F417654
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 348 | 193 | 348 | 156 |
Family's Representative Sequence
| Representative Sequence | 3300045976|Ga0466967_0271241|Ga0466967_0271241_855_1406 |
| Length | 183 |
| Sequence | MRKHSFDSKPLEEKIMVITRWDPFHDFSALQNRVNSLFQDYSRTGQDELTTVGSFVPAVDVYEDEHRVTLKLEIPGINQEDVDIRLENNTLTVRGERKFEKEEKEENFHRIERRYGSFARSFTLPNTLDPDSVTANYENGVLKIELAKRAEAKPKQIKVNIGSGKTLGKTVEGTKAESKTQAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 2 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 3 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 4 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 29 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 35 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 36 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 37 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 38 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 39 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 40 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 41 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 42 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 43 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 44 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 45 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 46 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 50 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 52 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300019161 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA2 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 74 | 3300019166 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 75 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 76 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 77 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 78 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 79 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 80 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 81 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 82 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 83 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 84 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 85 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 86 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 87 | 3300023561 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 88 | 3300023672 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 89 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 124 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 125 | 3300030880 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 126 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 127 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 128 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 129 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 130 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 131 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 132 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 133 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 134 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 135 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 136 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 137 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 138 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 139 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 140 | 3300032120 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 141 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 142 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 143 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 144 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 145 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 146 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 147 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 148 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 149 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 150 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 151 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 152 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 153 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 154 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 155 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 156 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 157 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 158 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 159 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 160 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 161 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 162 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 163 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 180 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 181 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 182 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 183 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 184 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 185 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 186 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 187 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 188 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 189 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 190 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 191 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 193 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 78.16 |
| Metatranscriptomes | 21.84 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 2.59 |
| Rhizosphere | 94.83 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.59 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10383157 | 3300003323 | Bacteria | 1242 |
| 2 | Ga0058863_10086594 | 3300004799 | Bacteria | 1011 |
| 3 | Ga0058861_10051339 | 3300004800 | Bacteria | 845 |
| 4 | Ga0058861_10077517 | 3300004800 | Bacteria | 1103 |
| 5 | Ga0058861_11782676 | 3300004800 | Bacteria | 649 |
| 6 | Ga0058862_10226840 | 3300004803 | Bacteria | 558 |
| 7 | Ga0058862_10254669 | 3300004803 | Bacteria | 717 |
| 8 | Ga0058862_12627438 | 3300004803 | Bacteria | 718 |
| 9 | Ga0070658_11125725 | 3300005327 | Bacteria | 683 |
| 10 | Ga0070676_10128807 | 3300005328 | Bacteria | 1598 |
| 11 | Ga0070683_101144033 | 3300005329 | Bacteria | 748 |
| 12 | Ga0070690_100557192 | 3300005330 | Bacteria | 865 |
| 13 | Ga0070670_100016038 | 3300005331 | Bacteria | 6429 |
