F417504

General Info

Members Datasets Scaffolds Average Seq Length
348 201 696 319

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10011910|Ga0105240_100119102
Length 344
Sequence MIRFIVKSGSQSSSRRKEMITGKVTTLSGLAAAALFALSSLPAPAAAQQKFVTIGTGGVTGVYYAVGGAVCRLMNKDRAKTGIRCSVESTGGSVFNANAIGTGEQEFGLAQSDVQFNAAKGEAQFKGKAIADLRAVFSVHPEPFTVLARKEANIAKFEDFKGKRFNIGNPGSGTLASMEELLKQMGWTRADFSLAAELKADEQGTALCDNKIDGFFYGVGHPSAAIQDPTTACGAKLVPLTGSAVDALVAAHPYYAKVAIPGGMYANNPNPTPTYGVLATMMTSAKVPDQVVYDLAKAVFENFDEFKKLHPAFANLDPRHMVKDGLSAPLHPGAIKYYKEKGWM

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
28 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
29 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
30 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
31 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
44 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
50 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
51 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
78 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
80 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
81 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
82 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
83 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
84 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
85 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
86 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
87 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
88 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
89 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
90 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
91 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
92 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
93 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
94 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
95 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
96 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
97 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
98 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
99 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
100 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
101 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
102 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
103 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
104 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
105 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
106 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
107 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
108 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
109 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
110 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
112 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
113 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
114 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
115 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
116 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
117 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
118 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
119 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
120 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
121 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
122 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
123 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
124 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
125 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
126 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
127 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
128 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
129 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
130 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
131 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
132 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
133 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
134 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
135 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
136 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
137 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
138 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
139 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
140 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
141 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
142 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
143 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
144 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
145 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
146 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
147 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
148 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
162 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
163 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
164 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
165 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
166 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
167 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
168 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
169 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
170 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
171 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
172 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
173 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
174 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
175 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
178 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
179 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
180 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
181 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
182 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
183 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
184 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
185 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
186 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
187 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
188 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
189 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
190 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
191 2643221621 Achromobacter sp. Root83 Isolate Unclassified
192 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
193 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
194 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
195 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
196 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
197 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
198 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
199 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
200 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
201 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.11
Metatranscriptomes 0.57
Isolates 4.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.74
Nodule 2.3
Rhizoplane 0.29
Rhizosphere 91.38
Stem 0
Stem Tuber 0
Unclassified 0.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10011910 3300009093 Bacteria 12062
2 LJQas_1002447 3300000549 Bacteria 2580
3 Ga0070658_10021237 3300005327 Bacteria 5201
4 Ga0070658_10028900 3300005327 Bacteria 4451
5 Ga0070683_100018847 3300005329 Bacteria 6123
6 Ga0070680_100022626 3300005336 Bacteria 5008
7 Ga0070680_100028568 3300005336 Bacteria 4474
8 Ga0070680_100029149 3300005336 Bacteria 4433
9 Ga0070680_100120490 3300005336 Bacteria 2190
10 Ga0070660_100014784 3300005339 Bacteria 5631
11 Ga0070691_10117164 3300005341 Bacteria 1338
12 Ga0070661_100064974 3300005344 Bacteria 2681
13 Ga0070675_100155745 3300005354 Bacteria 1962
14 Ga0070688_100212628 3300005365 Bacteria 1359
15 Ga0070659_100118746 3300005366 Bacteria 2140
16 Ga0070659_100206012 3300005366 Bacteria 1620
17 Ga0070659_100387109 3300005366 Bacteria 1178
18 Ga0070714_100083261 3300005435 Bacteria 2789
19 Ga0070662_100053447 3300005457 Bacteria 2924
20 Ga0070681_10003118 3300005458 Bacteria 15399
21 Ga0070681_10084259 3300005458 Bacteria 3131
22 Ga0070681_10210676 3300005458 Bacteria 1860
23 Ga0070699_100156603 3300005518 Bacteria 2016
24 Ga0070679_100002575 3300005530 Bacteria 16471
25 Ga0070679_100044649 3300005530 Bacteria 4415
26 Ga0070679_100056561 3300005530 Bacteria 3908
27 Ga0070679_100107224 3300005530 Bacteria 2779
28 Ga0070684_100060818 3300005535 Bacteria 3304
29 Ga0070684_100285110 3300005535 Bacteria 1514
30 Ga0068853_100002117 3300005539 Bacteria 14743
31 Ga0068853_100008111 3300005539 Bacteria 8430
32 Ga0070693_100006849 3300005547 Bacteria 5540
33 Ga0070693_100008954 3300005547 Bacteria 4966
34 Ga0068855_100011862 3300005563 Bacteria 10537
35 Ga0068855_100014231 3300005563 Bacteria 9583
36 Ga0068855_100025923 3300005563 Bacteria 7013
37 Ga0068855_100054267 3300005563 Bacteria 4710
38 Ga0068855_100435572 3300005563 Bacteria 1432
39 Ga0070664_100105162 3300005564 Bacteria 2458
40 Ga0068857_100035960 3300005577 Bacteria 4388
41 Ga0068854_100001452 3300005578 Bacteria 14343
42 Ga0068854_100021820 3300005578 Bacteria 4352
43 Ga0068856_100000024 3300005614 Bacteria 141222
44 Ga0068856_100065386 3300005614 Bacteria 3594
45 Ga0068856_100152949 3300005614 Bacteria 2316
46 Ga0068852_100030159 3300005616 Bacteria 4461
47 Ga0068862_100024817 3300005844 Bacteria 5030
48 Ga0081538_10008504 3300005981 Bacteria 8697
49 Ga0081540_1004828 3300005983 Bacteria 10156
50 Ga0075365_10002483 3300006038 Bacteria 9065
51 Ga0075368_10032606 3300006042 Bacteria 2024
52 Ga0075363_100010017 3300006048 Bacteria 4479
53 Ga0075363_100084100 3300006048 Bacteria 1744
54 Ga0075363_100155731 3300006048 Bacteria 1292
55 Ga0075364_10016046 3300006051 Bacteria 4654
56 Ga0070712_100168147 3300006175 Bacteria 1699
57 Ga0075367_10012833 3300006178 Bacteria 4486
58 Ga0075429_100439520 3300006880 Bacteria 1143
59 Ga0099794_10029464 3300007265 Bacteria 2558
60 Ga0105240_10006964 3300009093 Bacteria 16514
61 Ga0105240_10055924 3300009093 Bacteria 4939
62 Ga0111539_10041364 3300009094 Bacteria 5541
63 Ga0105241_10005667 3300009174 Bacteria 9214
64 Ga0105248_10251083 3300009177 Bacteria 1991
65 Ga0105237_10007023 3300009545 Bacteria 12400
66 Ga0105238_10036027 3300009551 Bacteria 5029
67 Ga0105238_10104833 3300009551 Bacteria 2809
68 Ga0105239_10030920 3300010375 Bacteria 5890
69 Ga0157373_10009307 3300013100 Bacteria 7263
70 Ga0157371_10052607 3300013102 Bacteria 2892
71 Ga0157370_10018194 3300013104 Bacteria 7072
72 Ga0157370_10024107 3300013104 Bacteria 6031
73 Ga0157378_10081569 3300013297 Bacteria 2923
74 Ga0157372_10029953 3300013307 Bacteria 5948
75 Ga0206353_10197760 3300020082 Bacteria 3626
76 Ga0213876_10009783 3300021384 Bacteria 5160
77 Ga0209233_1006798 3300025261 Bacteria 3660
78 Ga0207656_10005116 3300025321 Bacteria 4612
79 Ga0207705_10009596 3300025909 Bacteria 7039
80 Ga0207705_10019884 3300025909 Bacteria 4803
81 Ga0207705_10159452 3300025909 Bacteria 1694
82 Ga0207654_10170687 3300025911 Bacteria 1412
83 Ga0207707_10007720 3300025912 Bacteria 9366
84 Ga0207707_10014256 3300025912 Bacteria 6925
85 Ga0207707_10020876 3300025912 Bacteria 5720
86 Ga0207707_10021242 3300025912 Bacteria 5674
87 Ga0207695_10017211 3300025913 Bacteria 8421
88 Ga0207695_10036471 3300025913 Bacteria 5315
89 Ga0207671_10009486 3300025914 Bacteria 8129
90 Ga0207693_10228140 3300025915 Bacteria 1462
91 Ga0207660_10008544 3300025917 Bacteria 6626
92 Ga0207660_10014572 3300025917 Bacteria 5173
93 Ga0207662_10136652 3300025918 Bacteria 1550
94 Ga0207657_10004221 3300025919 Bacteria 15223
95 Ga0207657_10048498 3300025919 Bacteria 3708
96 Ga0207657_10073689 3300025919 Bacteria 2884
97 Ga0207649_10047380 3300025920 Bacteria 2645
98 Ga0207652_10012192 3300025921 Bacteria 6946
99 Ga0207652_10050909 3300025921 Bacteria 3549
100 Ga0207652_10078341 3300025921 Bacteria 2885
101 Ga0207652_10263026 3300025921 Bacteria 1556
102 Ga0207681_10066960 3300025923 Bacteria 2488
103 Ga0207650_10169706 3300025925 Bacteria 1733
104 Ga0207690_10043068 3300025932 Bacteria 2969
105 Ga0207706_10004852 3300025933 Bacteria 12593
106 Ga0207670_10336819 3300025936 Bacteria 1191
107 Ga0207661_10046153 3300025944 Bacteria 3454
108 Ga0207667_10012359 3300025949 Bacteria 9845
109 Ga0207667_10027075 3300025949 Bacteria 6251
110 Ga0207667_10075289 3300025949 Bacteria 3505
111 Ga0207667_10080429 3300025949 Bacteria 3376
112 Ga0207640_10019304 3300025981 Bacteria 4025
113 Ga0207640_10025784 3300025981 Bacteria 3563
114 Ga0207640_10092314 3300025981 Bacteria 2100
115 Ga0207639_10016950 3300026041 Bacteria 5162
116 Ga0207639_10038051 3300026041 Bacteria 3576
117 Ga0207639_10177175 3300026041 Bacteria 1811
118 Ga0207678_10135901 3300026067 Bacteria 2098
119 Ga0207702_10000805 3300026078 Bacteria 33235
120 Ga0207702_10319148 3300026078 Bacteria 1479
121 Ga0207674_10012738 3300026116 Bacteria 9394
122 Ga0207674_10155708 3300026116 Bacteria 2240
123 Ga0207698_10034006 3300026142 Bacteria 3711
124 Ga0207698_10592257 3300026142 Bacteria 1092
125 Ga0209970_1003456 3300027614 Bacteria 2655
126 Ga0207428_10142246 3300027907 Bacteria 1830
127 Ga0268265_10013916 3300028380 Bacteria 5477
128 Ga0268265_10314179 3300028380 Bacteria 1416
129 Ga0307513_10000012 3300031456 Bacteria 328865
130 Ga0307408_100058669 3300031548 Bacteria 2799
131 Ga0265313_10000087 3300031595 Bacteria 91132
132 Ga0265313_10013513 3300031595 Bacteria 4895
133 Ga0265342_10000131 3300031712 Bacteria 82968
134 Ga0316576_10001596 3300031727 Bacteria 12358
135 Ga0307405_10002425 3300031731 Bacteria 8213
136 Ga0307410_10006859 3300031852 Bacteria 6185
137 Ga0307406_10005349 3300031901 Bacteria 7026
138 Ga0307407_10004490 3300031903 Bacteria 5936
139 Ga0307409_100002503 3300031995 Bacteria 9626
140 Ga0307416_100009639 3300032002 Bacteria 6334
141 Ga0307411_10084155 3300032005 Bacteria 2199
142 Ga0307411_10272350 3300032005 Bacteria 1343
143 Ga0307415_100003499 3300032126 Bacteria 8004
144 Ga0316593_10032136 3300032168 Bacteria 1713
145 Ga0373926_0006331 3300035083 Bacteria 3930
146 Ga0373934_0001465 3300035086 Bacteria 8638
147 Ga0373936_0045393 3300035113 Bacteria 1770
148 Ga0373941_0001564 3300035115 Bacteria 4858
149 Ga0373945_0011709 3300035116 Bacteria 2904
150 Ga0373953_0003693 3300035117 Bacteria 4805
151 Ga0373954_0000827 3300035118 Bacteria 11995
152 Ga0373954_0123131 3300035118 Bacteria 1260
153 Ga0373957_0010743 3300035120 Bacteria 3035
154 Ga0373943_0000498 3300035170 Bacteria 16777
155 Ga0373955_0002043 3300035172 Bacteria 8678
156 Ga0373955_0020483 3300035172 Bacteria 3326
157 Ga0373924_0002332 3300035410 Bacteria 6372
158 Ga0373935_0010062 3300035692 Bacteria 5666
159 Ga0373927_0002012 3300035695 Bacteria 14988
160 Ga0373933_0008625 3300035724 Bacteria 5559
161 Ga0373947_0002414 3300035725 Bacteria 11276
162 Ga0373937_0014183 3300036401 Bacteria 7030
163 Ga0316582_0137353 3300036647 Unclassified 1646
164 Ga0373925_0028167 3300037068 Bacteria 4116
165 Ga0395899_0098695 3300037312 Bacteria 2110
166 Ga0395899_0220105 3300037312 Bacteria 1315
167 Ga0395900_0031735 3300037418 Bacteria 5430
168 Ga0395900_0089134 3300037418 Bacteria 3171
169 Ga0395900_0245254 3300037418 Bacteria 1795
170 Ga0395898_0178666 3300037466 Bacteria 2028
171 Ga0316581_0069833 3300037588 Unclassified 1079
172 Ga0395901_0100712 3300038443 Bacteria 3031
173 Ga0395901_0496844 3300038443 Bacteria 1242
174 Ga0400487_58139 3300039110 Bacteria 4932
175 Ga0436365_1849927 3300039437 Bacteria 23122
176 Ga0439448_0023556 3300042005 Bacteria 1922
177 Ga0451577_0141711 3300042876 Bacteria 2160
178 Ga0453684_0024323 3300044712 Bacteria 8859
179 Ga0495629_0000804 3300046459 Bacteria 25437
180 Ga0495629_0076097 3300046459 Bacteria 2344
181 Ga0495651_0120569 3300046462 Bacteria 1927
182 Ga0495653_0005997 3300046463 Bacteria 9949
183 Ga0495662_0015620 3300046476 Bacteria 3684
184 Ga0495608_0006206 3300046511 Bacteria 8483
185 Ga0495628_0026632 3300046516 Bacteria 4710
186 Ga0495630_0047031 3300046517 Bacteria 3226
187 Ga0495665_0034600 3300046531 Bacteria 2701
188 Ga0495640_0002381 3300046533 Bacteria 15097
189 Ga0495645_0008789 3300046543 Bacteria 7054
190 Ga0495634_0005998 3300046642 Bacteria 9277
191 Ga0495634_0110442 3300046642 Bacteria 1768
192 Ga0495635_0006293 3300046663 Bacteria 8269
193 Ga0495657_0033361 3300046675 Bacteria 3584
194 Ga0495599_0005174 3300046678 Bacteria 7777
195 Ga0495623_0143097 3300046679 Bacteria 1420
196 Ga0495646_0019943 3300046680 Bacteria 4239
197 Ga0495658_0162174 3300046683 Bacteria 1379
198 Ga0495600_0015912 3300046809 Bacteria 4765
199 Ga0495600_0177706 3300046809 Bacteria 1372
200 Ga0495581_0005378 3300047315 Bacteria 7410
201 Ga0495604_0191553 3300047317 Bacteria 1424
202 Ga0495674_0012736 3300047319 Bacteria 7923
203 Ga0495674_0035147 3300047319 Bacteria 4524
204 Ga0495676_0071239 3300047321 Bacteria 2673
205 Ga0495675_0012432 3300047444 Bacteria 5358
206 Ga0495684_0001622 3300047471 Bacteria 18046
207 Ga0495684_0003719 3300047471 Bacteria 11894
208 Ga0495593_0003006 3300047673 Bacteria 10163
209 Ga0495593_0036345 3300047673 Bacteria 2671
210 Ga0495602_0040840 3300048088 Bacteria 4245
211 Ga0496114_0072544 3300048917 Bacteria 2896
212 Ga0501031_0103129 3300049568 Bacteria 1861
213 Ga0501031_0119679 3300049568 Bacteria 1720
214 Ga0501031_0226938 3300049568 Bacteria 1216
215 Ga0501032_0016333 3300049569 Bacteria 5223
216 Ga0501032_0017695 3300049569 Bacteria 5002
217 Ga0501032_0067917 3300049569 Bacteria 2380
218 Ga0501033_0001736 3300049570 Bacteria 19056
219 Ga0501033_0114275 3300049570 Bacteria 1962
220 Ga0501034_0000179 3300049571 Bacteria 118832
221 Ga0501034_0009186 3300049571 Bacteria 10371
222 Ga0501034_0009628 3300049571 Bacteria 10107
223 Ga0501034_0015149 3300049571 Bacteria 7924
224 Ga0501034_0088129 3300049571 Bacteria 3102
225 Ga0501034_0210054 3300049571 Bacteria 1902
226 Ga0501034_0356450 3300049571 Bacteria 1390
227 Ga0501036_0001210 3300049572 Bacteria 19714
228 Ga0501036_0002364 3300049572 Bacteria 14751
229 Ga0501036_0004131 3300049572 Bacteria 11683
230 Ga0501036_0012136 3300049572 Bacteria 7139
231 Ga0501036_0012446 3300049572 Bacteria 7050
232 Ga0501037_0003424 3300049573 Bacteria 11527
233 Ga0501037_0007192 3300049573 Bacteria 8132
234 Ga0501037_0022670 3300049573 Bacteria 4642
235 Ga0501038_0001455 3300049574 Bacteria 21766
236 Ga0501038_0004755 3300049574 Bacteria 12624
237 Ga0501038_0009593 3300049574 Bacteria 8880
238 Ga0501039_0005161 3300049575 Bacteria 9897
239 Ga0501039_0008624 3300049575 Bacteria 7770
240 Ga0501039_0030048 3300049575 Bacteria 4187
241 Ga0501039_0184700 3300049575 Bacteria 1639
242 Ga0501042_0031595 3300049578 Bacteria 3746
243 Ga0501043_0001468 3300049579 Bacteria 20618
244 Ga0501043_0004234 3300049579 Bacteria 11697
245 Ga0501043_0034549 3300049579 Bacteria 3976
246 Ga0501046_0010801 3300049580 Bacteria 7827
247 Ga0501046_0013077 3300049580 Bacteria 7045
248 Ga0501046_0048993 3300049580 Bacteria 3344
249 Ga0501047_0000179 3300049581 Bacteria 77520
250 Ga0501047_0004650 3300049581 Bacteria 12913
251 Ga0501047_0085972 3300049581 Bacteria 3021
252 Ga0501047_0255541 3300049581 Bacteria 1600
253 Ga0501048_0000818 3300049582 Bacteria 22920
254 Ga0501048_0005785 3300049582 Bacteria 9399
255 Ga0501048_0025403 3300049582 Bacteria 4317
256 Ga0501048_0072238 3300049582 Bacteria 2436
257 Ga0501067_0008054 3300049583 Bacteria 5856
258 Ga0501067_0043173 3300049583 Bacteria 2504
259 Ga0501067_0175645 3300049583 Bacteria 1193
260 Ga0501068_0010845 3300049584 Bacteria 5128
261 Ga0501069_0000783 3300049585 Bacteria 14926
262 Ga0501069_0050031 3300049585 Bacteria 2323
263 Ga0501069_0099815 3300049585 Bacteria 1647
264 Ga0501069_0100894 3300049585 Bacteria 1638
265 Ga0501069_0265632 3300049585 Bacteria 1002
266 Ga0501070_0003205 3300049586 Bacteria 14226
267 Ga0501070_0003263 3300049586 Bacteria 14075
268 Ga0501070_0007403 3300049586 Bacteria 9323
269 Ga0501070_0061598 3300049586 Bacteria 3108
270 Ga0501070_0061927 3300049586 Bacteria 3099
271 Ga0501070_0088206 3300049586 Bacteria 2568
272 Ga0501071_0009950 3300049587 Bacteria 6354
273 Ga0501071_0017895 3300049587 Bacteria 4899
274 Ga0501071_0116511 3300049587 Bacteria 1978
275 Ga0501072_0001804 3300049588 Bacteria 15946
276 Ga0501072_0039652 3300049588 Bacteria 3697
277 Ga0501073_0011864 3300049589 Bacteria 6360
278 Ga0501073_0012683 3300049589 Bacteria 6147
279 Ga0501073_0018071 3300049589 Bacteria 5099
280 Ga0501073_0050271 3300049589 Bacteria 2922
281 Ga0501073_0062557 3300049589 Bacteria 2596
282 Ga0501074_0009832 3300049590 Bacteria 6947
283 Ga0501074_0011223 3300049590 Bacteria 6510
284 Ga0501074_0033159 3300049590 Bacteria 3742
285 Ga0501075_0005615 3300049591 Bacteria 8582
286 Ga0501075_0022341 3300049591 Bacteria 4620
287 Ga0501076_0000232 3300049592 Bacteria 33942
288 Ga0501076_0005960 3300049592 Bacteria 8800
289 Ga0501077_0040602 3300049593 Bacteria 2964
290 Ga0501077_0049256 3300049593 Bacteria 2678
291 Ga0501077_0051257 3300049593 Bacteria 2623
292 Ga0501079_0017940 3300049741 Bacteria 5404
293 Ga0501079_0136530 3300049741 Bacteria 1910
294 Ga0501080_0001165 3300049742 Bacteria 21739
295 Ga0501080_0003959 3300049742 Bacteria 13113
296 Ga0501080_0012111 3300049742 Bacteria 7902
297 Ga0501080_0018937 3300049742 Bacteria 6376
298 Ga0501080_0040611 3300049742 Bacteria 4339
299 Ga0501080_0158096 3300049742 Bacteria 2093
300 Ga0501080_0351121 3300049742 Bacteria 1332
301 Ga0501083_0003061 3300049744 Bacteria 11626
302 Ga0501083_0006494 3300049744 Bacteria 8292
303 Ga0501083_0036174 3300049744 Bacteria 3368
304 Ga0501083_0037504 3300049744 Bacteria 3301
305 Ga0501083_0233272 3300049744 Bacteria 1198
306 Ga0501035_0001465 3300049822 Bacteria 24189
307 Ga0501035_0008439 3300049822 Bacteria 9593
308 Ga0501035_0046251 3300049822 Bacteria 3914
309 Ga0501035_0272149 3300049822 Bacteria 1433
310 Ga0501044_0003639 3300049823 Bacteria 17347
311 Ga0501044_0005248 3300049823 Bacteria 14411
312 Ga0501044_0046723 3300049823 Bacteria 4481
313 Ga0501044_0057454 3300049823 Bacteria 3992
314 Ga0501044_0167466 3300049823 Bacteria 2171
315 Ga0501044_0278613 3300049823 Bacteria 1606
316 Ga0501045_0022855 3300049824 Bacteria 4479
317 nmdc:mga03n38_31255_c1 3300050490 Bacteria 2245
318 nmdc:mga03n38_33977_c1 3300050490 Bacteria 2174
319 nmdc:mga00v17_17763_c1 3300050491 Bacteria 4033
320 Ga0495595_0005672 3300053084 Bacteria 5052
321 Ga0495619_0002256 3300053085 Bacteria 12741
322 Ga0495619_0190431 3300053085 Bacteria 1420
323 Ga0500651_0001692 3300053093 Bacteria 11268
324 Ga0500616_0013767 3300053153 Bacteria 4678
325 Ga0501084_0002949 3300054114 Bacteria 13780
326 Ga0501084_0005398 3300054114 Bacteria 10478
327 Ga0501084_0017256 3300054114 Bacteria 5997
328 Ga0501084_0078980 3300054114 Bacteria 2758
329 Ga0501082_0002533 3300060353 Bacteria 16001
330 Ga0501082_0003464 3300060353 Bacteria 13763
331 Ga0501082_0040028 3300060353 Bacteria 4043
332 Ga0501082_0095901 3300060353 Bacteria 2564
333 Ga0530510_0000487 3300061734 Bacteria 25408
334 2503200797 2503198000 Bacteria 6884444
335 2513611541 2513237090 Bacteria 7096802
336 2514585977 2513237351 Bacteria 6968952
337 2643758360 2643221547 Bacteria 4740017
338 2644121060 2643221621 Bacteria 6212786
339 2694629669 2693429783 Bacteria 7019804
340 2694638123 2693429784 Bacteria 7241525
341 2857539638 2857537821 Bacteria 5248181
342 2871479033 2871474448 Bacteria 6806570
343 2874124431 2874123672 Bacteria 7238285
344 2885317240 2885312484 Bacteria 6415165
345 2919704771 2919704043 Bacteria 5560311
346 2958077662 2958071322 Bacteria 6815895
347 8002392535 8002392321 Bacteria 4159911
348 8004635393 8004633249 Bacteria 6723080
349 Ga0105240_10011910
350 LJQas_1002447
351 Ga0070658_10021237
352 Ga0070658_10028900
353 Ga0070683_100018847
354 Ga0070680_100022626
355 Ga0070680_100028568
356 Ga0070680_100029149
357 Ga0070680_100120490
358 Ga0070660_100014784
359 Ga0070691_10117164
360 Ga0070661_100064974
361 Ga0070675_100155745
362 Ga0070688_100212628
363 Ga0070659_100118746
364 Ga0070659_100206012
365 Ga0070659_100387109
366 Ga0070714_100083261
367 Ga0070662_100053447
368 Ga0070681_10003118
369 Ga0070681_10084259
370 Ga0070681_10210676
371 Ga0070699_100156603
372 Ga0070679_100002575
373 Ga0070679_100044649
374 Ga0070679_100056561
375 Ga0070679_100107224
376 Ga0070684_100060818
377 Ga0070684_100285110
378 Ga0068853_100002117
379 Ga0068853_100008111
380 Ga0070693_100006849
381 Ga0070693_100008954
382 Ga0068855_100011862
383 Ga0068855_100014231
384 Ga0068855_100025923
385 Ga0068855_100054267
386 Ga0068855_100435572
387 Ga0070664_100105162
388 Ga0068857_100035960
389 Ga0068854_100001452
390 Ga0068854_100021820
391 Ga0068856_100000024
392 Ga0068856_100065386
393 Ga0068856_100152949
394 Ga0068852_100030159
395 Ga0068862_100024817
396 Ga0081538_10008504
397 Ga0081540_1004828
398 Ga0075365_10002483
399 Ga0075368_10032606
400 Ga0075363_100010017
401 Ga0075363_100084100
402 Ga0075363_100155731
403 Ga0075364_10016046
404 Ga0070712_100168147
405 Ga0075367_10012833
406 Ga0075429_100439520
407 Ga0099794_10029464
408 Ga0105240_10006964
409 Ga0105240_10055924
410 Ga0111539_10041364
411 Ga0105241_10005667
412 Ga0105248_10251083
413 Ga0105237_10007023
414 Ga0105238_10036027
415 Ga0105238_10104833
416 Ga0105239_10030920
417 Ga0157373_10009307
418 Ga0157371_10052607
419 Ga0157370_10018194
420 Ga0157370_10024107
421 Ga0157378_10081569
422 Ga0157372_10029953
423 Ga0206353_10197760
424 Ga0213876_10009783
425 Ga0209233_1006798
426 Ga0207656_10005116
427 Ga0207705_10009596
428 Ga0207705_10019884
429 Ga0207705_10159452
430 Ga0207654_10170687
431 Ga0207707_10007720
432 Ga0207707_10014256
433 Ga0207707_10020876
434 Ga0207707_10021242
435 Ga0207695_10017211
436 Ga0207695_10036471
437 Ga0207671_10009486
438 Ga0207693_10228140
439 Ga0207660_10008544
440 Ga0207660_10014572
441 Ga0207662_10136652
442 Ga0207657_10004221
443 Ga0207657_10048498
444 Ga0207657_10073689
445 Ga0207649_10047380
446 Ga0207652_10012192
447 Ga0207652_10050909
448 Ga0207652_10078341
449 Ga0207652_10263026
450 Ga0207681_10066960
451 Ga0207650_10169706
452 Ga0207690_10043068
453 Ga0207706_10004852
454 Ga0207670_10336819
455 Ga0207661_10046153
456 Ga0207667_10012359
457 Ga0207667_10027075
458 Ga0207667_10075289
459 Ga0207667_10080429
460 Ga0207640_10019304
461 Ga0207640_10025784
462 Ga0207640_10092314
463 Ga0207639_10016950
464 Ga0207639_10038051
465 Ga0207639_10177175
466 Ga0207678_10135901
467 Ga0207702_10000805
468 Ga0207702_10319148
469 Ga0207674_10012738
470 Ga0207674_10155708
471 Ga0207698_10034006
472 Ga0207698_10592257
473 Ga0209970_1003456
474 Ga0207428_10142246
475 Ga0268265_10013916
476 Ga0268265_10314179
477 Ga0307513_10000012
478 Ga0307408_100058669
479 Ga0265313_10000087
480 Ga0265313_10013513
481 Ga0265342_10000131
482 Ga0316576_10001596
483 Ga0307405_10002425
484 Ga0307410_10006859
485 Ga0307406_10005349
486 Ga0307407_10004490
487 Ga0307409_100002503
488 Ga0307416_100009639
489 Ga0307411_10084155
490 Ga0307411_10272350
491 Ga0307415_100003499
492 Ga0316593_10032136
493 Ga0373926_0006331
494 Ga0373934_0001465
495 Ga0373936_0045393
496 Ga0373941_0001564
497 Ga0373945_0011709
498 Ga0373953_0003693
499 Ga0373954_0000827
500 Ga0373954_0123131
501 Ga0373957_0010743
502 Ga0373943_0000498
503 Ga0373955_0002043
504 Ga0373955_0020483
505 Ga0373924_0002332
506 Ga0373935_0010062
507 Ga0373927_0002012
508 Ga0373933_0008625
509 Ga0373947_0002414
510 Ga0373937_0014183
511 Ga0316582_0137353
512 Ga0373925_0028167
513 Ga0395899_0098695
514 Ga0395899_0220105
515 Ga0395900_0031735
516 Ga0395900_0089134
517 Ga0395900_0245254
518 Ga0395898_0178666
519 Ga0316581_0069833
520 Ga0395901_0100712
521 Ga0395901_0496844
522 Ga0400487_58139
523 Ga0436365_1849927
524 Ga0439448_0023556
525 Ga0451577_0141711
526 Ga0453684_0024323
527 Ga0495629_0000804
528 Ga0495629_0076097
529 Ga0495651_0120569
530 Ga0495653_0005997
531 Ga0495662_0015620
532 Ga0495608_0006206
533 Ga0495628_0026632
534 Ga0495630_0047031
535 Ga0495665_0034600
536 Ga0495640_0002381
537 Ga0495645_0008789
538 Ga0495634_0005998
539 Ga0495634_0110442
540 Ga0495635_0006293
541 Ga0495657_0033361
542 Ga0495599_0005174
543 Ga0495623_0143097
544 Ga0495646_0019943
545 Ga0495658_0162174
546 Ga0495600_0015912
547 Ga0495600_0177706
548 Ga0495581_0005378
549 Ga0495604_0191553
550 Ga0495674_0012736
551 Ga0495674_0035147
552 Ga0495676_0071239
553 Ga0495675_0012432
554 Ga0495684_0001622
555 Ga0495684_0003719
556 Ga0495593_0003006
557 Ga0495593_0036345
558 Ga0495602_0040840
559 Ga0496114_0072544
560 Ga0501031_0103129
561 Ga0501031_0119679
562 Ga0501031_0226938
563 Ga0501032_0016333
564 Ga0501032_0017695
565 Ga0501032_0067917
566 Ga0501033_0001736
567 Ga0501033_0114275
568 Ga0501034_0000179
569 Ga0501034_0009186
570 Ga0501034_0009628
571 Ga0501034_0015149
572 Ga0501034_0088129
573 Ga0501034_0210054
574 Ga0501034_0356450
575 Ga0501036_0001210
576 Ga0501036_0002364
577 Ga0501036_0004131
578 Ga0501036_0012136
579 Ga0501036_0012446
580 Ga0501037_0003424
581 Ga0501037_0007192
582 Ga0501037_0022670
583 Ga0501038_0001455
584 Ga0501038_0004755
585 Ga0501038_0009593
586 Ga0501039_0005161
587 Ga0501039_0008624
588 Ga0501039_0030048
589 Ga0501039_0184700
590 Ga0501042_0031595
591 Ga0501043_0001468
592 Ga0501043_0004234
593 Ga0501043_0034549
594 Ga0501046_0010801
595 Ga0501046_0013077
596 Ga0501046_0048993
597 Ga0501047_0000179
598 Ga0501047_0004650
599 Ga0501047_0085972
600 Ga0501047_0255541
601 Ga0501048_0000818
602 Ga0501048_0005785
603 Ga0501048_0025403
604 Ga0501048_0072238
605 Ga0501067_0008054
606 Ga0501067_0043173
607 Ga0501067_0175645
608 Ga0501068_0010845
609 Ga0501069_0000783
610 Ga0501069_0050031
611 Ga0501069_0099815
612 Ga0501069_0100894
613 Ga0501069_0265632
614 Ga0501070_0003205
615 Ga0501070_0003263
616 Ga0501070_0007403
617 Ga0501070_0061598
618 Ga0501070_0061927
619 Ga0501070_0088206
620 Ga0501071_0009950
621 Ga0501071_0017895
622 Ga0501071_0116511
623 Ga0501072_0001804
624 Ga0501072_0039652
625 Ga0501073_0011864
626 Ga0501073_0012683
627 Ga0501073_0018071
628 Ga0501073_0050271
629 Ga0501073_0062557
630 Ga0501074_0009832
631 Ga0501074_0011223
632 Ga0501074_0033159
633 Ga0501075_0005615
634 Ga0501075_0022341
635 Ga0501076_0000232
636 Ga0501076_0005960
637 Ga0501077_0040602
638 Ga0501077_0049256
639 Ga0501077_0051257
640 Ga0501079_0017940
641 Ga0501079_0136530
642 Ga0501080_0001165
643 Ga0501080_0003959
644 Ga0501080_0012111
645 Ga0501080_0018937
646 Ga0501080_0040611
647 Ga0501080_0158096
648 Ga0501080_0351121
649 Ga0501083_0003061
650 Ga0501083_0006494
651 Ga0501083_0036174
652 Ga0501083_0037504
653 Ga0501083_0233272
654 Ga0501035_0001465
655 Ga0501035_0008439
656 Ga0501035_0046251
657 Ga0501035_0272149
658 Ga0501044_0003639
659 Ga0501044_0005248
660 Ga0501044_0046723
661 Ga0501044_0057454
662 Ga0501044_0167466
663 Ga0501044_0278613
664 Ga0501045_0022855
665 nmdc:mga03n38_31255_c1
666 nmdc:mga03n38_33977_c1
667 nmdc:mga00v17_17763_c1
668 Ga0495595_0005672
669 Ga0495619_0002256
670 Ga0495619_0190431
671 Ga0500651_0001692
672 Ga0500616_0013767
673 Ga0501084_0002949
674 Ga0501084_0005398
675 Ga0501084_0017256
676 Ga0501084_0078980
677 Ga0501082_0002533
678 Ga0501082_0003464
679 Ga0501082_0040028
680 Ga0501082_0095901
681 Ga0530510_0000487
682 2503200797
683 2513611541
684 2514585977
685 2643758360
686 2644121060
687 2694629669
688 2694638123
689 2857539638
690 2871479033
691 2874124431
692 2885317240
693 2919704771
694 2958077662
695 8002392535
696 8004635393

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16868

NMT1_3

NMT1-like family

54

342

0.98

PF09084

NMT1

NMT1/THI5 like

79

233

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ddd-assembly1.cif.gz_A crystal structure of an immunogenic protein from ehrlichia chaffeensis 0.7867 28 310
1us5-assembly1.cif.gz_A putative glur0 ligand binding core with l-glutamate 0.7741 28 310
4ddd-assembly1.cif.gz_A crystal structure of an immunogenic protein from ehrlichia chaffeensis 0.7458 28 310
1us5-assembly1.cif.gz_A putative glur0 ligand binding core with l-glutamate 0.7406 28 310
7d3b-assembly1.cif.gz_A flavone reductase 0.7154 29 68
ID Description Score Start End Superfamily
4dddA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9332 106 243 3.40.190.10
1us4A02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9242 106 243 3.40.190.10
4dddA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9205 106 243 3.40.190.10
1us4A02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9117 106 243 3.40.190.10
af_Q54B10_47_225_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8544 29 69 3.40.50.360
ID Description Score Start End GO Terms
AF-A0A528CWL3-F1-model_v4 TAXI family TRAP transporter solute-binding subunit 0.9381 100 184
AF-X1W1P1-F1-model_v4 Uncharacterized protein 0.925 104 244
AF-A0A0M9E212-F1-model_v4 TRAP transporter solute receptor, TAXI family 0.9063 26 310
AF-A0A840WRM5-F1-model_v4 Uncharacterized protein 0.9008 16 307
AF-A0A1V0PSZ8-F1-model_v4 TRAP transporter solute receptor, TAXI family 0.8886 28 308

Map