F417654

General Info

Members Datasets Scaffolds Average Seq Length
348 193 348 156

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0271241|Ga0466967_0271241_855_1406
Length 183
Sequence MRKHSFDSKPLEEKIMVITRWDPFHDFSALQNRVNSLFQDYSRTGQDELTTVGSFVPAVDVYEDEHRVTLKLEIPGINQEDVDIRLENNTLTVRGERKFEKEEKEENFHRIERRYGSFARSFTLPNTLDPDSVTANYENGVLKIELAKRAEAKPKQIKVNIGSGKTLGKTVEGTKAESKTQAA

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300019161 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
74 3300019166 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
75 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
79 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
85 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
86 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300023561 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
88 3300023672 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
89 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
124 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
125 3300030880 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
127 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
128 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
129 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
130 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
131 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
132 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
133 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
134 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
135 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
136 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
139 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
140 3300032120 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
142 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
143 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
144 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
145 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
146 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
149 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
150 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
151 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
152 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
153 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
154 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
155 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
156 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
157 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
158 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
159 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
160 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
161 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
162 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
163 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
164 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
165 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
166 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
167 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
168 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
169 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
170 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
171 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
172 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
173 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
174 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
175 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
176 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
177 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
178 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
179 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
180 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
181 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
182 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
183 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
184 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
185 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
186 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
187 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
188 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
189 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
190 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
191 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
192 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 78.16
Metatranscriptomes 21.84
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.59
Rhizosphere 94.83
Stem 0
Stem Tuber 0
Unclassified 2.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10383157 3300003323 Bacteria 1242
2 Ga0058863_10086594 3300004799 Bacteria 1011
3 Ga0058861_10051339 3300004800 Bacteria 845
4 Ga0058861_10077517 3300004800 Bacteria 1103
5 Ga0058861_11782676 3300004800 Bacteria 649
6 Ga0058862_10226840 3300004803 Bacteria 558
7 Ga0058862_10254669 3300004803 Bacteria 717
8 Ga0058862_12627438 3300004803 Bacteria 718
9 Ga0070658_11125725 3300005327 Bacteria 683
10 Ga0070676_10128807 3300005328 Bacteria 1598
11 Ga0070683_101144033 3300005329 Bacteria 748
12 Ga0070690_100557192 3300005330 Bacteria 865
13 Ga0070670_100016038 3300005331 Bacteria 6429
14 Ga0070670_100189125 3300005331 Bacteria 1788
15 Ga0070666_10023949 3300005335 Bacteria 3975
16 Ga0070666_10828979 3300005335 Bacteria 682
17 Ga0070680_100084424 3300005336 Unclassified 2622
18 Ga0070680_100140932 3300005336 Bacteria 2022
19 Ga0070680_100267067 3300005336 Bacteria 1448
20 Ga0070682_100267988 3300005337 Bacteria 1239
21 Ga0070682_100628947 3300005337 Bacteria 852
22 Ga0070660_100207978 3300005339 Bacteria 1588
23 Ga0070675_100072244 3300005354 Bacteria 2864
24 Ga0070671_100023925 3300005355 Bacteria 4998
25 Ga0070671_100709319 3300005355 Bacteria 873
26 Ga0070674_100282377 3300005356 Bacteria 1316
27 Ga0070673_100184742 3300005364 Bacteria 1786
28 Ga0070688_100324907 3300005365 Bacteria 1119
29 Ga0070667_100074971 3300005367 Bacteria 2887
30 Ga0070667_100389949 3300005367 Bacteria 1266
31 Ga0070709_10063625 3300005434 Bacteria 2357
32 Ga0070713_100049683 3300005436 Unclassified 3461
33 Ga0070713_101264258 3300005436 Bacteria 715
34 Ga0070678_100007527 3300005456 Bacteria 6467
35 Ga0070662_100003983 3300005457 Bacteria 9252
36 Ga0070681_10030956 3300005458 Bacteria 5371
37 Ga0070681_11034360 3300005458 Bacteria 741
38 Ga0070681_11141222 3300005458 Bacteria 701
39 Ga0070679_100300160 3300005530 Bacteria 1557
40 Ga0070679_100601875 3300005530 Bacteria 1042
41 Ga0070679_101084272 3300005530 Bacteria 745
42 Ga0070684_100068201 3300005535 Bacteria 3126
43 Ga0070697_100012826 3300005536 Bacteria 6565
44 Ga0068853_100106162 3300005539 Bacteria 2489
45 Ga0070672_100002005 3300005543 Bacteria 12791
46 Ga0070696_100071040 3300005546 Bacteria 2449
47 Ga0070696_101306553 3300005546 Bacteria 616
48 Ga0070693_100027985 3300005547 Unclassified 3061
49 Ga0070665_100020643 3300005548 Bacteria 6618
50 Ga0070665_100049205 3300005548 Bacteria 4229
51 Ga0070665_100114970 3300005548 Bacteria 2693
52 Ga0070665_100693015 3300005548 Bacteria 1032
53 Ga0070704_100957761 3300005549 Unclassified 772
54 Ga0068855_100044675 3300005563 Bacteria 5243
55 Ga0068855_100058062 3300005563 Bacteria 4533
56 Ga0068855_100438610 3300005563 Bacteria 1427
57 Ga0068855_101490991 3300005563 Bacteria 695
58 Ga0068857_100013228 3300005577 Bacteria 7191
59 Ga0068857_100395049 3300005577 Bacteria 1286
60 Ga0068856_100017420 3300005614 Bacteria 6961
61 Ga0068856_101065512 3300005614 Bacteria 826
62 Ga0068856_101189323 3300005614 Bacteria 779
63 Ga0068852_100031489 3300005616 Bacteria 4377
64 Ga0068852_100406278 3300005616 Unclassified 1340
65 Ga0068859_100542482 3300005617 Bacteria 1258
66 Ga0068864_100013695 3300005618 Bacteria 6726
67 Ga0068864_100402680 3300005618 Bacteria 1301
68 Ga0068861_100843183 3300005719 Bacteria 863
69 Ga0068851_10634232 3300005834 Unclassified 653
70 Ga0068870_10360148 3300005840 Bacteria 936
71 Ga0068863_100318871 3300005841 Bacteria 1509
72 Ga0068863_102526738 3300005841 Bacteria 523
73 Ga0068858_100048599 3300005842 Bacteria 3929
74 Ga0068860_100056734 3300005843 Bacteria 3722
75 Ga0068860_102242980 3300005843 Bacteria 567
76 Ga0070717_10168127 3300006028 Bacteria 1906
77 Ga0070717_10542988 3300006028 Unclassified 1052
78 Ga0070716_100490541 3300006173 Unclassified 904
79 Ga0097621_100059084 3300006237 Bacteria 3138
80 Ga0068871_100012609 3300006358 Bacteria 6241
81 Ga0097620_100542495 3300006931 Bacteria 1258
82 Ga0099794_10109840 3300007265 Unclassified 1381
83 Ga0105240_10137392 3300009093 Unclassified 2926
84 Ga0105240_10192371 3300009093 Bacteria 2398
85 Ga0105240_11010787 3300009093 Bacteria 889
86 Ga0105240_11631972 3300009093 Bacteria 674
87 Ga0114129_10012875 3300009147 Bacteria 11903
88 Ga0105243_10276858 3300009148 Bacteria 1509
89 Ga0105243_10548537 3300009148 Bacteria 1104
90 Ga0105241_10425449 3300009174 Bacteria 1170
91 Ga0105242_10152637 3300009176 Bacteria 2015
92 Ga0105248_10005228 3300009177 Bacteria 14297
93 Ga0105248_10067100 3300009177 Bacteria 4028
94 Ga0105248_10074097 3300009177 Bacteria 3826
95 Ga0105237_10151542 3300009545 Bacteria 2315
96 Ga0105237_10296552 3300009545 Bacteria 1620
97 Ga0105238_10447587 3300009551 Bacteria 1288
98 Ga0105249_10064892 3300009553 Bacteria 3358
99 Ga0105239_10091411 3300010375 Bacteria 3358
100 Ga0105239_10203382 3300010375 Bacteria 2219
101 Ga0105239_10500861 3300010375 Bacteria 1381
102 Ga0105246_10011686 3300011119 Bacteria 5455
103 Ga0157370_10384461 3300013104 Bacteria 1293
104 Ga0157370_10418603 3300013104 Bacteria 1233
105 Ga0157369_10005757 3300013105 Bacteria 14407
106 Ga0157369_10065977 3300013105 Bacteria 3894
107 Ga0157369_10110906 3300013105 Bacteria 2916
108 Ga0157369_10339892 3300013105 Bacteria 1560
109 Ga0157369_11216694 3300013105 Bacteria 769
110 Ga0157374_10004959 3300013296 Bacteria 11171
111 Ga0157374_10050205 3300013296 Bacteria 3877
112 Ga0157374_10069404 3300013296 Bacteria 3318
113 Ga0157374_10076710 3300013296 Bacteria 3161
114 Ga0157378_10099990 3300013297 Bacteria 2647
115 Ga0157378_10191866 3300013297 Bacteria 1927
116 Ga0163162_10354950 3300013306 Bacteria 1599
117 Ga0163162_10599876 3300013306 Bacteria 1227
118 Ga0163162_11264993 3300013306 Bacteria 838
119 Ga0163162_11747767 3300013306 Bacteria 711
120 Ga0157372_10029172 3300013307 Bacteria 6022
121 Ga0157372_10129867 3300013307 Bacteria 2898
122 Ga0157372_10945828 3300013307 Bacteria 999
123 Ga0157372_10978858 3300013307 Unclassified 980
124 Ga0157375_10013492 3300013308 Bacteria 7275
125 Ga0157375_10425799 3300013308 Bacteria 1493
126 Ga0163163_10003373 3300014325 Bacteria 13552
127 Ga0163163_10275117 3300014325 Bacteria 1735
128 Ga0157376_10203372 3300014969 Bacteria 1824
129 Ga0157376_10495111 3300014969 Bacteria 1200
130 Ga0163161_10015051 3300017792 Bacteria 5391
131 Ga0184602_115772 3300019161 Bacteria 786
132 Ga0184595_118846 3300019166 Bacteria 544
133 Ga0197907_10520732 3300020069 Bacteria 817
134 Ga0197907_10581016 3300020069 Bacteria 746
135 Ga0197907_10610278 3300020069 Bacteria 648
136 Ga0197907_10845772 3300020069 Bacteria 1002
137 Ga0206356_10294992 3300020070 Bacteria 635
138 Ga0206356_10874967 3300020070 Bacteria 549
139 Ga0206349_1187794 3300020075 Bacteria 720
140 Ga0206349_1335831 3300020075 Bacteria 560
141 Ga0206349_1362241 3300020075 Unclassified 639
142 Ga0206349_1680554 3300020075 Unclassified 650
143 Ga0206349_1965047 3300020075 Bacteria 554
144 Ga0206355_1147249 3300020076 Bacteria 806
145 Ga0206355_1267967 3300020076 Unclassified 553
146 Ga0206355_1271688 3300020076 Bacteria 584
147 Ga0206355_1350699 3300020076 Bacteria 538
148 Ga0206355_1385288 3300020076 Bacteria 661
149 Ga0206351_10037011 3300020077 Unclassified 895
150 Ga0206351_10245823 3300020077 Bacteria 512
151 Ga0206351_10293074 3300020077 Bacteria 730
152 Ga0206351_10315708 3300020077 Bacteria 1667
153 Ga0206351_10343963 3300020077 Bacteria 610
154 Ga0206351_10374921 3300020077 Bacteria 1377
155 Ga0206351_10561193 3300020077 Unclassified 590
156 Ga0206351_10604236 3300020077 Bacteria 618
157 Ga0206351_10614195 3300020077 Bacteria 561
158 Ga0206351_10736055 3300020077 Bacteria 1001
159 Ga0206351_10918230 3300020077 Bacteria 532
160 Ga0206351_10974413 3300020077 Bacteria 838
161 Ga0206352_10019431 3300020078 Unclassified 588
162 Ga0206352_10567405 3300020078 Unclassified 1111
163 Ga0206352_10572176 3300020078 Bacteria 714
164 Ga0206352_10726361 3300020078 Bacteria 828
165 Ga0206352_10832553 3300020078 Bacteria 518
166 Ga0206352_11312925 3300020078 Unclassified 580
167 Ga0206352_11334485 3300020078 Bacteria 575
168 Ga0206350_10199177 3300020080 Bacteria 527
169 Ga0206350_10232606 3300020080 Bacteria 834
170 Ga0206350_10438208 3300020080 Bacteria 570
171 Ga0206350_10706527 3300020080 Bacteria 602
172 Ga0206350_11166613 3300020080 Bacteria 785
173 Ga0206350_11467074 3300020080 Unclassified 847
174 Ga0206354_10339928 3300020081 Unclassified 547
175 Ga0206354_11664707 3300020081 Bacteria 652
176 Ga0206353_10280453 3300020082 Bacteria 563
177 Ga0206353_10894400 3300020082 Bacteria 587
178 Ga0154015_1093487 3300020610 Bacteria 547
179 Ga0154015_1612928 3300020610 Bacteria 779
180 Ga0154015_1663793 3300020610 Bacteria 690
181 Ga0154015_1676406 3300020610 Bacteria 1290
182 Ga0154015_1707358 3300020610 Bacteria 629
183 Ga0213874_10046026 3300021377 Bacteria 1323
184 Ga0213874_10072283 3300021377 Unclassified 1102
185 Ga0224712_10039891 3300022467 Bacteria 1763
186 Ga0224712_10065457 3300022467 Bacteria 1461
187 Ga0224712_10116782 3300022467 Bacteria 1151
188 Ga0224712_10125430 3300022467 Bacteria 1116
189 Ga0224712_10143518 3300022467 Unclassified 1053
190 Ga0224712_10182879 3300022467 Bacteria 945
191 Ga0224712_10447565 3300022467 Bacteria 620
192 Ga0224712_10502110 3300022467 Bacteria 586
193 Ga0247518_116456 3300023561 Bacteria 646
194 Ga0247553_106660 3300023672 Bacteria 618
195 Ga0247553_106721 3300023672 Bacteria 616
196 Ga0207697_10103637 3300025315 Bacteria 1214
197 Ga0207688_10203867 3300025901 Bacteria 1187
198 Ga0207680_10058218 3300025903 Bacteria 2341
199 Ga0207680_11014883 3300025903 Bacteria 594
200 Ga0207647_10008351 3300025904 Bacteria 7427
201 Ga0207645_10048582 3300025907 Bacteria 2710
202 Ga0207643_10225129 3300025908 Bacteria 1149
203 Ga0207654_10599372 3300025911 Bacteria 786
204 Ga0207707_10090550 3300025912 Bacteria 2673
205 Ga0207707_10960317 3300025912 Bacteria 703
206 Ga0207695_10852549 3300025913 Bacteria 791
207 Ga0207660_10110271 3300025917 Bacteria 2070
208 Ga0207652_10377305 3300025921 Bacteria 1280
209 Ga0207652_10550050 3300025921 Bacteria 1037
210 Ga0207652_11198133 3300025921 Bacteria 661
211 Ga0207700_10147515 3300025928 Unclassified 1941
212 Ga0207644_10156399 3300025931 Bacteria 1768
213 Ga0207706_10015144 3300025933 Bacteria 6979
214 Ga0207686_10410567 3300025934 Bacteria 1033
215 Ga0207704_10192322 3300025938 Bacteria 1485
216 Ga0207665_10134120 3300025939 Bacteria 1760
217 Ga0207665_10227457 3300025939 Unclassified 1370
218 Ga0207665_10723152 3300025939 Bacteria 783
219 Ga0207691_10006334 3300025940 Bacteria 11428
220 Ga0207711_10338500 3300025941 Bacteria 1392
221 Ga0207711_10385802 3300025941 Bacteria 1300
222 Ga0207689_10008476 3300025942 Bacteria 8956
223 Ga0207661_10063824 3300025944 Bacteria 2984
224 Ga0207667_10035823 3300025949 Bacteria 5323
225 Ga0207667_10123609 3300025949 Bacteria 2666
226 Ga0207667_10228700 3300025949 Bacteria 1905
227 Ga0207667_10431833 3300025949 Bacteria 1339
228 Ga0207667_11414950 3300025949 Bacteria 668
229 Ga0207651_10039620 3300025960 Bacteria 3109
230 Ga0207640_10116174 3300025981 Bacteria 1907
231 Ga0207677_10223979 3300026023 Bacteria 1510
232 Ga0207703_10162257 3300026035 Bacteria 1958
233 Ga0207702_10482638 3300026078 Bacteria 1206
234 Ga0207641_12487934 3300026088 Bacteria 516
235 Ga0207676_10939152 3300026095 Bacteria 850
236 Ga0207674_10018350 3300026116 Bacteria 7607
237 Ga0207674_10349615 3300026116 Bacteria 1429
238 Ga0207683_10000538 3300026121 Bacteria 35079
239 Ga0207698_10235273 3300026142 Bacteria 1666
240 Ga0268266_10294418 3300028379 Bacteria 1512
241 Ga0268266_11338648 3300028379 Unclassified 691
242 Ga0268264_10169549 3300028381 Bacteria 1973
243 Ga0265318_10062946 3300028577 Bacteria 1381
244 Ga0265338_10468193 3300028800 Bacteria 890
245 Ga0265776_107616 3300030880 Unclassified 601
246 Ga0265330_10000373 3300031235 Bacteria 31405
247 Ga0265325_10000560 3300031241 Bacteria 27013
248 Ga0265325_10067469 3300031241 Unclassified 1802
249 Ga0265325_10068416 3300031241 Unclassified 1787
250 Ga0265340_10150428 3300031247 Bacteria 1061
251 Ga0265340_10280614 3300031247 Bacteria 740
252 Ga0265340_10458371 3300031247 Bacteria 561
253 Ga0265339_10000899 3300031249 Bacteria 22835
254 Ga0265331_10064172 3300031250 Bacteria 1729
255 Ga0265316_10000692 3300031344 Bacteria 37515
256 Ga0265316_10087078 3300031344 Bacteria 2387
257 Ga0265316_10375432 3300031344 Bacteria 1026
258 Ga0265316_11088245 3300031344 Bacteria 555
259 Ga0307408_100050801 3300031548 Bacteria 2983
260 Ga0265313_10001674 3300031595 Bacteria 20509
261 Ga0265313_10040034 3300031595 Bacteria 2320
262 Ga0265342_10000395 3300031712 Bacteria 48238
263 Ga0265342_10079397 3300031712 Bacteria 1897
264 Ga0307405_10176626 3300031731 Bacteria 1529
265 Ga0307409_100004178 3300031995 Bacteria 8046
266 Ga0307416_100021654 3300032002 Bacteria 4621
267 Ga0307416_100298747 3300032002 Bacteria 1599
268 Ga0307414_10311076 3300032004 Bacteria 1337
269 Ga0307411_10016139 3300032005 Bacteria 4222
270 Ga0316053_113640 3300032120 Bacteria 591
271 Ga0373946_0110205 3300035171 Bacteria 1245
272 Ga0373931_0128927 3300035691 Bacteria 1454
273 Ga0373933_0078530 3300035724 Bacteria 2020
274 Ga0373947_0029509 3300035725 Bacteria 3219
275 Ga0373937_0002292 3300036401 Bacteria 15978
276 Ga0373937_0074603 3300036401 Bacteria 3130
277 Ga0265778_041771 3300036457 Bacteria 612
278 Ga0373925_0311385 3300037068 Bacteria 1273
279 Ga0395900_0367144 3300037418 Bacteria 1410
280 Ga0395898_0030782 3300037466 Bacteria 5369
281 Ga0395905_0036893 3300037471 Bacteria 4591
282 Ga0395905_0072198 3300037471 Bacteria 3236
283 Ga0395905_0087258 3300037471 Bacteria 2925
284 Ga0395905_0960617 3300037471 Bacteria 757
285 Ga0395905_0967486 3300037471 Bacteria 754
286 Ga0395905_1059072 3300037471 Bacteria 714
287 Ga0395905_1162044 3300037471 Bacteria 675
288 Ga0395905_1735033 3300037471 Bacteria 530
289 Ga0395901_0255289 3300038443 Bacteria 1826
290 Ga0395901_0588965 3300038443 Bacteria 1123
291 Ga0395901_0958336 3300038443 Bacteria 834
292 Ga0436365_0167286 3300039437 Bacteria 1113
293 Ga0436361_0206802 3300039447 Bacteria 2086
294 Ga0436363_1536646 3300039450 Bacteria 5052
295 Ga0436363_1572531 3300039450 Bacteria 4222
296 Ga0436362_0438158 3300039453 Unclassified 757
297 Ga0436362_0674302 3300039453 Bacteria 1170
298 Ga0451839_0548124 3300041496 Bacteria 908
299 Ga0451577_0000325 3300042876 Bacteria 89199
300 Ga0451577_0354053 3300042876 Bacteria 1332
301 Ga0453683_0123730 3300044673 Bacteria 1628
302 Ga0453683_1096870 3300044673 Bacteria 531
303 Ga0453684_0000429 3300044712 Bacteria 171513
304 Ga0466957_0128247 3300044842 Bacteria 1623
305 Ga0466957_0165823 3300044842 Bacteria 1437
306 Ga0466957_0681116 3300044842 Bacteria 725
307 Ga0451576_0001898 3300045051 Bacteria 33560
308 Ga0466967_0271241 3300045976 Unclassified 1626
309 Ga0466967_1895551 3300045976 Bacteria 593
310 Ga0495629_0013052 3300046459 Bacteria 6003
311 Ga0495664_0016858 3300046477 Bacteria 4171
312 Ga0495630_0760493 3300046517 Bacteria 740
313 Ga0495586_0144457 3300046535 Bacteria 1336
314 Ga0495587_0057391 3300046536 Bacteria 2289
315 Ga0495587_0070091 3300046536 Bacteria 2041
316 Ga0495645_0051066 3300046543 Bacteria 3009
317 Ga0495667_0862773 3300046559 Unclassified 556
318 Ga0495635_0252741 3300046663 Bacteria 1188
319 Ga0495635_0347245 3300046663 Unclassified 990
320 Ga0495659_0033032 3300046664 Bacteria 1814
321 Ga0495657_0211488 3300046675 Bacteria 1179
322 Ga0495599_0418468 3300046678 Bacteria 796
323 Ga0495623_0077117 3300046679 Bacteria 2067
324 Ga0495669_0098247 3300046684 Bacteria 1358
325 Ga0495669_0205837 3300046684 Bacteria 941
326 Ga0495675_0071446 3300047444 Unclassified 2190
327 Ga0495675_0192758 3300047444 Bacteria 1243
328 Ga0495677_0095382 3300047445 Unclassified 1123
329 Ga0495684_0530846 3300047471 Bacteria 804
330 Ga0496100_0224143 3300048903 Bacteria 1381
331 Ga0496102_0402018 3300048905 Bacteria 1288
332 Ga0496106_0805220 3300048909 Bacteria 745
333 Ga0496109_0550908 3300048912 Bacteria 1088
334 Ga0496112_0019906 3300048915 Bacteria 6351
335 Ga0496112_0184421 3300048915 Bacteria 2050
336 Ga0496115_0026503 3300048918 Bacteria 4524
337 Ga0496115_0303977 3300048918 Bacteria 1307
338 Ga0496115_0369947 3300048918 Unclassified 1167
339 Ga0496126_0419086 3300048929 Bacteria 1083
340 Ga0501300_082052 3300049523 Bacteria 532
341 Ga0501235_077888 3300049669 Bacteria 790
342 Ga0501263_063081 3300049760 Bacteria 585
343 nmdc:mga05p37_75476_c1 3300050507 Bacteria 4149
344 nmdc:mga0a205_1094342_c1 3300050515 Bacteria 644
345 Ga0495601_0295461 3300053077 Bacteria 1056
346 Ga0587066_084460 3300059490 Bacteria 694
347 Ga0587073_0103812 3300059492 Unclassified 743
348 Ga0587073_0225917 3300059492 Bacteria 575

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049669 Ga0501235_077888 Ga0501235_077888_325_765 121
2 3300049760 Ga0501263_063081 Ga0501263_063081_21_461 122
3 3300013307 Ga0157372_10029172 Ga0157372_100291725 125
4 3300035171 Ga0373946_0110205 Ga0373946_0110205_468_974 125
5 3300035725 Ga0373947_0029509 Ga0373947_0029509_1611_2117 125
6 3300041496 Ga0451839_0548124 Ga0451839_0548124_203_727 125
7 3300044842 Ga0466957_0128247 Ga0466957_0128247_203_655 127
8 3300007265 Ga0099794_10109840 Ga0099794_101098402 131
9 3300032002 Ga0307416_100298747 Ga0307416_1002987472 133
10 3300044842 Ga0466957_0165823 Ga0466957_0165823_80_565 135
11 3300013307 Ga0157372_10129867 Ga0157372_101298673 138
12 3300045976 Ga0466967_1895551 Ga0466967_1895551_22_504 139
13 3300046664 Ga0495659_0033032 Ga0495659_0033032_817_1302 142
14 3300046684 Ga0495669_0098247 Ga0495669_0098247_801_1286 142
15 3300049523 Ga0501300_082052 Ga0501300_082052_41_520 142
16 3300059492 Ga0587073_0225917 Ga0587073_0225917_22_501 142
17 3300004800 Ga0058861_10051339 Ga0058861_100513391 143
18 3300004800 Ga0058861_11782676 Ga0058861_117826762 143
19 3300004803 Ga0058862_10226840 Ga0058862_102268401 143
20 3300004803 Ga0058862_10254669 Ga0058862_102546691 143
21 3300004803 Ga0058862_12627438 Ga0058862_126274381 143
22 3300005327 Ga0070658_11125725 Ga0070658_111257251 143
23 3300005328 Ga0070676_10128807 Ga0070676_101288072 143
24 3300005329 Ga0070683_101144033 Ga0070683_1011440331 143
25 3300005330 Ga0070690_100557192 Ga0070690_1005571921 143
26 3300005331 Ga0070670_100016038 Ga0070670_1000160384 143
27 3300005335 Ga0070666_10023949 Ga0070666_100239492 143
28 3300005335 Ga0070666_10828979 Ga0070666_108289791 143
29 3300005336 Ga0070680_100140932 Ga0070680_1001409322 143
30 3300005337 Ga0070682_100267988 Ga0070682_1002679881 143
31 3300005354 Ga0070675_100072244 Ga0070675_1000722442 143
32 3300005355 Ga0070671_100023925 Ga0070671_1000239252 143
33 3300005355 Ga0070671_100709319 Ga0070671_1007093191 143
34 3300005356 Ga0070674_100282377 Ga0070674_1002823772 143
35 3300005364 Ga0070673_100184742 Ga0070673_1001847422 143
36 3300005365 Ga0070688_100324907 Ga0070688_1003249072 143
37 3300005367 Ga0070667_100074971 Ga0070667_1000749712 143
38 3300005456 Ga0070678_100007527 Ga0070678_1000075275 143
39 3300005457 Ga0070662_100003983 Ga0070662_1000039832 143
40 3300005458 Ga0070681_10030956 Ga0070681_100309562 143
41 3300005530 Ga0070679_100300160 Ga0070679_1003001602 143
42 3300005539 Ga0068853_100106162 Ga0068853_1001061622 143
43 3300005543 Ga0070672_100002005 Ga0070672_1000020057 143
44 3300005546 Ga0070696_101306553 Ga0070696_1013065531 143
45 3300005548 Ga0070665_100020643 Ga0070665_1000206432 143
46 3300005563 Ga0068855_100044675 Ga0068855_1000446755 143
47 3300005563 Ga0068855_100058062 Ga0068855_1000580626 143
48 3300005577 Ga0068857_100395049 Ga0068857_1003950492 143
49 3300005614 Ga0068856_100017420 Ga0068856_1000174204 143
50 3300005614 Ga0068856_101189323 Ga0068856_1011893231 143
51 3300005616 Ga0068852_100031489 Ga0068852_1000314892 143
52 3300005617 Ga0068859_100542482 Ga0068859_1005424821 143
53 3300005618 Ga0068864_100013695 Ga0068864_1000136954 143
54 3300005719 Ga0068861_100843183 Ga0068861_1008431832 143
55 3300005840 Ga0068870_10360148 Ga0068870_103601481 143
56 3300005841 Ga0068863_102526738 Ga0068863_1025267381 143
57 3300005842 Ga0068858_100048599 Ga0068858_1000485992 143
58 3300005843 Ga0068860_100056734 Ga0068860_1000567342 143
59 3300005843 Ga0068860_102242980 Ga0068860_1022429801 143
60 3300006237 Ga0097621_100059084 Ga0097621_1000590842 143
61 3300006358 Ga0068871_100012609 Ga0068871_1000126092 143
62 3300006931 Ga0097620_100542495 Ga0097620_1005424951 143
63 3300009093 Ga0105240_10192371 Ga0105240_101923712 143
64 3300009093 Ga0105240_11010787 Ga0105240_110107871 143
65 3300009093 Ga0105240_11631972 Ga0105240_116319721 143
66 3300009148 Ga0105243_10276858 Ga0105243_102768582 143
67 3300009148 Ga0105243_10548537 Ga0105243_105485372 143
68 3300009174 Ga0105241_10425449 Ga0105241_104254491 143
69 3300009176 Ga0105242_10152637 Ga0105242_101526372 143
70 3300009177 Ga0105248_10005228 Ga0105248_100052286 143
71 3300009177 Ga0105248_10074097 Ga0105248_100740972 143
72 3300009545 Ga0105237_10151542 Ga0105237_101515422 143
73 3300009545 Ga0105237_10296552 Ga0105237_102965521 143
74 3300009553 Ga0105249_10064892 Ga0105249_100648922 143
75 3300010375 Ga0105239_10091411 Ga0105239_100914112 143
76 3300010375 Ga0105239_10500861 Ga0105239_105008611 143
77 3300011119 Ga0105246_10011686 Ga0105246_100116865 143
78 3300013104 Ga0157370_10384461 Ga0157370_103844612 143
79 3300013105 Ga0157369_10005757 Ga0157369_1000575713 143
80 3300013105 Ga0157369_10065977 Ga0157369_100659772 143
81 3300013296 Ga0157374_10004959 Ga0157374_100049594 143
82 3300013296 Ga0157374_10069404 Ga0157374_100694043 143
83 3300013296 Ga0157374_10076710 Ga0157374_100767101 143
84 3300013297 Ga0157378_10099990 Ga0157378_100999902 143
85 3300013297 Ga0157378_10191866 Ga0157378_101918662 143
86 3300013306 Ga0163162_10354950 Ga0163162_103549502 143
87 3300013306 Ga0163162_10599876 Ga0163162_105998762 143
88 3300013307 Ga0157372_10945828 Ga0157372_109458281 143
89 3300013308 Ga0157375_10013492 Ga0157375_100134925 143
90 3300013308 Ga0157375_10425799 Ga0157375_104257993 143
91 3300014325 Ga0163163_10275117 Ga0163163_102751172 143
92 3300014969 Ga0157376_10203372 Ga0157376_102033721 143
93 3300014969 Ga0157376_10495111 Ga0157376_104951112 143
94 3300017792 Ga0163161_10015051 Ga0163161_100150512 143
95 3300019161 Ga0184602_115772 Ga0184602_1157721 143
96 3300019166 Ga0184595_118846 Ga0184595_1188461 143
97 3300020069 Ga0197907_10520732 Ga0197907_105207321 143
98 3300020069 Ga0197907_10581016 Ga0197907_105810161 143
99 3300020069 Ga0197907_10610278 Ga0197907_106102781 143
100 3300020070 Ga0206356_10294992 Ga0206356_102949921 143
101 3300020070 Ga0206356_10874967 Ga0206356_108749671 143
102 3300020075 Ga0206349_1187794 Ga0206349_11877941 143
103 3300020075 Ga0206349_1335831 Ga0206349_13358311 143
104 3300020075 Ga0206349_1680554 Ga0206349_16805541 143
105 3300020075 Ga0206349_1965047 Ga0206349_19650471 143
106 3300020076 Ga0206355_1147249 Ga0206355_11472491 143
107 3300020076 Ga0206355_1267967 Ga0206355_12679671 143
108 3300020076 Ga0206355_1271688 Ga0206355_12716881 143
109 3300020076 Ga0206355_1350699 Ga0206355_13506991 143
110 3300020076 Ga0206355_1385288 Ga0206355_13852881 143
111 3300020077 Ga0206351_10293074 Ga0206351_102930741 143
112 3300020077 Ga0206351_10315708 Ga0206351_103157082 143
113 3300020077 Ga0206351_10343963 Ga0206351_103439631 143
114 3300020077 Ga0206351_10604236 Ga0206351_106042361 143
115 3300020077 Ga0206351_10614195 Ga0206351_106141951 143
116 3300020077 Ga0206351_10736055 Ga0206351_107360552 143
117 3300020077 Ga0206351_10974413 Ga0206351_109744131 143
118 3300020078 Ga0206352_10726361 Ga0206352_107263611 143
119 3300020078 Ga0206352_11312925 Ga0206352_113129251 143
120 3300020080 Ga0206350_10438208 Ga0206350_104382081 143
121 3300020080 Ga0206350_10706527 Ga0206350_107065271 143
122 3300020080 Ga0206350_11166613 Ga0206350_111666131 143
123 3300020080 Ga0206350_11467074 Ga0206350_114670741 143
124 3300020081 Ga0206354_10339928 Ga0206354_103399281 143
125 3300020081 Ga0206354_11664707 Ga0206354_116647071 143
126 3300020082 Ga0206353_10280453 Ga0206353_102804531 143
127 3300020610 Ga0154015_1093487 Ga0154015_10934871 143
128 3300020610 Ga0154015_1612928 Ga0154015_16129281 143
129 3300020610 Ga0154015_1663793 Ga0154015_16637931 143
130 3300020610 Ga0154015_1707358 Ga0154015_17073581 143
131 3300022467 Ga0224712_10065457 Ga0224712_100654571 143
132 3300022467 Ga0224712_10116782 Ga0224712_101167821 143
133 3300022467 Ga0224712_10125430 Ga0224712_101254302 143
134 3300022467 Ga0224712_10143518 Ga0224712_101435182 143
135 3300022467 Ga0224712_10447565 Ga0224712_104475651 143
136 3300022467 Ga0224712_10502110 Ga0224712_105021101 143
137 3300023561 Ga0247518_116456 Ga0247518_1164561 143
138 3300023672 Ga0247553_106721 Ga0247553_1067211 143
139 3300025315 Ga0207697_10103637 Ga0207697_101036371 143
140 3300025901 Ga0207688_10203867 Ga0207688_102038671 143
141 3300025903 Ga0207680_10058218 Ga0207680_100582182 143
142 3300025903 Ga0207680_11014883 Ga0207680_110148831 143
143 3300025904 Ga0207647_10008351 Ga0207647_100083512 143
144 3300025907 Ga0207645_10048582 Ga0207645_100485822 143
145 3300025908 Ga0207643_10225129 Ga0207643_102251292 143
146 3300025912 Ga0207707_10090550 Ga0207707_100905502 143
147 3300025921 Ga0207652_10377305 Ga0207652_103773051 143
148 3300025921 Ga0207652_10550050 Ga0207652_105500502 143
149 3300025931 Ga0207644_10156399 Ga0207644_101563992 143
150 3300025933 Ga0207706_10015144 Ga0207706_100151447 143
151 3300025934 Ga0207686_10410567 Ga0207686_104105671 143
152 3300025938 Ga0207704_10192322 Ga0207704_101923222 143
153 3300025940 Ga0207691_10006334 Ga0207691_100063348 143
154 3300025941 Ga0207711_10338500 Ga0207711_103385002 143
155 3300025941 Ga0207711_10385802 Ga0207711_103858022 143
156 3300025942 Ga0207689_10008476 Ga0207689_100084765 143
157 3300025949 Ga0207667_10035823 Ga0207667_100358232 143
158 3300025949 Ga0207667_10123609 Ga0207667_101236091 143
159 3300025960 Ga0207651_10039620 Ga0207651_100396202 143
160 3300025981 Ga0207640_10116174 Ga0207640_101161742 143
161 3300026023 Ga0207677_10223979 Ga0207677_102239792 143
162 3300026035 Ga0207703_10162257 Ga0207703_101622572 143
163 3300026088 Ga0207641_12487934 Ga0207641_124879341 143
164 3300026095 Ga0207676_10939152 Ga0207676_109391521 143
165 3300026116 Ga0207674_10349615 Ga0207674_103496152 143
166 3300026121 Ga0207683_10000538 Ga0207683_1000053825 143
167 3300028381 Ga0268264_10169549 Ga0268264_101695492 143
168 3300028577 Ga0265318_10062946 Ga0265318_100629462 143
169 3300028800 Ga0265338_10468193 Ga0265338_104681932 143
170 3300031241 Ga0265325_10067469 Ga0265325_100674692 143
171 3300031247 Ga0265340_10280614 Ga0265340_102806141 143
172 3300031247 Ga0265340_10458371 Ga0265340_104583711 143
173 3300031250 Ga0265331_10064172 Ga0265331_100641722 143
174 3300031344 Ga0265316_10087078 Ga0265316_100870783 143
175 3300031344 Ga0265316_10375432 Ga0265316_103754322 143
176 3300031344 Ga0265316_11088245 Ga0265316_110882451 143
177 3300031548 Ga0307408_100050801 Ga0307408_1000508011 143
178 3300031595 Ga0265313_10040034 Ga0265313_100400342 143
179 3300031712 Ga0265342_10079397 Ga0265342_100793971 143
180 3300031731 Ga0307405_10176626 Ga0307405_101766262 143
181 3300031995 Ga0307409_100004178 Ga0307409_10000417812 143
182 3300032002 Ga0307416_100021654 Ga0307416_1000216542 143
183 3300032004 Ga0307414_10311076 Ga0307414_103110761 143
184 3300032005 Ga0307411_10016139 Ga0307411_100161393 143
185 3300032120 Ga0316053_113640 Ga0316053_1136401 143
186 3300035691 Ga0373931_0128927 Ga0373931_0128927_439_897 143
187 3300035724 Ga0373933_0078530 Ga0373933_0078530_320_799 143
188 3300036401 Ga0373937_0002292 Ga0373937_0002292_10219_10698 143
189 3300036401 Ga0373937_0074603 Ga0373937_0074603_1049_1507 143
190 3300037068 Ga0373925_0311385 Ga0373925_0311385_598_1056 143
191 3300037471 Ga0395905_1059072 Ga0395905_1059072_143_640 143
192 3300039447 Ga0436361_0206802 Ga0436361_0206802_1414_1872 143
193 3300044673 Ga0453683_1096870 Ga0453683_1096870_26_487 143
194 3300046459 Ga0495629_0013052 Ga0495629_0013052_1037_1495 143
195 3300046517 Ga0495630_0760493 Ga0495630_0760493_110_568 143
196 3300046535 Ga0495586_0144457 Ga0495586_0144457_863_1321 143
197 3300046536 Ga0495587_0070091 Ga0495587_0070091_902_1360 143
198 3300046663 Ga0495635_0252741 Ga0495635_0252741_220_678 143
199 3300046678 Ga0495599_0418468 Ga0495599_0418468_200_658 143
200 3300047471 Ga0495684_0530846 Ga0495684_0530846_74_532 143
201 3300048903 Ga0496100_0224143 Ga0496100_0224143_543_1001 143
202 3300048905 Ga0496102_0402018 Ga0496102_0402018_254_712 143
203 3300048909 Ga0496106_0805220 Ga0496106_0805220_215_673 143
204 3300048912 Ga0496109_0550908 Ga0496109_0550908_268_726 143
205 3300048918 Ga0496115_0026503 Ga0496115_0026503_1838_2296 143
206 3300048918 Ga0496115_0303977 Ga0496115_0303977_516_968 143
207 3300053077 Ga0495601_0295461 Ga0495601_0295461_84_542 143
208 3300005331 Ga0070670_100189125 Ga0070670_1001891252 144
209 3300005339 Ga0070660_100207978 Ga0070660_1002079782 144
210 3300005367 Ga0070667_100389949 Ga0070667_1003899491 144
211 3300005436 Ga0070713_101264258 Ga0070713_1012642581 144
212 3300005535 Ga0070684_100068201 Ga0070684_1000682012 144
213 3300005536 Ga0070697_100012826 Ga0070697_1000128262 144
214 3300005546 Ga0070696_100071040 Ga0070696_1000710403 144
215 3300005549 Ga0070704_100957761 Ga0070704_1009577611 144
216 3300005563 Ga0068855_101490991 Ga0068855_1014909911 144
217 3300005577 Ga0068857_100013228 Ga0068857_1000132284 144
218 3300005618 Ga0068864_100402680 Ga0068864_1004026801 144
219 3300005841 Ga0068863_100318871 Ga0068863_1003188712 144
220 3300006173 Ga0070716_100490541 Ga0070716_1004905412 144
221 3300009093 Ga0105240_10137392 Ga0105240_101373922 144
222 3300009147 Ga0114129_10012875 Ga0114129_100128758 144
223 3300009177 Ga0105248_10067100 Ga0105248_100671006 144
224 3300009551 Ga0105238_10447587 Ga0105238_104475871 144
225 3300010375 Ga0105239_10203382 Ga0105239_102033822 144
226 3300013104 Ga0157370_10418603 Ga0157370_104186031 144
227 3300013105 Ga0157369_10339892 Ga0157369_103398922 144
228 3300013105 Ga0157369_11216694 Ga0157369_112166941 144
229 3300013296 Ga0157374_10050205 Ga0157374_100502056 144
230 3300013306 Ga0163162_11747767 Ga0163162_117477671 144
231 3300014325 Ga0163163_10003373 Ga0163163_100033735 144
232 3300020069 Ga0197907_10845772 Ga0197907_108457721 144
233 3300020077 Ga0206351_10374921 Ga0206351_103749211 144
234 3300020078 Ga0206352_10572176 Ga0206352_105721761 144
235 3300020080 Ga0206350_10232606 Ga0206350_102326061 144
236 3300020610 Ga0154015_1676406 Ga0154015_16764061 144
237 3300021377 Ga0213874_10046026 Ga0213874_100460262 144
238 3300022467 Ga0224712_10182879 Ga0224712_101828793 144
239 3300025939 Ga0207665_10227457 Ga0207665_102274571 144
240 3300025944 Ga0207661_10063824 Ga0207661_100638242 144
241 3300025949 Ga0207667_10228700 Ga0207667_102287002 144
242 3300026078 Ga0207702_10482638 Ga0207702_104826382 144
243 3300026116 Ga0207674_10018350 Ga0207674_100183506 144
244 3300030880 Ga0265776_107616 Ga0265776_1076161 144
245 3300031235 Ga0265330_10000373 Ga0265330_1000037331 144
246 3300031241 Ga0265325_10000560 Ga0265325_100005602 144
247 3300031241 Ga0265325_10068416 Ga0265325_100684161 144
248 3300031247 Ga0265340_10150428 Ga0265340_101504281 144
249 3300031249 Ga0265339_10000899 Ga0265339_1000089916 144
250 3300031344 Ga0265316_10000692 Ga0265316_100006923 144
251 3300031595 Ga0265313_10001674 Ga0265313_100016749 144
252 3300031712 Ga0265342_10000395 Ga0265342_100003956 144
253 3300036457 Ga0265778_041771 Ga0265778_041771_47_496 144
254 3300037418 Ga0395900_0367144 Ga0395900_0367144_856_1314 144
255 3300037466 Ga0395898_0030782 Ga0395898_0030782_4825_5283 144
256 3300037471 Ga0395905_0960617 Ga0395905_0960617_57_557 144
257 3300037471 Ga0395905_0967486 Ga0395905_0967486_165_665 144
258 3300037471 Ga0395905_1162044 Ga0395905_1162044_133_633 144
259 3300037471 Ga0395905_1735033 Ga0395905_1735033_41_508 144
260 3300038443 Ga0395901_0255289 Ga0395901_0255289_1177_1677 144
261 3300039450 Ga0436363_1536646 Ga0436363_1536646_3810_4301 144
262 3300039453 Ga0436362_0438158 Ga0436362_0438158_56_556 144
263 3300042876 Ga0451577_0000325 Ga0451577_0000325_39706_40209 144
264 3300042876 Ga0451577_0354053 Ga0451577_0354053_142_624 144
265 3300044673 Ga0453683_0123730 Ga0453683_0123730_163_666 144
266 3300044712 Ga0453684_0000429 Ga0453684_0000429_140319_140822 144
267 3300044842 Ga0466957_0681116 Ga0466957_0681116_129_617 144
268 3300045051 Ga0451576_0001898 Ga0451576_0001898_5207_5710 144
269 3300046684 Ga0495669_0205837 Ga0495669_0205837_139_606 144
270 3300048915 Ga0496112_0184421 Ga0496112_0184421_1520_2008 144
271 3300048918 Ga0496115_0369947 Ga0496115_0369947_23_481 144
272 3300050507 nmdc:mga05p37_75476_c1 nmdc:mga05p37_75476_c1_2516_2998 144
273 3300004799 Ga0058863_10086594 Ga0058863_100865942 145
274 3300004800 Ga0058861_10077517 Ga0058861_100775172 145
275 3300005336 Ga0070680_100084424 Ga0070680_1000844243 145
276 3300005336 Ga0070680_100267067 Ga0070680_1002670672 145
277 3300005337 Ga0070682_100628947 Ga0070682_1006289472 145
278 3300005434 Ga0070709_10063625 Ga0070709_100636252 145
279 3300005436 Ga0070713_100049683 Ga0070713_1000496834 145
280 3300005458 Ga0070681_11034360 Ga0070681_110343601 145
281 3300005458 Ga0070681_11141222 Ga0070681_111412221 145
282 3300005530 Ga0070679_100601875 Ga0070679_1006018751 145
283 3300005530 Ga0070679_101084272 Ga0070679_1010842721 145
284 3300005548 Ga0070665_100049205 Ga0070665_1000492053 145
285 3300005548 Ga0070665_100114970 Ga0070665_1001149702 145
286 3300005548 Ga0070665_100693015 Ga0070665_1006930151 145
287 3300005563 Ga0068855_100438610 Ga0068855_1004386101 145
288 3300005614 Ga0068856_101065512 Ga0068856_1010655121 145
289 3300006028 Ga0070717_10168127 Ga0070717_101681271 145
290 3300006028 Ga0070717_10542988 Ga0070717_105429882 145
291 3300013105 Ga0157369_10110906 Ga0157369_101109062 145
292 3300013306 Ga0163162_11264993 Ga0163162_112649931 145
293 3300013307 Ga0157372_10978858 Ga0157372_109788581 145
294 3300020075 Ga0206349_1362241 Ga0206349_13622411 145
295 3300020077 Ga0206351_10245823 Ga0206351_102458231 145
296 3300020077 Ga0206351_10561193 Ga0206351_105611931 145
297 3300020077 Ga0206351_10918230 Ga0206351_109182301 145
298 3300020078 Ga0206352_10019431 Ga0206352_100194311 145
299 3300020078 Ga0206352_10832553 Ga0206352_108325531 145
300 3300020078 Ga0206352_11334485 Ga0206352_113344851 145
301 3300020080 Ga0206350_10199177 Ga0206350_101991771 145
302 3300020082 Ga0206353_10894400 Ga0206353_108944001 145
303 3300021377 Ga0213874_10072283 Ga0213874_100722832 145
304 3300022467 Ga0224712_10039891 Ga0224712_100398912 145
305 3300023672 Ga0247553_106660 Ga0247553_1066601 145
306 3300025911 Ga0207654_10599372 Ga0207654_105993722 145
307 3300025912 Ga0207707_10960317 Ga0207707_109603172 145
308 3300025913 Ga0207695_10852549 Ga0207695_108525492 145
309 3300025917 Ga0207660_10110271 Ga0207660_101102712 145
310 3300025921 Ga0207652_11198133 Ga0207652_111981331 145
311 3300025928 Ga0207700_10147515 Ga0207700_101475152 145
312 3300025939 Ga0207665_10134120 Ga0207665_101341202 145
313 3300025939 Ga0207665_10723152 Ga0207665_107231521 145
314 3300025949 Ga0207667_10431833 Ga0207667_104318332 145
315 3300025949 Ga0207667_11414950 Ga0207667_114149502 145
316 3300028379 Ga0268266_10294418 Ga0268266_102944181 145
317 3300028379 Ga0268266_11338648 Ga0268266_113386481 145
318 3300037471 Ga0395905_0036893 Ga0395905_0036893_1967_2473 145
319 3300037471 Ga0395905_0072198 Ga0395905_0072198_2635_3117 145
320 3300037471 Ga0395905_0087258 Ga0395905_0087258_700_1173 145
321 3300038443 Ga0395901_0588965 Ga0395901_0588965_527_1009 145
322 3300038443 Ga0395901_0958336 Ga0395901_0958336_63_536 145
323 3300039437 Ga0436365_0167286 Ga0436365_0167286_329_835 145
324 3300039450 Ga0436363_1572531 Ga0436363_1572531_2618_3124 145
325 3300045976 Ga0466967_0271241 Ga0466967_0271241_855_1406 145
326 3300046477 Ga0495664_0016858 Ga0495664_0016858_2513_3052 145
327 3300046536 Ga0495587_0057391 Ga0495587_0057391_705_1244 145
328 3300046543 Ga0495645_0051066 Ga0495645_0051066_2059_2598 145
329 3300046559 Ga0495667_0862773 Ga0495667_0862773_52_525 145
330 3300046663 Ga0495635_0347245 Ga0495635_0347245_424_897 145
331 3300046675 Ga0495657_0211488 Ga0495657_0211488_383_922 145
332 3300046679 Ga0495623_0077117 Ga0495623_0077117_541_1080 145
333 3300047444 Ga0495675_0071446 Ga0495675_0071446_1098_1637 145
334 3300047444 Ga0495675_0192758 Ga0495675_0192758_79_618 145
335 3300047445 Ga0495677_0095382 Ga0495677_0095382_105_578 145
336 3300048915 Ga0496112_0019906 Ga0496112_0019906_5139_5645 145
337 3300059490 Ga0587066_084460 Ga0587066_084460_67_531 145
338 3300059492 Ga0587073_0103812 Ga0587073_0103812_124_588 145
339 3300003323 rootH1_10383157 rootH1_103831571 146
340 3300005547 Ga0070693_100027985 Ga0070693_1000279852 146
341 3300005616 Ga0068852_100406278 Ga0068852_1004062782 146
342 3300005834 Ga0068851_10634232 Ga0068851_106342321 146
343 3300020077 Ga0206351_10037011 Ga0206351_100370111 146
344 3300020078 Ga0206352_10567405 Ga0206352_105674051 146
345 3300026142 Ga0207698_10235273 Ga0207698_102352732 146
346 3300039453 Ga0436362_0674302 Ga0436362_0674302_513_998 146
347 3300048929 Ga0496126_0419086 Ga0496126_0419086_106_585 146
348 3300050515 nmdc:mga0a205_1094342_c1 nmdc:mga0a205_1094342_c1_65_562 146

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17886

ArsA_HSP20

HSP20-like domain found in ArsA

65

146

0.96

PF00011

HSP20

Hsp20/alpha crystallin family

60

162

0.92

PF04969

CS

CS domain

57

148

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ds2-assembly2.cif.gz_D core domain of the class i small heat-shock protein hsp 18.1 from pisum sativum 0.8657 42 134
5ds2-assembly2.cif.gz_D core domain of the class i small heat-shock protein hsp 18.1 from pisum sativum 0.8484 42 134
2h50-assembly1.cif.gz_P multiple distinct assemblies reveal conformational flexibility in the small heat shock protein hsp26 0.8447 44 134
2jki-assembly3.cif.gz_U complex of hsp90 n-terminal and sgt1 cs domain 0.8395 42 134
7l7i-assembly1.cif.gz_E cryo-em structure of hsp90:fkbp51:p23 closed-state complex 0.8282 39 134
ID Description Score Start End Superfamily
af_Q9D9A7_3_126_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8698 43 134 2.60.40.790
5ds2D00 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8657 42 134 2.60.40.790
af_A0A144A1J3_25_143_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8584 41 134 2.60.40.790
af_Q8S1F2_1_96_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8521 30 138 2.60.40.790
af_A0A1D6GL72_7_81_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8517 62 138 2.60.40.790
ID Description Score Start End GO Terms
AF-A0A2D4Z8W5-F1-model_v4 deleted 0.85 41 146
AF-A0A1G0K3F4-F1-model_v4 Heat-shock protein Hsp20 0.8361 38 146
AF-A0A1G0K3F4-F1-model_v4 Heat-shock protein Hsp20 0.822 38 146
AF-A0A3M1CST7-F1-model_v4 Hsp20/alpha crystallin family protein 0.8213 41 146
AF-A0A350I0T8-F1-model_v4 Heat-shock protein Hsp20 0.8187 31 146

Feature Viewer

pLDDT pTM Quality
76.11 0.63 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map