| 14 | Ga0070670_100189125 | 3300005331 | Bacteria | 1788 |
| 15 | Ga0070666_10023949 | 3300005335 | Bacteria | 3975 |
| 16 | Ga0070666_10828979 | 3300005335 | Bacteria | 682 |
| 17 | Ga0070680_100084424 | 3300005336 | Unclassified | 2622 |
| 18 | Ga0070680_100140932 | 3300005336 | Bacteria | 2022 |
| 19 | Ga0070680_100267067 | 3300005336 | Bacteria | 1448 |
| 20 | Ga0070682_100267988 | 3300005337 | Bacteria | 1239 |
| 21 | Ga0070682_100628947 | 3300005337 | Bacteria | 852 |
| 22 | Ga0070660_100207978 | 3300005339 | Bacteria | 1588 |
| 23 | Ga0070675_100072244 | 3300005354 | Bacteria | 2864 |
| 24 | Ga0070671_100023925 | 3300005355 | Bacteria | 4998 |
| 25 | Ga0070671_100709319 | 3300005355 | Bacteria | 873 |
| 26 | Ga0070674_100282377 | 3300005356 | Bacteria | 1316 |
| 27 | Ga0070673_100184742 | 3300005364 | Bacteria | 1786 |
| 28 | Ga0070688_100324907 | 3300005365 | Bacteria | 1119 |
| 29 | Ga0070667_100074971 | 3300005367 | Bacteria | 2887 |
| 30 | Ga0070667_100389949 | 3300005367 | Bacteria | 1266 |
| 31 | Ga0070709_10063625 | 3300005434 | Bacteria | 2357 |
| 32 | Ga0070713_100049683 | 3300005436 | Unclassified | 3461 |
| 33 | Ga0070713_101264258 | 3300005436 | Bacteria | 715 |
| 34 | Ga0070678_100007527 | 3300005456 | Bacteria | 6467 |
| 35 | Ga0070662_100003983 | 3300005457 | Bacteria | 9252 |
| 36 | Ga0070681_10030956 | 3300005458 | Bacteria | 5371 |
| 37 | Ga0070681_11034360 | 3300005458 | Bacteria | 741 |
| 38 | Ga0070681_11141222 | 3300005458 | Bacteria | 701 |
| 39 | Ga0070679_100300160 | 3300005530 | Bacteria | 1557 |
| 40 | Ga0070679_100601875 | 3300005530 | Bacteria | 1042 |
| 41 | Ga0070679_101084272 | 3300005530 | Bacteria | 745 |
| 42 | Ga0070684_100068201 | 3300005535 | Bacteria | 3126 |
| 43 | Ga0070697_100012826 | 3300005536 | Bacteria | 6565 |
| 44 | Ga0068853_100106162 | 3300005539 | Bacteria | 2489 |
| 45 | Ga0070672_100002005 | 3300005543 | Bacteria | 12791 |
| 46 | Ga0070696_100071040 | 3300005546 | Bacteria | 2449 |
| 47 | Ga0070696_101306553 | 3300005546 | Bacteria | 616 |
| 48 | Ga0070693_100027985 | 3300005547 | Unclassified | 3061 |
| 49 | Ga0070665_100020643 | 3300005548 | Bacteria | 6618 |
| 50 | Ga0070665_100049205 | 3300005548 | Bacteria | 4229 |
| 51 | Ga0070665_100114970 | 3300005548 | Bacteria | 2693 |
| 52 | Ga0070665_100693015 | 3300005548 | Bacteria | 1032 |
| 53 | Ga0070704_100957761 | 3300005549 | Unclassified | 772 |
| 54 | Ga0068855_100044675 | 3300005563 | Bacteria | 5243 |
| 55 | Ga0068855_100058062 | 3300005563 | Bacteria | 4533 |
| 56 | Ga0068855_100438610 | 3300005563 | Bacteria | 1427 |
| 57 | Ga0068855_101490991 | 3300005563 | Bacteria | 695 |
| 58 | Ga0068857_100013228 | 3300005577 | Bacteria | 7191 |
| 59 | Ga0068857_100395049 | 3300005577 | Bacteria | 1286 |
| 60 | Ga0068856_100017420 | 3300005614 | Bacteria | 6961 |
| 61 | Ga0068856_101065512 | 3300005614 | Bacteria | 826 |
| 62 | Ga0068856_101189323 | 3300005614 | Bacteria | 779 |
| 63 | Ga0068852_100031489 | 3300005616 | Bacteria | 4377 |
| 64 | Ga0068852_100406278 | 3300005616 | Unclassified | 1340 |
| 65 | Ga0068859_100542482 | 3300005617 | Bacteria | 1258 |
| 66 | Ga0068864_100013695 | 3300005618 | Bacteria | 6726 |
| 67 | Ga0068864_100402680 | 3300005618 | Bacteria | 1301 |
| 68 | Ga0068861_100843183 | 3300005719 | Bacteria | 863 |
| 69 | Ga0068851_10634232 | 3300005834 | Unclassified | 653 |
| 70 | Ga0068870_10360148 | 3300005840 | Bacteria | 936 |
| 71 | Ga0068863_100318871 | 3300005841 | Bacteria | 1509 |
| 72 | Ga0068863_102526738 | 3300005841 | Bacteria | 523 |
| 73 | Ga0068858_100048599 | 3300005842 | Bacteria | 3929 |
| 74 | Ga0068860_100056734 | 3300005843 | Bacteria | 3722 |
| 75 | Ga0068860_102242980 | 3300005843 | Bacteria | 567 |
| 76 | Ga0070717_10168127 | 3300006028 | Bacteria | 1906 |
| 77 | Ga0070717_10542988 | 3300006028 | Unclassified | 1052 |
| 78 | Ga0070716_100490541 | 3300006173 | Unclassified | 904 |
| 79 | Ga0097621_100059084 | 3300006237 | Bacteria | 3138 |
| 80 | Ga0068871_100012609 | 3300006358 | Bacteria | 6241 |
| 81 | Ga0097620_100542495 | 3300006931 | Bacteria | 1258 |
| 82 | Ga0099794_10109840 | 3300007265 | Unclassified | 1381 |
| 83 | Ga0105240_10137392 | 3300009093 | Unclassified | 2926 |
| 84 | Ga0105240_10192371 | 3300009093 | Bacteria | 2398 |
| 85 | Ga0105240_11010787 | 3300009093 | Bacteria | 889 |
| 86 | Ga0105240_11631972 | 3300009093 | Bacteria | 674 |
| 87 | Ga0114129_10012875 | 3300009147 | Bacteria | 11903 |
| 88 | Ga0105243_10276858 | 3300009148 | Bacteria | 1509 |
| 89 | Ga0105243_10548537 | 3300009148 | Bacteria | 1104 |
| 90 | Ga0105241_10425449 | 3300009174 | Bacteria | 1170 |
| 91 | Ga0105242_10152637 | 3300009176 | Bacteria | 2015 |
| 92 | Ga0105248_10005228 | 3300009177 | Bacteria | 14297 |
| 93 | Ga0105248_10067100 | 3300009177 | Bacteria | 4028 |
| 94 | Ga0105248_10074097 | 3300009177 | Bacteria | 3826 |
| 95 | Ga0105237_10151542 | 3300009545 | Bacteria | 2315 |
| 96 | Ga0105237_10296552 | 3300009545 | Bacteria | 1620 |
| 97 | Ga0105238_10447587 | 3300009551 | Bacteria | 1288 |
| 98 | Ga0105249_10064892 | 3300009553 | Bacteria | 3358 |
| 99 | Ga0105239_10091411 | 3300010375 | Bacteria | 3358 |
| 100 | Ga0105239_10203382 | 3300010375 | Bacteria | 2219 |
| 101 | Ga0105239_10500861 | 3300010375 | Bacteria | 1381 |
| 102 | Ga0105246_10011686 | 3300011119 | Bacteria | 5455 |
| 103 | Ga0157370_10384461 | 3300013104 | Bacteria | 1293 |
| 104 | Ga0157370_10418603 | 3300013104 | Bacteria | 1233 |
| 105 | Ga0157369_10005757 | 3300013105 | Bacteria | 14407 |
| 106 | Ga0157369_10065977 | 3300013105 | Bacteria | 3894 |
| 107 | Ga0157369_10110906 | 3300013105 | Bacteria | 2916 |
| 108 | Ga0157369_10339892 | 3300013105 | Bacteria | 1560 |
| 109 | Ga0157369_11216694 | 3300013105 | Bacteria | 769 |
| 110 | Ga0157374_10004959 | 3300013296 | Bacteria | 11171 |
| 111 | Ga0157374_10050205 | 3300013296 | Bacteria | 3877 |
| 112 | Ga0157374_10069404 | 3300013296 | Bacteria | 3318 |
| 113 | Ga0157374_10076710 | 3300013296 | Bacteria | 3161 |
| 114 | Ga0157378_10099990 | 3300013297 | Bacteria | 2647 |
| 115 | Ga0157378_10191866 | 3300013297 | Bacteria | 1927 |
| 116 | Ga0163162_10354950 | 3300013306 | Bacteria | 1599 |
| 117 | Ga0163162_10599876 | 3300013306 | Bacteria | 1227 |
| 118 | Ga0163162_11264993 | 3300013306 | Bacteria | 838 |
| 119 | Ga0163162_11747767 | 3300013306 | Bacteria | 711 |
| 120 | Ga0157372_10029172 | 3300013307 | Bacteria | 6022 |
| 121 | Ga0157372_10129867 | 3300013307 | Bacteria | 2898 |
| 122 | Ga0157372_10945828 | 3300013307 | Bacteria | 999 |
| 123 | Ga0157372_10978858 | 3300013307 | Unclassified | 980 |
| 124 | Ga0157375_10013492 | 3300013308 | Bacteria | 7275 |
| 125 | Ga0157375_10425799 | 3300013308 | Bacteria | 1493 |
| 126 | Ga0163163_10003373 | 3300014325 | Bacteria | 13552 |
| 127 | Ga0163163_10275117 | 3300014325 | Bacteria | 1735 |
| 128 | Ga0157376_10203372 | 3300014969 | Bacteria | 1824 |
| 129 | Ga0157376_10495111 | 3300014969 | Bacteria | 1200 |
| 130 | Ga0163161_10015051 | 3300017792 | Bacteria | 5391 |
| 131 | Ga0184602_115772 | 3300019161 | Bacteria | 786 |
| 132 | Ga0184595_118846 | 3300019166 | Bacteria | 544 |
| 133 | Ga0197907_10520732 | 3300020069 | Bacteria | 817 |
| 134 | Ga0197907_10581016 | 3300020069 | Bacteria | 746 |
| 135 | Ga0197907_10610278 | 3300020069 | Bacteria | 648 |
| 136 | Ga0197907_10845772 | 3300020069 | Bacteria | 1002 |
| 137 | Ga0206356_10294992 | 3300020070 | Bacteria | 635 |
| 138 | Ga0206356_10874967 | 3300020070 | Bacteria | 549 |
| 139 | Ga0206349_1187794 | 3300020075 | Bacteria | 720 |
| 140 | Ga0206349_1335831 | 3300020075 | Bacteria | 560 |
| 141 | Ga0206349_1362241 | 3300020075 | Unclassified | 639 |
| 142 | Ga0206349_1680554 | 3300020075 | Unclassified | 650 |
| 143 | Ga0206349_1965047 | 3300020075 | Bacteria | 554 |
| 144 | Ga0206355_1147249 | 3300020076 | Bacteria | 806 |
| 145 | Ga0206355_1267967 | 3300020076 | Unclassified | 553 |
| 146 | Ga0206355_1271688 | 3300020076 | Bacteria | 584 |
| 147 | Ga0206355_1350699 | 3300020076 | Bacteria | 538 |
| 148 | Ga0206355_1385288 | 3300020076 | Bacteria | 661 |
| 149 | Ga0206351_10037011 | 3300020077 | Unclassified | 895 |
| 150 | Ga0206351_10245823 | 3300020077 | Bacteria | 512 |
| 151 | Ga0206351_10293074 | 3300020077 | Bacteria | 730 |
| 152 | Ga0206351_10315708 | 3300020077 | Bacteria | 1667 |
| 153 | Ga0206351_10343963 | 3300020077 | Bacteria | 610 |
| 154 | Ga0206351_10374921 | 3300020077 | Bacteria | 1377 |
| 155 | Ga0206351_10561193 | 3300020077 | Unclassified | 590 |
| 156 | Ga0206351_10604236 | 3300020077 | Bacteria | 618 |
| 157 | Ga0206351_10614195 | 3300020077 | Bacteria | 561 |
| 158 | Ga0206351_10736055 | 3300020077 | Bacteria | 1001 |
| 159 | Ga0206351_10918230 | 3300020077 | Bacteria | 532 |
| 160 | Ga0206351_10974413 | 3300020077 | Bacteria | 838 |
| 161 | Ga0206352_10019431 | 3300020078 | Unclassified | 588 |
| 162 | Ga0206352_10567405 | 3300020078 | Unclassified | 1111 |
| 163 | Ga0206352_10572176 | 3300020078 | Bacteria | 714 |
| 164 | Ga0206352_10726361 | 3300020078 | Bacteria | 828 |
| 165 | Ga0206352_10832553 | 3300020078 | Bacteria | 518 |
| 166 | Ga0206352_11312925 | 3300020078 | Unclassified | 580 |
| 167 | Ga0206352_11334485 | 3300020078 | Bacteria | 575 |
| 168 | Ga0206350_10199177 | 3300020080 | Bacteria | 527 |
| 169 | Ga0206350_10232606 | 3300020080 | Bacteria | 834 |
| 170 | Ga0206350_10438208 | 3300020080 | Bacteria | 570 |
| 171 | Ga0206350_10706527 | 3300020080 | Bacteria | 602 |
| 172 | Ga0206350_11166613 | 3300020080 | Bacteria | 785 |
| 173 | Ga0206350_11467074 | 3300020080 | Unclassified | 847 |
| 174 | Ga0206354_10339928 | 3300020081 | Unclassified | 547 |
| 175 | Ga0206354_11664707 | 3300020081 | Bacteria | 652 |
| 176 | Ga0206353_10280453 | 3300020082 | Bacteria | 563 |
| 177 | Ga0206353_10894400 | 3300020082 | Bacteria | 587 |
| 178 | Ga0154015_1093487 | 3300020610 | Bacteria | 547 |
| 179 | Ga0154015_1612928 | 3300020610 | Bacteria | 779 |
| 180 | Ga0154015_1663793 | 3300020610 | Bacteria | 690 |
| 181 | Ga0154015_1676406 | 3300020610 | Bacteria | 1290 |
| 182 | Ga0154015_1707358 | 3300020610 | Bacteria | 629 |
| 183 | Ga0213874_10046026 | 3300021377 | Bacteria | 1323 |
| 184 | Ga0213874_10072283 | 3300021377 | Unclassified | 1102 |
| 185 | Ga0224712_10039891 | 3300022467 | Bacteria | 1763 |
| 186 | Ga0224712_10065457 | 3300022467 | Bacteria | 1461 |
| 187 | Ga0224712_10116782 | 3300022467 | Bacteria | 1151 |
| 188 | Ga0224712_10125430 | 3300022467 | Bacteria | 1116 |
| 189 | Ga0224712_10143518 | 3300022467 | Unclassified | 1053 |
| 190 | Ga0224712_10182879 | 3300022467 | Bacteria | 945 |
| 191 | Ga0224712_10447565 | 3300022467 | Bacteria | 620 |
| 192 | Ga0224712_10502110 | 3300022467 | Bacteria | 586 |
| 193 | Ga0247518_116456 | 3300023561 | Bacteria | 646 |
| 194 | Ga0247553_106660 | 3300023672 | Bacteria | 618 |
| 195 | Ga0247553_106721 | 3300023672 | Bacteria | 616 |
| 196 | Ga0207697_10103637 | 3300025315 | Bacteria | 1214 |
| 197 | Ga0207688_10203867 | 3300025901 | Bacteria | 1187 |
| 198 | Ga0207680_10058218 | 3300025903 | Bacteria | 2341 |
| 199 | Ga0207680_11014883 | 3300025903 | Bacteria | 594 |
| 200 | Ga0207647_10008351 | 3300025904 | Bacteria | 7427 |
| 201 | Ga0207645_10048582 | 3300025907 | Bacteria | 2710 |
| 202 | Ga0207643_10225129 | 3300025908 | Bacteria | 1149 |
| 203 | Ga0207654_10599372 | 3300025911 | Bacteria | 786 |
| 204 | Ga0207707_10090550 | 3300025912 | Bacteria | 2673 |
| 205 | Ga0207707_10960317 | 3300025912 | Bacteria | 703 |
| 206 | Ga0207695_10852549 | 3300025913 | Bacteria | 791 |
| 207 | Ga0207660_10110271 | 3300025917 | Bacteria | 2070 |
| 208 | Ga0207652_10377305 | 3300025921 | Bacteria | 1280 |
| 209 | Ga0207652_10550050 | 3300025921 | Bacteria | 1037 |
| 210 | Ga0207652_11198133 | 3300025921 | Bacteria | 661 |
| 211 | Ga0207700_10147515 | 3300025928 | Unclassified | 1941 |
| 212 | Ga0207644_10156399 | 3300025931 | Bacteria | 1768 |
| 213 | Ga0207706_10015144 | 3300025933 | Bacteria | 6979 |
| 214 | Ga0207686_10410567 | 3300025934 | Bacteria | 1033 |
| 215 | Ga0207704_10192322 | 3300025938 | Bacteria | 1485 |
| 216 | Ga0207665_10134120 | 3300025939 | Bacteria | 1760 |
| 217 | Ga0207665_10227457 | 3300025939 | Unclassified | 1370 |
| 218 | Ga0207665_10723152 | 3300025939 | Bacteria | 783 |
| 219 | Ga0207691_10006334 | 3300025940 | Bacteria | 11428 |
| 220 | Ga0207711_10338500 | 3300025941 | Bacteria | 1392 |
| 221 | Ga0207711_10385802 | 3300025941 | Bacteria | 1300 |
| 222 | Ga0207689_10008476 | 3300025942 | Bacteria | 8956 |
| 223 | Ga0207661_10063824 | 3300025944 | Bacteria | 2984 |
| 224 | Ga0207667_10035823 | 3300025949 | Bacteria | 5323 |
| 225 | Ga0207667_10123609 | 3300025949 | Bacteria | 2666 |
| 226 | Ga0207667_10228700 | 3300025949 | Bacteria | 1905 |
| 227 | Ga0207667_10431833 | 3300025949 | Bacteria | 1339 |
| 228 | Ga0207667_11414950 | 3300025949 | Bacteria | 668 |
| 229 | Ga0207651_10039620 | 3300025960 | Bacteria | 3109 |
| 230 | Ga0207640_10116174 | 3300025981 | Bacteria | 1907 |
| 231 | Ga0207677_10223979 | 3300026023 | Bacteria | 1510 |
| 232 | Ga0207703_10162257 | 3300026035 | Bacteria | 1958 |
| 233 | Ga0207702_10482638 | 3300026078 | Bacteria | 1206 |
| 234 | Ga0207641_12487934 | 3300026088 | Bacteria | 516 |
| 235 | Ga0207676_10939152 | 3300026095 | Bacteria | 850 |
| 236 | Ga0207674_10018350 | 3300026116 | Bacteria | 7607 |
| 237 | Ga0207674_10349615 | 3300026116 | Bacteria | 1429 |
| 238 | Ga0207683_10000538 | 3300026121 | Bacteria | 35079 |
| 239 | Ga0207698_10235273 | 3300026142 | Bacteria | 1666 |
| 240 | Ga0268266_10294418 | 3300028379 | Bacteria | 1512 |
| 241 | Ga0268266_11338648 | 3300028379 | Unclassified | 691 |
| 242 | Ga0268264_10169549 | 3300028381 | Bacteria | 1973 |
| 243 | Ga0265318_10062946 | 3300028577 | Bacteria | 1381 |
| 244 | Ga0265338_10468193 | 3300028800 | Bacteria | 890 |
| 245 | Ga0265776_107616 | 3300030880 | Unclassified | 601 |
| 246 | Ga0265330_10000373 | 3300031235 | Bacteria | 31405 |
| 247 | Ga0265325_10000560 | 3300031241 | Bacteria | 27013 |
| 248 | Ga0265325_10067469 | 3300031241 | Unclassified | 1802 |
| 249 | Ga0265325_10068416 | 3300031241 | Unclassified | 1787 |
| 250 | Ga0265340_10150428 | 3300031247 | Bacteria | 1061 |
| 251 | Ga0265340_10280614 | 3300031247 | Bacteria | 740 |
| 252 | Ga0265340_10458371 | 3300031247 | Bacteria | 561 |
| 253 | Ga0265339_10000899 | 3300031249 | Bacteria | 22835 |
| 254 | Ga0265331_10064172 | 3300031250 | Bacteria | 1729 |
| 255 | Ga0265316_10000692 | 3300031344 | Bacteria | 37515 |
| 256 | Ga0265316_10087078 | 3300031344 | Bacteria | 2387 |
| 257 | Ga0265316_10375432 | 3300031344 | Bacteria | 1026 |
| 258 | Ga0265316_11088245 | 3300031344 | Bacteria | 555 |
| 259 | Ga0307408_100050801 | 3300031548 | Bacteria | 2983 |
| 260 | Ga0265313_10001674 | 3300031595 | Bacteria | 20509 |
| 261 | Ga0265313_10040034 | 3300031595 | Bacteria | 2320 |
| 262 | Ga0265342_10000395 | 3300031712 | Bacteria | 48238 |
| 263 | Ga0265342_10079397 | 3300031712 | Bacteria | 1897 |
| 264 | Ga0307405_10176626 | 3300031731 | Bacteria | 1529 |
| 265 | Ga0307409_100004178 | 3300031995 | Bacteria | 8046 |
| 266 | Ga0307416_100021654 | 3300032002 | Bacteria | 4621 |
| 267 | Ga0307416_100298747 | 3300032002 | Bacteria | 1599 |
| 268 | Ga0307414_10311076 | 3300032004 | Bacteria | 1337 |
| 269 | Ga0307411_10016139 | 3300032005 | Bacteria | 4222 |
| 270 | Ga0316053_113640 | 3300032120 | Bacteria | 591 |
| 271 | Ga0373946_0110205 | 3300035171 | Bacteria | 1245 |
| 272 | Ga0373931_0128927 | 3300035691 | Bacteria | 1454 |
| 273 | Ga0373933_0078530 | 3300035724 | Bacteria | 2020 |
| 274 | Ga0373947_0029509 | 3300035725 | Bacteria | 3219 |
| 275 | Ga0373937_0002292 | 3300036401 | Bacteria | 15978 |
| 276 | Ga0373937_0074603 | 3300036401 | Bacteria | 3130 |
| 277 | Ga0265778_041771 | 3300036457 | Bacteria | 612 |
| 278 | Ga0373925_0311385 | 3300037068 | Bacteria | 1273 |
| 279 | Ga0395900_0367144 | 3300037418 | Bacteria | 1410 |
| 280 | Ga0395898_0030782 | 3300037466 | Bacteria | 5369 |
| 281 | Ga0395905_0036893 | 3300037471 | Bacteria | 4591 |
| 282 | Ga0395905_0072198 | 3300037471 | Bacteria | 3236 |
| 283 | Ga0395905_0087258 | 3300037471 | Bacteria | 2925 |
| 284 | Ga0395905_0960617 | 3300037471 | Bacteria | 757 |
| 285 | Ga0395905_0967486 | 3300037471 | Bacteria | 754 |
| 286 | Ga0395905_1059072 | 3300037471 | Bacteria | 714 |
| 287 | Ga0395905_1162044 | 3300037471 | Bacteria | 675 |
| 288 | Ga0395905_1735033 | 3300037471 | Bacteria | 530 |
| 289 | Ga0395901_0255289 | 3300038443 | Bacteria | 1826 |
| 290 | Ga0395901_0588965 | 3300038443 | Bacteria | 1123 |
| 291 | Ga0395901_0958336 | 3300038443 | Bacteria | 834 |
| 292 | Ga0436365_0167286 | 3300039437 | Bacteria | 1113 |
| 293 | Ga0436361_0206802 | 3300039447 | Bacteria | 2086 |
| 294 | Ga0436363_1536646 | 3300039450 | Bacteria | 5052 |
| 295 | Ga0436363_1572531 | 3300039450 | Bacteria | 4222 |
| 296 | Ga0436362_0438158 | 3300039453 | Unclassified | 757 |
| 297 | Ga0436362_0674302 | 3300039453 | Bacteria | 1170 |
| 298 | Ga0451839_0548124 | 3300041496 | Bacteria | 908 |
| 299 | Ga0451577_0000325 | 3300042876 | Bacteria | 89199 |
| 300 | Ga0451577_0354053 | 3300042876 | Bacteria | 1332 |
| 301 | Ga0453683_0123730 | 3300044673 | Bacteria | 1628 |
| 302 | Ga0453683_1096870 | 3300044673 | Bacteria | 531 |
| 303 | Ga0453684_0000429 | 3300044712 | Bacteria | 171513 |
| 304 | Ga0466957_0128247 | 3300044842 | Bacteria | 1623 |
| 305 | Ga0466957_0165823 | 3300044842 | Bacteria | 1437 |
| 306 | Ga0466957_0681116 | 3300044842 | Bacteria | 725 |
| 307 | Ga0451576_0001898 | 3300045051 | Bacteria | 33560 |
| 308 | Ga0466967_0271241 | 3300045976 | Unclassified | 1626 |
| 309 | Ga0466967_1895551 | 3300045976 | Bacteria | 593 |
| 310 | Ga0495629_0013052 | 3300046459 | Bacteria | 6003 |
| 311 | Ga0495664_0016858 | 3300046477 | Bacteria | 4171 |
| 312 | Ga0495630_0760493 | 3300046517 | Bacteria | 740 |
| 313 | Ga0495586_0144457 | 3300046535 | Bacteria | 1336 |
| 314 | Ga0495587_0057391 | 3300046536 | Bacteria | 2289 |
| 315 | Ga0495587_0070091 | 3300046536 | Bacteria | 2041 |
| 316 | Ga0495645_0051066 | 3300046543 | Bacteria | 3009 |
| 317 | Ga0495667_0862773 | 3300046559 | Unclassified | 556 |
| 318 | Ga0495635_0252741 | 3300046663 | Bacteria | 1188 |
| 319 | Ga0495635_0347245 | 3300046663 | Unclassified | 990 |
| 320 | Ga0495659_0033032 | 3300046664 | Bacteria | 1814 |
| 321 | Ga0495657_0211488 | 3300046675 | Bacteria | 1179 |
| 322 | Ga0495599_0418468 | 3300046678 | Bacteria | 796 |
| 323 | Ga0495623_0077117 | 3300046679 | Bacteria | 2067 |
| 324 | Ga0495669_0098247 | 3300046684 | Bacteria | 1358 |
| 325 | Ga0495669_0205837 | 3300046684 | Bacteria | 941 |
| 326 | Ga0495675_0071446 | 3300047444 | Unclassified | 2190 |
| 327 | Ga0495675_0192758 | 3300047444 | Bacteria | 1243 |
| 328 | Ga0495677_0095382 | 3300047445 | Unclassified | 1123 |
| 329 | Ga0495684_0530846 | 3300047471 | Bacteria | 804 |
| 330 | Ga0496100_0224143 | 3300048903 | Bacteria | 1381 |
| 331 | Ga0496102_0402018 | 3300048905 | Bacteria | 1288 |
| 332 | Ga0496106_0805220 | 3300048909 | Bacteria | 745 |
| 333 | Ga0496109_0550908 | 3300048912 | Bacteria | 1088 |
| 334 | Ga0496112_0019906 | 3300048915 | Bacteria | 6351 |
| 335 | Ga0496112_0184421 | 3300048915 | Bacteria | 2050 |
| 336 | Ga0496115_0026503 | 3300048918 | Bacteria | 4524 |
| 337 | Ga0496115_0303977 | 3300048918 | Bacteria | 1307 |
| 338 | Ga0496115_0369947 | 3300048918 | Unclassified | 1167 |
| 339 | Ga0496126_0419086 | 3300048929 | Bacteria | 1083 |
| 340 | Ga0501300_082052 | 3300049523 | Bacteria | 532 |
| 341 | Ga0501235_077888 | 3300049669 | Bacteria | 790 |
| 342 | Ga0501263_063081 | 3300049760 | Bacteria | 585 |
| 343 | nmdc:mga05p37_75476_c1 | 3300050507 | Bacteria | 4149 |
| 344 | nmdc:mga0a205_1094342_c1 | 3300050515 | Bacteria | 644 |
| 345 | Ga0495601_0295461 | 3300053077 | Bacteria | 1056 |
| 346 | Ga0587066_084460 | 3300059490 | Bacteria | 694 |
| 347 | Ga0587073_0103812 | 3300059492 | Unclassified | 743 |
| 348 | Ga0587073_0225917 | 3300059492 | Bacteria | 575 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049669 | Ga0501235_077888 | Ga0501235_077888_325_765 | 121 |
| 2 | 3300049760 | Ga0501263_063081 | Ga0501263_063081_21_461 | 122 |
| 3 | 3300013307 | Ga0157372_10029172 | Ga0157372_100291725 | 125 |
| 4 | 3300035171 | Ga0373946_0110205 | Ga0373946_0110205_468_974 | 125 |
| 5 | 3300035725 | Ga0373947_0029509 | Ga0373947_0029509_1611_2117 | 125 |
| 6 | 3300041496 | Ga0451839_0548124 | Ga0451839_0548124_203_727 | 125 |
| 7 | 3300044842 | Ga0466957_0128247 | Ga0466957_0128247_203_655 | 127 |
| 8 | 3300007265 | Ga0099794_10109840 | Ga0099794_101098402 | 131 |
| 9 | 3300032002 | Ga0307416_100298747 | Ga0307416_1002987472 | 133 |
| 10 | 3300044842 | Ga0466957_0165823 | Ga0466957_0165823_80_565 | 135 |
| 11 | 3300013307 | Ga0157372_10129867 | Ga0157372_101298673 | 138 |
| 12 | 3300045976 | Ga0466967_1895551 | Ga0466967_1895551_22_504 | 139 |
| 13 | 3300046664 | Ga0495659_0033032 | Ga0495659_0033032_817_1302 | 142 |
| 14 | 3300046684 | Ga0495669_0098247 | Ga0495669_0098247_801_1286 | 142 |
| 15 | 3300049523 | Ga0501300_082052 | Ga0501300_082052_41_520 | 142 |
| 16 | 3300059492 | Ga0587073_0225917 | Ga0587073_0225917_22_501 | 142 |
| 17 | 3300004800 | Ga0058861_10051339 | Ga0058861_100513391 | 143 |
| 18 | 3300004800 | Ga0058861_11782676 | Ga0058861_117826762 | 143 |
| 19 | 3300004803 | Ga0058862_10226840 | Ga0058862_102268401 | 143 |
| 20 | 3300004803 | Ga0058862_10254669 | Ga0058862_102546691 | 143 |
| 21 | 3300004803 | Ga0058862_12627438 | Ga0058862_126274381 | 143 |
| 22 | 3300005327 | Ga0070658_11125725 | Ga0070658_111257251 | 143 |
| 23 | 3300005328 | Ga0070676_10128807 | Ga0070676_101288072 | 143 |
| 24 | 3300005329 | Ga0070683_101144033 | Ga0070683_1011440331 | 143 |
| 25 | 3300005330 | Ga0070690_100557192 | Ga0070690_1005571921 | 143 |
| 26 | 3300005331 | Ga0070670_100016038 | Ga0070670_1000160384 | 143 |
| 27 | 3300005335 | Ga0070666_10023949 | Ga0070666_100239492 | 143 |
| 28 | 3300005335 | Ga0070666_10828979 | Ga0070666_108289791 | 143 |
| 29 | 3300005336 | Ga0070680_100140932 | Ga0070680_1001409322 | 143 |
| 30 | 3300005337 | Ga0070682_100267988 | Ga0070682_1002679881 | 143 |
| 31 | 3300005354 | Ga0070675_100072244 | Ga0070675_1000722442 | 143 |
| 32 | 3300005355 | Ga0070671_100023925 | Ga0070671_1000239252 | 143 |
| 33 | 3300005355 | Ga0070671_100709319 | Ga0070671_1007093191 | 143 |
| 34 | 3300005356 | Ga0070674_100282377 | Ga0070674_1002823772 | 143 |
| 35 | 3300005364 | Ga0070673_100184742 | Ga0070673_1001847422 | 143 |
| 36 | 3300005365 | Ga0070688_100324907 | Ga0070688_1003249072 | 143 |
| 37 | 3300005367 | Ga0070667_100074971 | Ga0070667_1000749712 | 143 |
| 38 | 3300005456 | Ga0070678_100007527 | Ga0070678_1000075275 | 143 |
| 39 | 3300005457 | Ga0070662_100003983 | Ga0070662_1000039832 | 143 |
| 40 | 3300005458 | Ga0070681_10030956 | Ga0070681_100309562 | 143 |
| 41 | 3300005530 | Ga0070679_100300160 | Ga0070679_1003001602 | 143 |
| 42 | 3300005539 | Ga0068853_100106162 | Ga0068853_1001061622 | 143 |
| 43 | 3300005543 | Ga0070672_100002005 | Ga0070672_1000020057 | 143 |
| 44 | 3300005546 | Ga0070696_101306553 | Ga0070696_1013065531 | 143 |
| 45 | 3300005548 | Ga0070665_100020643 | Ga0070665_1000206432 | 143 |
| 46 | 3300005563 | Ga0068855_100044675 | Ga0068855_1000446755 | 143 |
| 47 | 3300005563 | Ga0068855_100058062 | Ga0068855_1000580626 | 143 |
| 48 | 3300005577 | Ga0068857_100395049 | Ga0068857_1003950492 | 143 |
| 49 | 3300005614 | Ga0068856_100017420 | Ga0068856_1000174204 | 143 |
| 50 | 3300005614 | Ga0068856_101189323 | Ga0068856_1011893231 | 143 |
| 51 | 3300005616 | Ga0068852_100031489 | Ga0068852_1000314892 | 143 |
| 52 | 3300005617 | Ga0068859_100542482 | Ga0068859_1005424821 | 143 |
| 53 | 3300005618 | Ga0068864_100013695 | Ga0068864_1000136954 | 143 |
| 54 | 3300005719 | Ga0068861_100843183 | Ga0068861_1008431832 | 143 |
| 55 | 3300005840 | Ga0068870_10360148 | Ga0068870_103601481 | 143 |
| 56 | 3300005841 | Ga0068863_102526738 | Ga0068863_1025267381 | 143 |
| 57 | 3300005842 | Ga0068858_100048599 | Ga0068858_1000485992 | 143 |
| 58 | 3300005843 | Ga0068860_100056734 | Ga0068860_1000567342 | 143 |
| 59 | 3300005843 | Ga0068860_102242980 | Ga0068860_1022429801 | 143 |
| 60 | 3300006237 | Ga0097621_100059084 | Ga0097621_1000590842 | 143 |
| 61 | 3300006358 | Ga0068871_100012609 | Ga0068871_1000126092 | 143 |
| 62 | 3300006931 | Ga0097620_100542495 | Ga0097620_1005424951 | 143 |
| 63 | 3300009093 | Ga0105240_10192371 | Ga0105240_101923712 | 143 |
| 64 | 3300009093 | Ga0105240_11010787 | Ga0105240_110107871 | 143 |
| 65 | 3300009093 | Ga0105240_11631972 | Ga0105240_116319721 | 143 |
| 66 | 3300009148 | Ga0105243_10276858 | Ga0105243_102768582 | 143 |
| 67 | 3300009148 | Ga0105243_10548537 | Ga0105243_105485372 | 143 |
| 68 | 3300009174 | Ga0105241_10425449 | Ga0105241_104254491 | 143 |
| 69 | 3300009176 | Ga0105242_10152637 | Ga0105242_101526372 | 143 |
| 70 | 3300009177 | Ga0105248_10005228 | Ga0105248_100052286 | 143 |
| 71 | 3300009177 | Ga0105248_10074097 | Ga0105248_100740972 | 143 |
| 72 | 3300009545 | Ga0105237_10151542 | Ga0105237_101515422 | 143 |
| 73 | 3300009545 | Ga0105237_10296552 | Ga0105237_102965521 | 143 |
| 74 | 3300009553 | Ga0105249_10064892 | Ga0105249_100648922 | 143 |
| 75 | 3300010375 | Ga0105239_10091411 | Ga0105239_100914112 | 143 |
| 76 | 3300010375 | Ga0105239_10500861 | Ga0105239_105008611 | 143 |
| 77 | 3300011119 | Ga0105246_10011686 | Ga0105246_100116865 | 143 |
| 78 | 3300013104 | Ga0157370_10384461 | Ga0157370_103844612 | 143 |
| 79 | 3300013105 | Ga0157369_10005757 | Ga0157369_1000575713 | 143 |
| 80 | 3300013105 | Ga0157369_10065977 | Ga0157369_100659772 | 143 |
| 81 | 3300013296 | Ga0157374_10004959 | Ga0157374_100049594 | 143 |
| 82 | 3300013296 | Ga0157374_10069404 | Ga0157374_100694043 | 143 |
| 83 | 3300013296 | Ga0157374_10076710 | Ga0157374_100767101 | 143 |
| 84 | 3300013297 | Ga0157378_10099990 | Ga0157378_100999902 | 143 |
| 85 | 3300013297 | Ga0157378_10191866 | Ga0157378_101918662 | 143 |
| 86 | 3300013306 | Ga0163162_10354950 | Ga0163162_103549502 | 143 |
| 87 | 3300013306 | Ga0163162_10599876 | Ga0163162_105998762 | 143 |
| 88 | 3300013307 | Ga0157372_10945828 | Ga0157372_109458281 | 143 |
| 89 | 3300013308 | Ga0157375_10013492 | Ga0157375_100134925 | 143 |
| 90 | 3300013308 | Ga0157375_10425799 | Ga0157375_104257993 | 143 |
| 91 | 3300014325 | Ga0163163_10275117 | Ga0163163_102751172 | 143 |
| 92 | 3300014969 | Ga0157376_10203372 | Ga0157376_102033721 | 143 |
| 93 | 3300014969 | Ga0157376_10495111 | Ga0157376_104951112 | 143 |
| 94 | 3300017792 | Ga0163161_10015051 | Ga0163161_100150512 | 143 |
| 95 | 3300019161 | Ga0184602_115772 | Ga0184602_1157721 | 143 |
| 96 | 3300019166 | Ga0184595_118846 | Ga0184595_1188461 | 143 |
| 97 | 3300020069 | Ga0197907_10520732 | Ga0197907_105207321 | 143 |
| 98 | 3300020069 | Ga0197907_10581016 | Ga0197907_105810161 | 143 |
| 99 | 3300020069 | Ga0197907_10610278 | Ga0197907_106102781 | 143 |
| 100 | 3300020070 | Ga0206356_10294992 | Ga0206356_102949921 | 143 |
| 101 | 3300020070 | Ga0206356_10874967 | Ga0206356_108749671 | 143 |
| 102 | 3300020075 | Ga0206349_1187794 | Ga0206349_11877941 | 143 |
| 103 | 3300020075 | Ga0206349_1335831 | Ga0206349_13358311 | 143 |
| 104 | 3300020075 | Ga0206349_1680554 | Ga0206349_16805541 | 143 |
| 105 | 3300020075 | Ga0206349_1965047 | Ga0206349_19650471 | 143 |
| 106 | 3300020076 | Ga0206355_1147249 | Ga0206355_11472491 | 143 |
| 107 | 3300020076 | Ga0206355_1267967 | Ga0206355_12679671 | 143 |
| 108 | 3300020076 | Ga0206355_1271688 | Ga0206355_12716881 | 143 |
| 109 | 3300020076 | Ga0206355_1350699 | Ga0206355_13506991 | 143 |
| 110 | 3300020076 | Ga0206355_1385288 | Ga0206355_13852881 | 143 |
| 111 | 3300020077 | Ga0206351_10293074 | Ga0206351_102930741 | 143 |
| 112 | 3300020077 | Ga0206351_10315708 | Ga0206351_103157082 | 143 |
| 113 | 3300020077 | Ga0206351_10343963 | Ga0206351_103439631 | 143 |
| 114 | 3300020077 | Ga0206351_10604236 | Ga0206351_106042361 | 143 |
| 115 | 3300020077 | Ga0206351_10614195 | Ga0206351_106141951 | 143 |
| 116 | 3300020077 | Ga0206351_10736055 | Ga0206351_107360552 | 143 |
| 117 | 3300020077 | Ga0206351_10974413 | Ga0206351_109744131 | 143 |
| 118 | 3300020078 | Ga0206352_10726361 | Ga0206352_107263611 | 143 |
| 119 | 3300020078 | Ga0206352_11312925 | Ga0206352_113129251 | 143 |
| 120 | 3300020080 | Ga0206350_10438208 | Ga0206350_104382081 | 143 |
| 121 | 3300020080 | Ga0206350_10706527 | Ga0206350_107065271 | 143 |
| 122 | 3300020080 | Ga0206350_11166613 | Ga0206350_111666131 | 143 |
| 123 | 3300020080 | Ga0206350_11467074 | Ga0206350_114670741 | 143 |
| 124 | 3300020081 | Ga0206354_10339928 | Ga0206354_103399281 | 143 |
| 125 | 3300020081 | Ga0206354_11664707 | Ga0206354_116647071 | 143 |
| 126 | 3300020082 | Ga0206353_10280453 | Ga0206353_102804531 | 143 |
| 127 | 3300020610 | Ga0154015_1093487 | Ga0154015_10934871 | 143 |
| 128 | 3300020610 | Ga0154015_1612928 | Ga0154015_16129281 | 143 |
| 129 | 3300020610 | Ga0154015_1663793 | Ga0154015_16637931 | 143 |
| 130 | 3300020610 | Ga0154015_1707358 | Ga0154015_17073581 | 143 |
| 131 | 3300022467 | Ga0224712_10065457 | Ga0224712_100654571 | 143 |
| 132 | 3300022467 | Ga0224712_10116782 | Ga0224712_101167821 | 143 |
| 133 | 3300022467 | Ga0224712_10125430 | Ga0224712_101254302 | 143 |
| 134 | 3300022467 | Ga0224712_10143518 | Ga0224712_101435182 | 143 |
| 135 | 3300022467 | Ga0224712_10447565 | Ga0224712_104475651 | 143 |
| 136 | 3300022467 | Ga0224712_10502110 | Ga0224712_105021101 | 143 |
| 137 | 3300023561 | Ga0247518_116456 | Ga0247518_1164561 | 143 |
| 138 | 3300023672 | Ga0247553_106721 | Ga0247553_1067211 | 143 |
| 139 | 3300025315 | Ga0207697_10103637 | Ga0207697_101036371 | 143 |
| 140 | 3300025901 | Ga0207688_10203867 | Ga0207688_102038671 | 143 |
| 141 | 3300025903 | Ga0207680_10058218 | Ga0207680_100582182 | 143 |
| 142 | 3300025903 | Ga0207680_11014883 | Ga0207680_110148831 | 143 |
| 143 | 3300025904 | Ga0207647_10008351 | Ga0207647_100083512 | 143 |
| 144 | 3300025907 | Ga0207645_10048582 | Ga0207645_100485822 | 143 |
| 145 | 3300025908 | Ga0207643_10225129 | Ga0207643_102251292 | 143 |
| 146 | 3300025912 | Ga0207707_10090550 | Ga0207707_100905502 | 143 |
| 147 | 3300025921 | Ga0207652_10377305 | Ga0207652_103773051 | 143 |
| 148 | 3300025921 | Ga0207652_10550050 | Ga0207652_105500502 | 143 |
| 149 | 3300025931 | Ga0207644_10156399 | Ga0207644_101563992 | 143 |
| 150 | 3300025933 | Ga0207706_10015144 | Ga0207706_100151447 | 143 |
| 151 | 3300025934 | Ga0207686_10410567 | Ga0207686_104105671 | 143 |
| 152 | 3300025938 | Ga0207704_10192322 | Ga0207704_101923222 | 143 |
| 153 | 3300025940 | Ga0207691_10006334 | Ga0207691_100063348 | 143 |
| 154 | 3300025941 | Ga0207711_10338500 | Ga0207711_103385002 | 143 |
| 155 | 3300025941 | Ga0207711_10385802 | Ga0207711_103858022 | 143 |
| 156 | 3300025942 | Ga0207689_10008476 | Ga0207689_100084765 | 143 |
| 157 | 3300025949 | Ga0207667_10035823 | Ga0207667_100358232 | 143 |
| 158 | 3300025949 | Ga0207667_10123609 | Ga0207667_101236091 | 143 |
| 159 | 3300025960 | Ga0207651_10039620 | Ga0207651_100396202 | 143 |
| 160 | 3300025981 | Ga0207640_10116174 | Ga0207640_101161742 | 143 |
| 161 | 3300026023 | Ga0207677_10223979 | Ga0207677_102239792 | 143 |
| 162 | 3300026035 | Ga0207703_10162257 | Ga0207703_101622572 | 143 |
| 163 | 3300026088 | Ga0207641_12487934 | Ga0207641_124879341 | 143 |
| 164 | 3300026095 | Ga0207676_10939152 | Ga0207676_109391521 | 143 |
| 165 | 3300026116 | Ga0207674_10349615 | Ga0207674_103496152 | 143 |
| 166 | 3300026121 | Ga0207683_10000538 | Ga0207683_1000053825 | 143 |
| 167 | 3300028381 | Ga0268264_10169549 | Ga0268264_101695492 | 143 |
| 168 | 3300028577 | Ga0265318_10062946 | Ga0265318_100629462 | 143 |
| 169 | 3300028800 | Ga0265338_10468193 | Ga0265338_104681932 | 143 |
| 170 | 3300031241 | Ga0265325_10067469 | Ga0265325_100674692 | 143 |
| 171 | 3300031247 | Ga0265340_10280614 | Ga0265340_102806141 | 143 |
| 172 | 3300031247 | Ga0265340_10458371 | Ga0265340_104583711 | 143 |
| 173 | 3300031250 | Ga0265331_10064172 | Ga0265331_100641722 | 143 |
| 174 | 3300031344 | Ga0265316_10087078 | Ga0265316_100870783 | 143 |
| 175 | 3300031344 | Ga0265316_10375432 | Ga0265316_103754322 | 143 |
| 176 | 3300031344 | Ga0265316_11088245 | Ga0265316_110882451 | 143 |
| 177 | 3300031548 | Ga0307408_100050801 | Ga0307408_1000508011 | 143 |
| 178 | 3300031595 | Ga0265313_10040034 | Ga0265313_100400342 | 143 |
| 179 | 3300031712 | Ga0265342_10079397 | Ga0265342_100793971 | 143 |
| 180 | 3300031731 | Ga0307405_10176626 | Ga0307405_101766262 | 143 |
| 181 | 3300031995 | Ga0307409_100004178 | Ga0307409_10000417812 | 143 |
| 182 | 3300032002 | Ga0307416_100021654 | Ga0307416_1000216542 | 143 |
| 183 | 3300032004 | Ga0307414_10311076 | Ga0307414_103110761 | 143 |
| 184 | 3300032005 | Ga0307411_10016139 | Ga0307411_100161393 | 143 |
| 185 | 3300032120 | Ga0316053_113640 | Ga0316053_1136401 | 143 |
| 186 | 3300035691 | Ga0373931_0128927 | Ga0373931_0128927_439_897 | 143 |
| 187 | 3300035724 | Ga0373933_0078530 | Ga0373933_0078530_320_799 | 143 |
| 188 | 3300036401 | Ga0373937_0002292 | Ga0373937_0002292_10219_10698 | 143 |
| 189 | 3300036401 | Ga0373937_0074603 | Ga0373937_0074603_1049_1507 | 143 |
| 190 | 3300037068 | Ga0373925_0311385 | Ga0373925_0311385_598_1056 | 143 |
| 191 | 3300037471 | Ga0395905_1059072 | Ga0395905_1059072_143_640 | 143 |
| 192 | 3300039447 | Ga0436361_0206802 | Ga0436361_0206802_1414_1872 | 143 |
| 193 | 3300044673 | Ga0453683_1096870 | Ga0453683_1096870_26_487 | 143 |
| 194 | 3300046459 | Ga0495629_0013052 | Ga0495629_0013052_1037_1495 | 143 |
| 195 | 3300046517 | Ga0495630_0760493 | Ga0495630_0760493_110_568 | 143 |
| 196 | 3300046535 | Ga0495586_0144457 | Ga0495586_0144457_863_1321 | 143 |
| 197 | 3300046536 | Ga0495587_0070091 | Ga0495587_0070091_902_1360 | 143 |
| 198 | 3300046663 | Ga0495635_0252741 | Ga0495635_0252741_220_678 | 143 |
| 199 | 3300046678 | Ga0495599_0418468 | Ga0495599_0418468_200_658 | 143 |
| 200 | 3300047471 | Ga0495684_0530846 | Ga0495684_0530846_74_532 | 143 |
| 201 | 3300048903 | Ga0496100_0224143 | Ga0496100_0224143_543_1001 | 143 |
| 202 | 3300048905 | Ga0496102_0402018 | Ga0496102_0402018_254_712 | 143 |
| 203 | 3300048909 | Ga0496106_0805220 | Ga0496106_0805220_215_673 | 143 |
| 204 | 3300048912 | Ga0496109_0550908 | Ga0496109_0550908_268_726 | 143 |
| 205 | 3300048918 | Ga0496115_0026503 | Ga0496115_0026503_1838_2296 | 143 |
| 206 | 3300048918 | Ga0496115_0303977 | Ga0496115_0303977_516_968 | 143 |
| 207 | 3300053077 | Ga0495601_0295461 | Ga0495601_0295461_84_542 | 143 |
| 208 | 3300005331 | Ga0070670_100189125 | Ga0070670_1001891252 | 144 |
| 209 | 3300005339 | Ga0070660_100207978 | Ga0070660_1002079782 | 144 |
| 210 | 3300005367 | Ga0070667_100389949 | Ga0070667_1003899491 | 144 |
| 211 | 3300005436 | Ga0070713_101264258 | Ga0070713_1012642581 | 144 |
| 212 | 3300005535 | Ga0070684_100068201 | Ga0070684_1000682012 | 144 |
| 213 | 3300005536 | Ga0070697_100012826 | Ga0070697_1000128262 | 144 |
| 214 | 3300005546 | Ga0070696_100071040 | Ga0070696_1000710403 | 144 |
| 215 | 3300005549 | Ga0070704_100957761 | Ga0070704_1009577611 | 144 |
| 216 | 3300005563 | Ga0068855_101490991 | Ga0068855_1014909911 | 144 |
| 217 | 3300005577 | Ga0068857_100013228 | Ga0068857_1000132284 | 144 |
| 218 | 3300005618 | Ga0068864_100402680 | Ga0068864_1004026801 | 144 |
| 219 | 3300005841 | Ga0068863_100318871 | Ga0068863_1003188712 | 144 |
| 220 | 3300006173 | Ga0070716_100490541 | Ga0070716_1004905412 | 144 |
| 221 | 3300009093 | Ga0105240_10137392 | Ga0105240_101373922 | 144 |
| 222 | 3300009147 | Ga0114129_10012875 | Ga0114129_100128758 | 144 |
| 223 | 3300009177 | Ga0105248_10067100 | Ga0105248_100671006 | 144 |
| 224 | 3300009551 | Ga0105238_10447587 | Ga0105238_104475871 | 144 |
| 225 | 3300010375 | Ga0105239_10203382 | Ga0105239_102033822 | 144 |
| 226 | 3300013104 | Ga0157370_10418603 | Ga0157370_104186031 | 144 |
| 227 | 3300013105 | Ga0157369_10339892 | Ga0157369_103398922 | 144 |
| 228 | 3300013105 | Ga0157369_11216694 | Ga0157369_112166941 | 144 |
| 229 | 3300013296 | Ga0157374_10050205 | Ga0157374_100502056 | 144 |
| 230 | 3300013306 | Ga0163162_11747767 | Ga0163162_117477671 | 144 |
| 231 | 3300014325 | Ga0163163_10003373 | Ga0163163_100033735 | 144 |
| 232 | 3300020069 | Ga0197907_10845772 | Ga0197907_108457721 | 144 |
| 233 | 3300020077 | Ga0206351_10374921 | Ga0206351_103749211 | 144 |
| 234 | 3300020078 | Ga0206352_10572176 | Ga0206352_105721761 | 144 |
| 235 | 3300020080 | Ga0206350_10232606 | Ga0206350_102326061 | 144 |
| 236 | 3300020610 | Ga0154015_1676406 | Ga0154015_16764061 | 144 |
| 237 | 3300021377 | Ga0213874_10046026 | Ga0213874_100460262 | 144 |
| 238 | 3300022467 | Ga0224712_10182879 | Ga0224712_101828793 | 144 |
| 239 | 3300025939 | Ga0207665_10227457 | Ga0207665_102274571 | 144 |
| 240 | 3300025944 | Ga0207661_10063824 | Ga0207661_100638242 | 144 |
| 241 | 3300025949 | Ga0207667_10228700 | Ga0207667_102287002 | 144 |
| 242 | 3300026078 | Ga0207702_10482638 | Ga0207702_104826382 | 144 |
| 243 | 3300026116 | Ga0207674_10018350 | Ga0207674_100183506 | 144 |
| 244 | 3300030880 | Ga0265776_107616 | Ga0265776_1076161 | 144 |
| 245 | 3300031235 | Ga0265330_10000373 | Ga0265330_1000037331 | 144 |
| 246 | 3300031241 | Ga0265325_10000560 | Ga0265325_100005602 | 144 |
| 247 | 3300031241 | Ga0265325_10068416 | Ga0265325_100684161 | 144 |
| 248 | 3300031247 | Ga0265340_10150428 | Ga0265340_101504281 | 144 |
| 249 | 3300031249 | Ga0265339_10000899 | Ga0265339_1000089916 | 144 |
| 250 | 3300031344 | Ga0265316_10000692 | Ga0265316_100006923 | 144 |
| 251 | 3300031595 | Ga0265313_10001674 | Ga0265313_100016749 | 144 |
| 252 | 3300031712 | Ga0265342_10000395 | Ga0265342_100003956 | 144 |
| 253 | 3300036457 | Ga0265778_041771 | Ga0265778_041771_47_496 | 144 |
| 254 | 3300037418 | Ga0395900_0367144 | Ga0395900_0367144_856_1314 | 144 |
| 255 | 3300037466 | Ga0395898_0030782 | Ga0395898_0030782_4825_5283 | 144 |
| 256 | 3300037471 | Ga0395905_0960617 | Ga0395905_0960617_57_557 | 144 |
| 257 | 3300037471 | Ga0395905_0967486 | Ga0395905_0967486_165_665 | 144 |
| 258 | 3300037471 | Ga0395905_1162044 | Ga0395905_1162044_133_633 | 144 |
| 259 | 3300037471 | Ga0395905_1735033 | Ga0395905_1735033_41_508 | 144 |
| 260 | 3300038443 | Ga0395901_0255289 | Ga0395901_0255289_1177_1677 | 144 |
| 261 | 3300039450 | Ga0436363_1536646 | Ga0436363_1536646_3810_4301 | 144 |
| 262 | 3300039453 | Ga0436362_0438158 | Ga0436362_0438158_56_556 | 144 |
| 263 | 3300042876 | Ga0451577_0000325 | Ga0451577_0000325_39706_40209 | 144 |
| 264 | 3300042876 | Ga0451577_0354053 | Ga0451577_0354053_142_624 | 144 |
| 265 | 3300044673 | Ga0453683_0123730 | Ga0453683_0123730_163_666 | 144 |
| 266 | 3300044712 | Ga0453684_0000429 | Ga0453684_0000429_140319_140822 | 144 |
| 267 | 3300044842 | Ga0466957_0681116 | Ga0466957_0681116_129_617 | 144 |
| 268 | 3300045051 | Ga0451576_0001898 | Ga0451576_0001898_5207_5710 | 144 |
| 269 | 3300046684 | Ga0495669_0205837 | Ga0495669_0205837_139_606 | 144 |
| 270 | 3300048915 | Ga0496112_0184421 | Ga0496112_0184421_1520_2008 | 144 |
| 271 | 3300048918 | Ga0496115_0369947 | Ga0496115_0369947_23_481 | 144 |
| 272 | 3300050507 | nmdc:mga05p37_75476_c1 | nmdc:mga05p37_75476_c1_2516_2998 | 144 |
| 273 | 3300004799 | Ga0058863_10086594 | Ga0058863_100865942 | 145 |
| 274 | 3300004800 | Ga0058861_10077517 | Ga0058861_100775172 | 145 |
| 275 | 3300005336 | Ga0070680_100084424 | Ga0070680_1000844243 | 145 |
| 276 | 3300005336 | Ga0070680_100267067 | Ga0070680_1002670672 | 145 |
| 277 | 3300005337 | Ga0070682_100628947 | Ga0070682_1006289472 | 145 |
| 278 | 3300005434 | Ga0070709_10063625 | Ga0070709_100636252 | 145 |
| 279 | 3300005436 | Ga0070713_100049683 | Ga0070713_1000496834 | 145 |
| 280 | 3300005458 | Ga0070681_11034360 | Ga0070681_110343601 | 145 |
| 281 | 3300005458 | Ga0070681_11141222 | Ga0070681_111412221 | 145 |
| 282 | 3300005530 | Ga0070679_100601875 | Ga0070679_1006018751 | 145 |
| 283 | 3300005530 | Ga0070679_101084272 | Ga0070679_1010842721 | 145 |
| 284 | 3300005548 | Ga0070665_100049205 | Ga0070665_1000492053 | 145 |
| 285 | 3300005548 | Ga0070665_100114970 | Ga0070665_1001149702 | 145 |
| 286 | 3300005548 | Ga0070665_100693015 | Ga0070665_1006930151 | 145 |
| 287 | 3300005563 | Ga0068855_100438610 | Ga0068855_1004386101 | 145 |
| 288 | 3300005614 | Ga0068856_101065512 | Ga0068856_1010655121 | 145 |
| 289 | 3300006028 | Ga0070717_10168127 | Ga0070717_101681271 | 145 |
| 290 | 3300006028 | Ga0070717_10542988 | Ga0070717_105429882 | 145 |
| 291 | 3300013105 | Ga0157369_10110906 | Ga0157369_101109062 | 145 |
| 292 | 3300013306 | Ga0163162_11264993 | Ga0163162_112649931 | 145 |
| 293 | 3300013307 | Ga0157372_10978858 | Ga0157372_109788581 | 145 |
| 294 | 3300020075 | Ga0206349_1362241 | Ga0206349_13622411 | 145 |
| 295 | 3300020077 | Ga0206351_10245823 | Ga0206351_102458231 | 145 |
| 296 | 3300020077 | Ga0206351_10561193 | Ga0206351_105611931 | 145 |
| 297 | 3300020077 | Ga0206351_10918230 | Ga0206351_109182301 | 145 |
| 298 | 3300020078 | Ga0206352_10019431 | Ga0206352_100194311 | 145 |
| 299 | 3300020078 | Ga0206352_10832553 | Ga0206352_108325531 | 145 |
| 300 | 3300020078 | Ga0206352_11334485 | Ga0206352_113344851 | 145 |
| 301 | 3300020080 | Ga0206350_10199177 | Ga0206350_101991771 | 145 |
| 302 | 3300020082 | Ga0206353_10894400 | Ga0206353_108944001 | 145 |
| 303 | 3300021377 | Ga0213874_10072283 | Ga0213874_100722832 | 145 |
| 304 | 3300022467 | Ga0224712_10039891 | Ga0224712_100398912 | 145 |
| 305 | 3300023672 | Ga0247553_106660 | Ga0247553_1066601 | 145 |
| 306 | 3300025911 | Ga0207654_10599372 | Ga0207654_105993722 | 145 |
| 307 | 3300025912 | Ga0207707_10960317 | Ga0207707_109603172 | 145 |
| 308 | 3300025913 | Ga0207695_10852549 | Ga0207695_108525492 | 145 |
| 309 | 3300025917 | Ga0207660_10110271 | Ga0207660_101102712 | 145 |
| 310 | 3300025921 | Ga0207652_11198133 | Ga0207652_111981331 | 145 |
| 311 | 3300025928 | Ga0207700_10147515 | Ga0207700_101475152 | 145 |
| 312 | 3300025939 | Ga0207665_10134120 | Ga0207665_101341202 | 145 |
| 313 | 3300025939 | Ga0207665_10723152 | Ga0207665_107231521 | 145 |
| 314 | 3300025949 | Ga0207667_10431833 | Ga0207667_104318332 | 145 |
| 315 | 3300025949 | Ga0207667_11414950 | Ga0207667_114149502 | 145 |
| 316 | 3300028379 | Ga0268266_10294418 | Ga0268266_102944181 | 145 |
| 317 | 3300028379 | Ga0268266_11338648 | Ga0268266_113386481 | 145 |
| 318 | 3300037471 | Ga0395905_0036893 | Ga0395905_0036893_1967_2473 | 145 |
| 319 | 3300037471 | Ga0395905_0072198 | Ga0395905_0072198_2635_3117 | 145 |
| 320 | 3300037471 | Ga0395905_0087258 | Ga0395905_0087258_700_1173 | 145 |
| 321 | 3300038443 | Ga0395901_0588965 | Ga0395901_0588965_527_1009 | 145 |
| 322 | 3300038443 | Ga0395901_0958336 | Ga0395901_0958336_63_536 | 145 |
| 323 | 3300039437 | Ga0436365_0167286 | Ga0436365_0167286_329_835 | 145 |
| 324 | 3300039450 | Ga0436363_1572531 | Ga0436363_1572531_2618_3124 | 145 |
| 325 | 3300045976 | Ga0466967_0271241 | Ga0466967_0271241_855_1406 | 145 |
| 326 | 3300046477 | Ga0495664_0016858 | Ga0495664_0016858_2513_3052 | 145 |
| 327 | 3300046536 | Ga0495587_0057391 | Ga0495587_0057391_705_1244 | 145 |
| 328 | 3300046543 | Ga0495645_0051066 | Ga0495645_0051066_2059_2598 | 145 |
| 329 | 3300046559 | Ga0495667_0862773 | Ga0495667_0862773_52_525 | 145 |
| 330 | 3300046663 | Ga0495635_0347245 | Ga0495635_0347245_424_897 | 145 |
| 331 | 3300046675 | Ga0495657_0211488 | Ga0495657_0211488_383_922 | 145 |
| 332 | 3300046679 | Ga0495623_0077117 | Ga0495623_0077117_541_1080 | 145 |
| 333 | 3300047444 | Ga0495675_0071446 | Ga0495675_0071446_1098_1637 | 145 |
| 334 | 3300047444 | Ga0495675_0192758 | Ga0495675_0192758_79_618 | 145 |
| 335 | 3300047445 | Ga0495677_0095382 | Ga0495677_0095382_105_578 | 145 |
| 336 | 3300048915 | Ga0496112_0019906 | Ga0496112_0019906_5139_5645 | 145 |
| 337 | 3300059490 | Ga0587066_084460 | Ga0587066_084460_67_531 | 145 |
| 338 | 3300059492 | Ga0587073_0103812 | Ga0587073_0103812_124_588 | 145 |
| 339 | 3300003323 | rootH1_10383157 | rootH1_103831571 | 146 |
| 340 | 3300005547 | Ga0070693_100027985 | Ga0070693_1000279852 | 146 |
| 341 | 3300005616 | Ga0068852_100406278 | Ga0068852_1004062782 | 146 |
| 342 | 3300005834 | Ga0068851_10634232 | Ga0068851_106342321 | 146 |
| 343 | 3300020077 | Ga0206351_10037011 | Ga0206351_100370111 | 146 |
| 344 | 3300020078 | Ga0206352_10567405 | Ga0206352_105674051 | 146 |
| 345 | 3300026142 | Ga0207698_10235273 | Ga0207698_102352732 | 146 |
| 346 | 3300039453 | Ga0436362_0674302 | Ga0436362_0674302_513_998 | 146 |
| 347 | 3300048929 | Ga0496126_0419086 | Ga0496126_0419086_106_585 | 146 |
| 348 | 3300050515 | nmdc:mga0a205_1094342_c1 | nmdc:mga0a205_1094342_c1_65_562 | 146 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5ds2-assembly2.cif.gz_D | core domain of the class i small heat-shock protein hsp 18.1 from pisum sativum | 0.8657 | 42 | 134 |
| 5ds2-assembly2.cif.gz_D | core domain of the class i small heat-shock protein hsp 18.1 from pisum sativum | 0.8484 | 42 | 134 |
| 2h50-assembly1.cif.gz_P | multiple distinct assemblies reveal conformational flexibility in the small heat shock protein hsp26 | 0.8447 | 44 | 134 |
| 2jki-assembly3.cif.gz_U | complex of hsp90 n-terminal and sgt1 cs domain | 0.8395 | 42 | 134 |
| 7l7i-assembly1.cif.gz_E | cryo-em structure of hsp90:fkbp51:p23 closed-state complex | 0.8282 | 39 | 134 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9D9A7_3_126_2.60.40.790 | Mainly Beta;Sandwich;Immunoglobulin-like; | 0.8698 | 43 | 134 | 2.60.40.790 |
| 5ds2D00 | Mainly Beta;Sandwich;Immunoglobulin-like; | 0.8657 | 42 | 134 | 2.60.40.790 |
| af_A0A144A1J3_25_143_2.60.40.790 | Mainly Beta;Sandwich;Immunoglobulin-like; | 0.8584 | 41 | 134 | 2.60.40.790 |
| af_Q8S1F2_1_96_2.60.40.790 | Mainly Beta;Sandwich;Immunoglobulin-like; | 0.8521 | 30 | 138 | 2.60.40.790 |
| af_A0A1D6GL72_7_81_2.60.40.790 | Mainly Beta;Sandwich;Immunoglobulin-like; | 0.8517 | 62 | 138 | 2.60.40.790 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2D4Z8W5-F1-model_v4 | deleted | 0.85 | 41 | 146 |
|
| AF-A0A1G0K3F4-F1-model_v4 | Heat-shock protein Hsp20 | 0.8361 | 38 | 146 |
|
| AF-A0A1G0K3F4-F1-model_v4 | Heat-shock protein Hsp20 | 0.822 | 38 | 146 |
|
| AF-A0A3M1CST7-F1-model_v4 | Hsp20/alpha crystallin family protein | 0.8213 | 41 | 146 |
|
| AF-A0A350I0T8-F1-model_v4 | Heat-shock protein Hsp20 | 0.8187 | 31 | 146 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar