 |
| 342 | 3300049582 | Ga0501048_0015870 | Ga0501048_0015870_4518_4964 | 127 |
| 343 | 3300049586 | Ga0501070_0033242 | Ga0501070_0033242_3398_3844 | 127 |
| 344 | 3300049586 | Ga0501070_0797645 | Ga0501070_0797645_263_709 | 127 |
| 345 | 3300049686 | Ga0501257_093411 | Ga0501257_093411_20_466 | 127 |
| 346 | 3300049706 | Ga0501229_007518 | Ga0501229_007518_123_569 | 127 |
| 347 | 3300049823 | Ga0501044_0000188 | Ga0501044_0000188_64626_65072 | 127 |
| 348 | 3300049823 | Ga0501044_0041030 | Ga0501044_0041030_4069_4515 | 127 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2yx6-assembly3.cif.gz_D-3 | crystal structure of ph0822 | 0.9371 | 103 | 126 |
| 6th6-assembly1.cif.gz_BR | cryo-em structure of t. kodakarensis 70s ribosome | 0.9189 | 55 | 126 |
| 1w2b-assembly1.cif.gz_N | trigger factor ribosome binding domain in complex with 50s | 0.8742 | 55 | 125 |
| 4v6u-assembly1.cif.gz_BP | promiscuous behavior of proteins in archaeal ribosomes revealed by cryo-em: implications for evolution of eukaryotic ribosomes | 0.8704 | 57 | 126 |
| 1p90-assembly1.cif.gz_A | the three-dimensional structure of the core domain of nafy from azotobacter vinelandii determined at 1.8 resolution | 0.8681 | 103 | 126 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P54022_5_121_3.100.10.10 | Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; | 0.924 | 55 | 126 | 3.100.10.10 |
| 5v7qL01 | Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; | 0.9116 | 56 | 124 | 3.100.10.10 |
| af_P02413_75_144_3.100.10.10 | Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; | 0.9115 | 55 | 124 | 3.100.10.10 |
| 4qjsP01 | Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; | 0.9038 | 56 | 127 | 3.100.10.10 |
| 1jj2N00 | Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; | 0.8838 | 55 | 126 | 3.100.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4V1QUN6-F1-model_v4 | 50S ribosomal protein L15 | 0.9519 | 53 | 127 |
GO:0003735
GO:0005840 GO:0006412 GO:0016020 GO:0030313 GO:1990904 |
| AF-A0A661D962-F1-model_v4 | 50S ribosomal protein L15 | 0.9462 | 54 | 125 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A7K0MKD2-F1-model_v4 | 50S ribosomal protein L15 | 0.9441 | 50 | 127 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A7Z9N4H0-F1-model_v4 | 50S ribosomal protein L15 | 0.9431 | 55 | 127 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A4Q3ZTU2-F1-model_v4 | deleted | 0.9429 | 54 | 124 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar