F417434

General Info

Members Datasets Scaffolds Average Seq Length
348 260 696 91

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100408059|Ga0070713_1004080592
Length 101
Sequence MAVADVFAATMNTKSSITNKLREAFSPESLQVSDESHLHEGHAGHRPGGETHFRVYIVSSAFEGKSRIERHRMINAALNAELEGGVHALAIHAKAPGEDAG

Samples

Sample ID Description Type Environment
1 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
38 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
51 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
52 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
66 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
67 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
68 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
69 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
70 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
72 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
100 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
101 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
103 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
104 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
105 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
106 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
107 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
108 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
109 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
110 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
111 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
112 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
113 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
114 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
115 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
116 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
117 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
118 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
119 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
120 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
121 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
122 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
123 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
124 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
125 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
127 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
128 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
129 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
130 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
131 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
132 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
133 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
134 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
135 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
136 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
137 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
138 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
139 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
140 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
141 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
142 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
143 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
144 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
145 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
146 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
147 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
148 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
149 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
150 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
151 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
152 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
153 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
154 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
155 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
156 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
157 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
158 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
159 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
160 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
161 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
162 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
163 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
164 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
165 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
166 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
167 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
168 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
169 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
170 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
171 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
172 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
173 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
174 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
175 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
176 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
177 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
178 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
179 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
180 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
181 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
182 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
183 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
184 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
185 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
186 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
187 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
188 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
189 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
190 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
191 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
192 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
193 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
194 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
195 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
196 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
197 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
198 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
199 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
200 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
201 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
202 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
203 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
204 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
205 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
206 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
207 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
208 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
209 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
210 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
224 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
225 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
226 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
227 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
229 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
230 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
231 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
232 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
233 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
234 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
235 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
236 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
237 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
238 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
239 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
240 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
241 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
242 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
243 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
244 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
245 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
246 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
247 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
248 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
249 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
250 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
251 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
252 2643221651 Afipia sp. Root123D2 Isolate Unclassified
253 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
254 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
255 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
256 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
257 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
258 2904699407
259 641522639 Methylobacterium sp. 4-46 Isolate Nodule
260 8002060224 Methylocystis sp. Sn-Cys Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.54
Metatranscriptomes 0.29
Isolates 3.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.75
Nodule 2.01
Rhizoplane 2.01
Rhizosphere 78.45
Stem 0
Stem Tuber 0
Unclassified 0.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070713_100408059 3300005436 Bacteria 1270
2 CNAas_1005661 3300000532 Bacteria 801
3 JGI25406J46586_10003994 3300003203 Bacteria 6901
4 JGI25404J52841_10014342 3300003659 Bacteria 1719
5 JGI25405J52794_10059101 3300003911 Bacteria 828
6 Ga0070658_10221386 3300005327 Bacteria 1601
7 Ga0070658_10895170 3300005327 Bacteria 772
8 Ga0070658_10975747 3300005327 Bacteria 737
9 Ga0070683_100036060 3300005329 Bacteria 4524
10 Ga0068869_102009737 3300005334 Bacteria 519
11 Ga0070680_100157534 3300005336 Bacteria 1908
12 Ga0070682_101416295 3300005337 Bacteria 595
13 Ga0070691_10075365 3300005341 Bacteria 1643
14 Ga0070687_101163949 3300005343 Bacteria 567
15 Ga0070659_100301786 3300005366 Bacteria 1336
16 Ga0070709_10001027 3300005434 Bacteria 15441
17 Ga0070709_10004068 3300005434 Bacteria 7892
18 Ga0070714_100002014 3300005435 Bacteria 14871
19 Ga0070714_100083922 3300005435 Bacteria 2779
20 Ga0070714_100352975 3300005435 Bacteria 1381
21 Ga0070713_100004390 3300005436 Bacteria 9476
22 Ga0070713_100128640 3300005436 Bacteria 2231
23 Ga0070713_100941679 3300005436 Bacteria 832
24 Ga0070713_101570000 3300005436 Bacteria 639
25 Ga0070710_10001042 3300005437 Bacteria 13175
26 Ga0070710_10001151 3300005437 Bacteria 12525
27 Ga0070711_100003508 3300005439 Bacteria 9148
28 Ga0070711_100010129 3300005439 Bacteria 5825
29 Ga0070711_100315103 3300005439 Bacteria 1248
30 Ga0070681_10009040 3300005458 Bacteria 9791
31 Ga0070681_10023853 3300005458 Bacteria 6159
32 Ga0070698_100289967 3300005471 Bacteria 1568
33 Ga0070679_100036010 3300005530 Bacteria 4910
34 Ga0070679_100334107 3300005530 Bacteria 1464
35 Ga0070684_100105279 3300005535 Bacteria 2524
36 Ga0068853_101035333 3300005539 Bacteria 791
37 Ga0068853_101266036 3300005539 Bacteria 713
38 Ga0068853_102462069 3300005539 Bacteria 504
39 Ga0070672_100401771 3300005543 Bacteria 1175
40 Ga0070695_101663424 3300005545 Bacteria 534
41 Ga0070693_100011639 3300005547 Bacteria 4434
42 Ga0070665_100169963 3300005548 Bacteria 2181
43 Ga0068855_100039393 3300005563 Bacteria 5610
44 Ga0068857_100457313 3300005577 Bacteria 1194
45 Ga0068856_100001427 3300005614 Bacteria 25057
46 Ga0068856_100426886 3300005614 Bacteria 1346
47 Ga0068866_10144231 3300005718 Bacteria 1371
48 Ga0068861_100987778 3300005719 Bacteria 803
49 Ga0068858_100963314 3300005842 Bacteria 835
50 Ga0081455_10006916 3300005937 Bacteria 12066
51 Ga0081455_10173029 3300005937 Bacteria 1643
52 Ga0081540_1001133 3300005983 Bacteria 23567
53 Ga0081539_10000129 3300005985 Bacteria 178675
54 Ga0081539_10001064 3300005985 Bacteria 50201
55 Ga0081539_10080220 3300005985 Bacteria 1717
56 Ga0070717_10017810 3300006028 Bacteria 5536
57 Ga0075363_100462305 3300006048 Bacteria 750
58 Ga0070715_10000398 3300006163 Bacteria 10996
59 Ga0070715_10575101 3300006163 Bacteria 657
60 Ga0070716_100000855 3300006173 Bacteria 13112
61 Ga0070716_100018619 3300006173 Bacteria 3620
62 Ga0070716_101764961 3300006173 Bacteria 512
63 Ga0070712_100002401 3300006175 Bacteria 11532
64 Ga0070712_100038638 3300006175 Bacteria 3263
65 Ga0075369_10397474 3300006186 Bacteria 649
66 Ga0097621_102373487 3300006237 Bacteria 507
67 Ga0075370_10100746 3300006353 Bacteria 1671
68 Ga0068871_101385191 3300006358 Bacteria 663
69 Ga0075433_10073464 3300006852 Bacteria 3008
70 Ga0075434_100158696 3300006871 Bacteria 2282
71 Ga0068865_101324174 3300006881 Bacteria 641
72 Ga0075436_100855005 3300006914 Bacteria 679
73 Ga0075435_100012091 3300007076 Bacteria 6379
74 Ga0075435_100306813 3300007076 Bacteria 1358
75 Ga0099794_10016951 3300007265 Bacteria 3239
76 Ga0099795_10143922 3300007788 Bacteria 972
77 Ga0105250_10084564 3300009092 Bacteria 1288
78 Ga0105240_10031032 3300009093 Bacteria 6936
79 Ga0105245_10366484 3300009098 Bacteria 1431
80 Ga0105245_11175367 3300009098 Bacteria 815
81 Ga0105241_10233414 3300009174 Bacteria 1552
82 Ga0105241_11951322 3300009174 Bacteria 577
83 Ga0105242_11909398 3300009176 Bacteria 634
84 Ga0105248_10150577 3300009177 Bacteria 2625
85 Ga0105248_10535197 3300009177 Bacteria 1321
86 Ga0105237_10878305 3300009545 Bacteria 903
87 Ga0105237_11385075 3300009545 Bacteria 710
88 Ga0105237_12062757 3300009545 Bacteria 579
89 Ga0105239_10887727 3300010375 Bacteria 1023
90 Ga0157370_10223369 3300013104 Bacteria 1744
91 Ga0157369_12394224 3300013105 Bacteria 535
92 Ga0157374_10132517 3300013296 Bacteria 2413
93 Ga0157374_12052149 3300013296 Bacteria 598
94 Ga0157378_10050750 3300013297 Bacteria 3691
95 Ga0157378_10599918 3300013297 Bacteria 1112
96 Ga0157375_11188863 3300013308 Bacteria 894
97 Ga0213873_10017834 3300021358 Bacteria 1624
98 Ga0213872_10306796 3300021361 Bacteria 658
99 Ga0213874_10033195 3300021377 Bacteria 1503
100 Ga0213876_10001689 3300021384 Bacteria 13426
101 Ga0213876_10002183 3300021384 Bacteria 11561
102 Ga0228598_1054359 3300024227 Bacteria 795
103 Ga0207666_1004817 3300025271 Bacteria 1705
104 Ga0207426_1112110 3300025302 Bacteria 686
105 Ga0207692_10000436 3300025898 Bacteria 14690
106 Ga0207692_10002177 3300025898 Bacteria 7484
107 Ga0207685_10009067 3300025905 Bacteria 2872
108 Ga0207699_10000614 3300025906 Bacteria 17364
109 Ga0207699_10002471 3300025906 Bacteria 8722
110 Ga0207705_10099894 3300025909 Bacteria 2134
111 Ga0207705_10416651 3300025909 Bacteria 1040
112 Ga0207707_10440403 3300025912 Bacteria 1115
113 Ga0207695_10167321 3300025913 Bacteria 2126
114 Ga0207671_10820676 3300025914 Bacteria 737
115 Ga0207693_10000073 3300025915 Bacteria 89380
116 Ga0207693_10006707 3300025915 Bacteria 9504
117 Ga0207663_10001948 3300025916 Bacteria 9767
118 Ga0207663_10002898 3300025916 Bacteria 8291
119 Ga0207663_10129116 3300025916 Bacteria 1743
120 Ga0207660_10548444 3300025917 Bacteria 940
121 Ga0207652_10298256 3300025921 Bacteria 1455
122 Ga0207681_10803373 3300025923 Bacteria 786
123 Ga0207694_11098280 3300025924 Bacteria 673
124 Ga0207659_10144004 3300025926 Bacteria 1853
125 Ga0207687_10100087 3300025927 Bacteria 2131
126 Ga0207700_10007805 3300025928 Bacteria 6575
127 Ga0207700_10032363 3300025928 Bacteria 3729
128 Ga0207700_10539367 3300025928 Bacteria 1035
129 Ga0207664_10020170 3300025929 Bacteria 4936
130 Ga0207664_10021030 3300025929 Bacteria 4843
131 Ga0207664_10283206 3300025929 Bacteria 1455
132 Ga0207690_10131047 3300025932 Bacteria 1835
133 Ga0207669_10965740 3300025937 Bacteria 715
134 Ga0207665_10003417 3300025939 Bacteria 10628
135 Ga0207665_10109747 3300025939 Bacteria 1937
136 Ga0207665_10520676 3300025939 Bacteria 921
137 Ga0207691_10724429 3300025940 Bacteria 838
138 Ga0207711_10767839 3300025941 Bacteria 898
139 Ga0207711_11668144 3300025941 Bacteria 581
140 Ga0207667_10045591 3300025949 Bacteria 4642
141 Ga0207639_11896302 3300026041 Bacteria 557
142 Ga0207702_10000904 3300026078 Bacteria 30798
143 Ga0207702_10476867 3300026078 Bacteria 1214
144 Ga0207674_10145990 3300026116 Bacteria 2324
145 Ga0207698_11485425 3300026142 Bacteria 693
146 Ga0307515_10162606 3300028794 Bacteria 2268
147 Ga0307511_10224457 3300030521 Bacteria 938
148 Ga0265760_10085268 3300031090 Bacteria 983
149 Ga0265339_10000880 3300031249 Bacteria 23069
150 Ga0307513_10640938 3300031456 Bacteria 770
151 Ga0307509_10116624 3300031507 Bacteria 2659
152 Ga0307508_10000005 3300031616 Bacteria 286511
153 Ga0307508_10213936 3300031616 Bacteria 1527
154 Ga0265314_10004999 3300031711 Bacteria 12078
155 Ga0307516_10007789 3300031730 Bacteria 12230
156 Ga0307516_10168372 3300031730 Bacteria 1933
157 Ga0307507_10204341 3300033179 Bacteria 1360
158 Ga0307510_10262610 3300033180 Bacteria 1207
159 Ga0373944_0382208 3300035089 Bacteria 540
160 Ga0373923_0017699 3300035111 Bacteria 2729
161 Ga0373932_0139272 3300035112 Bacteria 824
162 Ga0373932_0143980 3300035112 Bacteria 813
163 Ga0373936_0059005 3300035113 Bacteria 1563
164 Ga0373945_0063893 3300035116 Bacteria 1379
165 Ga0373954_0032689 3300035118 Bacteria 2406
166 Ga0373956_0037885 3300035119 Bacteria 2132
167 Ga0373943_0019583 3300035170 Bacteria 3112
168 Ga0373943_0564380 3300035170 Bacteria 669
169 Ga0373946_0112985 3300035171 Bacteria 1231
170 Ga0373946_0659376 3300035171 Bacteria 545
171 Ga0373955_0111720 3300035172 Bacteria 1580
172 Ga0373924_0017563 3300035410 Bacteria 2747
173 Ga0373935_0021601 3300035692 Bacteria 3942
174 Ga0373935_0041280 3300035692 Bacteria 2898
175 Ga0373927_0038043 3300035695 Bacteria 3125
176 Ga0373933_0001709 3300035724 Bacteria 12737
177 Ga0373947_0062986 3300035725 Bacteria 2258
178 Ga0373947_0224510 3300035725 Bacteria 1236
179 Ga0373937_0000959 3300036401 Bacteria 24479
180 Ga0373925_0016244 3300037068 Bacteria 5388
181 Ga0373925_0066602 3300037068 Bacteria 2715
182 Ga0395900_0043449 3300037418 Bacteria 4632
183 Ga0395898_0692317 3300037466 Bacteria 961
184 Ga0436364_0265492 3300037853 Bacteria 945
185 Ga0436364_0529683 3300037853 Bacteria 5388
186 Ga0436364_0590207 3300037853 Bacteria 1043
187 Ga0436364_1298928 3300037853 Bacteria 530
188 Ga0436365_0667025 3300039437 Unclassified 1219
189 Ga0436365_0829696 3300039437 Bacteria 36403
190 Ga0436365_1668408 3300039437 Bacteria 631
191 Ga0436360_0343524 3300039438 Bacteria 787
192 Ga0436360_0476576 3300039438 Bacteria 598
193 Ga0436360_1257287 3300039438 Bacteria 604
194 Ga0436363_0460467 3300039450 Bacteria 5978
195 Ga0436363_0467493 3300039450 Bacteria 5601
196 Ga0436363_1161311 3300039450 Bacteria 612
197 Ga0436362_0515140 3300039453 Unclassified 784
198 Ga0451798_0073282 3300041458 Bacteria 601
199 Ga0451837_0961165 3300041494 Bacteria 634
200 Ga0451577_0575202 3300042876 Bacteria 1023
201 Ga0466969_0144597 3300044656 Bacteria 1098
202 Ga0453683_0545485 3300044673 Bacteria 754
203 Ga0453683_0944089 3300044673 Bacteria 571
204 Ga0466966_0497316 3300044684 Bacteria 733
205 Ga0466963_0830315 3300044694 Bacteria 652
206 Ga0466963_1233455 3300044694 Bacteria 525
207 Ga0453684_0257841 3300044712 Bacteria 1999
208 Ga0453684_0759735 3300044712 Bacteria 1049
209 Ga0466970_0282268 3300044765 Bacteria 934
210 Ga0451576_0058864 3300045051 Bacteria 4012
211 Ga0466967_1022657 3300045976 Bacteria 823
212 Ga0495603_0544784 3300046455 Bacteria 664
213 Ga0495629_0003800 3300046459 Bacteria 11376
214 Ga0495638_0646391 3300046460 Bacteria 514
215 Ga0495641_0554213 3300046461 Bacteria 525
216 Ga0495651_0002605 3300046462 Bacteria 13949
217 Ga0495653_0001872 3300046463 Bacteria 16609
218 Ga0495605_0261296 3300046474 Bacteria 739
219 Ga0495639_0064974 3300046475 Bacteria 1678
220 Ga0495662_0154377 3300046476 Bacteria 1131
221 Ga0495664_0005368 3300046477 Bacteria 7031
222 Ga0495584_0260102 3300046491 Bacteria 882
223 Ga0495594_0185772 3300046499 Bacteria 1184
224 Ga0495594_0506589 3300046499 Bacteria 685
225 Ga0495608_0008594 3300046511 Bacteria 7151
226 Ga0495618_0005171 3300046514 Bacteria 7973
227 Ga0495628_0150738 3300046516 Bacteria 1771
228 Ga0495628_0191333 3300046516 Bacteria 1545
229 Ga0495630_0095840 3300046517 Bacteria 2243
230 Ga0495630_0590891 3300046517 Bacteria 851
231 Ga0495630_0711698 3300046517 Bacteria 768
232 Ga0495631_0394125 3300046518 Bacteria 589
233 Ga0495632_0115844 3300046519 Bacteria 1255
234 Ga0495643_0184697 3300046522 Bacteria 1011
235 Ga0495666_0112008 3300046526 Bacteria 1281
236 Ga0495652_0017747 3300046529 Bacteria 6351
237 Ga0495665_0117851 3300046531 Bacteria 1391
238 Ga0495640_0003726 3300046533 Bacteria 12246
239 Ga0495587_0000685 3300046536 Bacteria 22759
240 Ga0495621_0462567 3300046539 Bacteria 544
241 Ga0495645_0192577 3300046543 Bacteria 1388
242 Ga0495622_0035018 3300046557 Bacteria 2341
243 Ga0495667_0002333 3300046559 Bacteria 12707
244 Ga0495656_0519466 3300046615 Bacteria 633
245 Ga0495634_0003291 3300046642 Bacteria 13024
246 Ga0495611_0407819 3300046648 Bacteria 621
247 Ga0495635_0000771 3300046663 Bacteria 20855
248 Ga0495657_0040707 3300046675 Bacteria 3185
249 Ga0495599_0105977 3300046678 Bacteria 1751
250 Ga0495623_0004279 3300046679 Bacteria 9399
251 Ga0495646_0006965 3300046680 Bacteria 7178
252 Ga0495658_0082897 3300046683 Bacteria 1885
253 Ga0495658_0096764 3300046683 Bacteria 1756
254 Ga0495669_0141920 3300046684 Bacteria 1134
255 Ga0495613_0684193 3300046689 Bacteria 676
256 Ga0495624_0109487 3300046690 Bacteria 1699
257 Ga0495624_0307285 3300046690 Bacteria 956
258 Ga0495670_0157834 3300046691 Bacteria 1191
259 Ga0495589_0332542 3300046794 Bacteria 701
260 Ga0495600_0001241 3300046809 Bacteria 14014
261 Ga0495581_0101781 3300047315 Bacteria 1669
262 Ga0495604_0000130 3300047317 Bacteria 63418
263 Ga0495674_0007329 3300047319 Bacteria 10543
264 Ga0495674_0095567 3300047319 Bacteria 2534
265 Ga0495680_0000701 3300047322 Bacteria 37622
266 Ga0495675_0017632 3300047444 Bacteria 4527
267 Ga0495684_0053669 3300047471 Bacteria 3075
268 Ga0495686_0079519 3300047472 Bacteria 2005
269 Ga0495593_0036813 3300047673 Bacteria 2651
270 Ga0495602_0013701 3300048088 Bacteria 8269
271 Ga0496102_1004650 3300048905 Bacteria 755
272 Ga0496104_1117142 3300048907 Bacteria 692
273 Ga0496106_0002763 3300048909 Bacteria 13001
274 Ga0496108_0293461 3300048911 Bacteria 1416
275 Ga0496108_0464193 3300048911 Bacteria 1106
276 Ga0496112_0277094 3300048915 Bacteria 1625
277 Ga0496116_0219523 3300048919 Bacteria 976
278 Ga0496117_0032533 3300048920 Bacteria 3961
279 Ga0496118_0031039 3300048921 Bacteria 4442
280 Ga0496119_0199643 3300048922 Bacteria 1036
281 Ga0496121_0136734 3300048924 Bacteria 1824
282 Ga0496121_0540187 3300048924 Bacteria 731
283 Ga0496124_0002831 3300048927 Bacteria 21956
284 Ga0496125_0045973 3300048928 Bacteria 3668
285 Ga0496125_0148938 3300048928 Bacteria 1612
286 Ga0496126_0002707 3300048929 Bacteria 23413
287 Ga0496126_0019215 3300048929 Bacteria 6734
288 Ga0496126_0411117 3300048929 Bacteria 1096
289 Ga0501031_0008622 3300049568 Bacteria 6629
290 Ga0501032_0006925 3300049569 Bacteria 8311
291 Ga0501033_0045514 3300049570 Bacteria 3265
292 Ga0501034_0451731 3300049571 Bacteria 1203
293 Ga0501034_0700524 3300049571 Bacteria 911
294 Ga0501036_0160803 3300049572 Bacteria 1893
295 Ga0501036_0688070 3300049572 Bacteria 845
296 Ga0501037_0003542 3300049573 Bacteria 11331
297 Ga0501038_0029768 3300049574 Bacteria 4835
298 Ga0501038_0881621 3300049574 Bacteria 661
299 Ga0501039_0043119 3300049575 Bacteria 3485
300 Ga0501041_0044146 3300049577 Bacteria 2710
301 Ga0501042_0318557 3300049578 Bacteria 1123
302 Ga0501043_0021489 3300049579 Bacteria 5060
303 Ga0501043_0359986 3300049579 Bacteria 1104
304 Ga0501046_0105471 3300049580 Bacteria 2158
305 Ga0501047_0586784 3300049581 Bacteria 937
306 Ga0501070_0294846 3300049586 Bacteria 1322
307 Ga0501073_0097512 3300049589 Bacteria 2042
308 Ga0501077_0435524 3300049593 Bacteria 839
309 Ga0501080_0180188 3300049742 Bacteria 1945
310 Ga0501035_0012680 3300049822 Bacteria 7789
311 Ga0501035_0138410 3300049822 Bacteria 2118
312 Ga0501044_0036067 3300049823 Bacteria 5175
313 Ga0501044_0266217 3300049823 Bacteria 1651
314 nmdc:mga0yw44_745624_c1 3300050492 Bacteria 665
315 nmdc:mga0rr50_5259_c1 3300050513 Bacteria 7701
316 nmdc:mga08x19_858715_c1 3300050514 Bacteria 645
317 nmdc:mga0a205_226547_c1 3300050515 Bacteria 1754
318 nmdc:mga0sz30_72808_c1 3300050516 Bacteria 1481
319 Ga0495601_0161051 3300053077 Bacteria 1466
320 Ga0495612_0010368 3300053078 Bacteria 3769
321 Ga0500635_0066572 3300053080 Bacteria 1269
322 Ga0495595_0011853 3300053084 Bacteria 3654
323 Ga0495619_0002023 3300053085 Bacteria 13480
324 Ga0500566_0096096 3300053094 Bacteria 1631
325 Ga0500595_037916 3300053119 Bacteria 1569
326 Ga0500573_0030549 3300053140 Bacteria 3107
327 Ga0500577_0000487 3300053142 Bacteria 10213
328 Ga0500590_261005 3300053148 Bacteria 680
329 Ga0500604_0092481 3300053151 Bacteria 989
330 Ga0500638_028147 3300053162 Bacteria 2699
331 Ga0500638_338497 3300053162 Bacteria 563
332 Ga0500639_111750 3300053163 Bacteria 1328
333 Ga0500636_0227678 3300053177 Bacteria 966
334 Ga0500636_0380120 3300053177 Bacteria 662
335 Ga0500637_0013267 3300053178 Bacteria 4316
336 Ga0500637_0386831 3300053178 Bacteria 731
337 2509150148 2508501128 Bacteria 8613869
338 2513718835 2513237104 Bacteria 10034502
339 2545678856 2545555834 Bacteria 8130841
340 2644290701 2643221651 Bacteria 4798932
341 2723849319 2721755755 Bacteria 8322773
342 2776257768 2775506901 Bacteria 9631051
343 2828308681 2828305725 Bacteria 4916900
344 2841912325 2841911363 Bacteria 6173697
345 2841919906 2841917233 Bacteria 6173500
346 2904707824
347 641646583 641522639 Bacteria 7737025
348 8002060904 8002060224 Bacteria 4026565
349 Ga0070713_100408059
350 CNAas_1005661
351 JGI25406J46586_10003994
352 JGI25404J52841_10014342
353 JGI25405J52794_10059101
354 Ga0070658_10221386
355 Ga0070658_10895170
356 Ga0070658_10975747
357 Ga0070683_100036060
358 Ga0068869_102009737
359 Ga0070680_100157534
360 Ga0070682_101416295
361 Ga0070691_10075365
362 Ga0070687_101163949
363 Ga0070659_100301786
364 Ga0070709_10001027
365 Ga0070709_10004068
366 Ga0070714_100002014
367 Ga0070714_100083922
368 Ga0070714_100352975
369 Ga0070713_100004390
370 Ga0070713_100128640
371 Ga0070713_100941679
372 Ga0070713_101570000
373 Ga0070710_10001042
374 Ga0070710_10001151
375 Ga0070711_100003508
376 Ga0070711_100010129
377 Ga0070711_100315103
378 Ga0070681_10009040
379 Ga0070681_10023853
380 Ga0070698_100289967
381 Ga0070679_100036010
382 Ga0070679_100334107
383 Ga0070684_100105279
384 Ga0068853_101035333
385 Ga0068853_101266036
386 Ga0068853_102462069
387 Ga0070672_100401771
388 Ga0070695_101663424
389 Ga0070693_100011639
390 Ga0070665_100169963
391 Ga0068855_100039393
392 Ga0068857_100457313
393 Ga0068856_100001427
394 Ga0068856_100426886
395 Ga0068866_10144231
396 Ga0068861_100987778
397 Ga0068858_100963314
398 Ga0081455_10006916
399 Ga0081455_10173029
400 Ga0081540_1001133
401 Ga0081539_10000129
402 Ga0081539_10001064
403 Ga0081539_10080220
404 Ga0070717_10017810
405 Ga0075363_100462305
406 Ga0070715_10000398
407 Ga0070715_10575101
408 Ga0070716_100000855
409 Ga0070716_100018619
410 Ga0070716_101764961
411 Ga0070712_100002401
412 Ga0070712_100038638
413 Ga0075369_10397474
414 Ga0097621_102373487
415 Ga0075370_10100746
416 Ga0068871_101385191
417 Ga0075433_10073464
418 Ga0075434_100158696
419 Ga0068865_101324174
420 Ga0075436_100855005
421 Ga0075435_100012091
422 Ga0075435_100306813
423 Ga0099794_10016951
424 Ga0099795_10143922
425 Ga0105250_10084564
426 Ga0105240_10031032
427 Ga0105245_10366484
428 Ga0105245_11175367
429 Ga0105241_10233414
430 Ga0105241_11951322
431 Ga0105242_11909398
432 Ga0105248_10150577
433 Ga0105248_10535197
434 Ga0105237_10878305
435 Ga0105237_11385075
436 Ga0105237_12062757
437 Ga0105239_10887727
438 Ga0157370_10223369
439 Ga0157369_12394224
440 Ga0157374_10132517
441 Ga0157374_12052149
442 Ga0157378_10050750
443 Ga0157378_10599918
444 Ga0157375_11188863
445 Ga0213873_10017834
446 Ga0213872_10306796
447 Ga0213874_10033195
448 Ga0213876_10001689
449 Ga0213876_10002183
450 Ga0228598_1054359
451 Ga0207666_1004817
452 Ga0207426_1112110
453 Ga0207692_10000436
454 Ga0207692_10002177
455 Ga0207685_10009067
456 Ga0207699_10000614
457 Ga0207699_10002471
458 Ga0207705_10099894
459 Ga0207705_10416651
460 Ga0207707_10440403
461 Ga0207695_10167321
462 Ga0207671_10820676
463 Ga0207693_10000073
464 Ga0207693_10006707
465 Ga0207663_10001948
466 Ga0207663_10002898
467 Ga0207663_10129116
468 Ga0207660_10548444
469 Ga0207652_10298256
470 Ga0207681_10803373
471 Ga0207694_11098280
472 Ga0207659_10144004
473 Ga0207687_10100087
474 Ga0207700_10007805
475 Ga0207700_10032363
476 Ga0207700_10539367
477 Ga0207664_10020170
478 Ga0207664_10021030
479 Ga0207664_10283206
480 Ga0207690_10131047
481 Ga0207669_10965740
482 Ga0207665_10003417
483 Ga0207665_10109747
484 Ga0207665_10520676
485 Ga0207691_10724429
486 Ga0207711_10767839
487 Ga0207711_11668144
488 Ga0207667_10045591
489 Ga0207639_11896302
490 Ga0207702_10000904
491 Ga0207702_10476867
492 Ga0207674_10145990
493 Ga0207698_11485425
494 Ga0307515_10162606
495 Ga0307511_10224457
496 Ga0265760_10085268
497 Ga0265339_10000880
498 Ga0307513_10640938
499 Ga0307509_10116624
500 Ga0307508_10000005
501 Ga0307508_10213936
502 Ga0265314_10004999
503 Ga0307516_10007789
504 Ga0307516_10168372
505 Ga0307507_10204341
506 Ga0307510_10262610
507 Ga0373944_0382208
508 Ga0373923_0017699
509 Ga0373932_0139272
510 Ga0373932_0143980
511 Ga0373936_0059005
512 Ga0373945_0063893
513 Ga0373954_0032689
514 Ga0373956_0037885
515 Ga0373943_0019583
516 Ga0373943_0564380
517 Ga0373946_0112985
518 Ga0373946_0659376
519 Ga0373955_0111720
520 Ga0373924_0017563
521 Ga0373935_0021601
522 Ga0373935_0041280
523 Ga0373927_0038043
524 Ga0373933_0001709
525 Ga0373947_0062986
526 Ga0373947_0224510
527 Ga0373937_0000959
528 Ga0373925_0016244
529 Ga0373925_0066602
530 Ga0395900_0043449
531 Ga0395898_0692317
532 Ga0436364_0265492
533 Ga0436364_0529683
534 Ga0436364_0590207
535 Ga0436364_1298928
536 Ga0436365_0667025
537 Ga0436365_0829696
538 Ga0436365_1668408
539 Ga0436360_0343524
540 Ga0436360_0476576
541 Ga0436360_1257287
542 Ga0436363_0460467
543 Ga0436363_0467493
544 Ga0436363_1161311
545 Ga0436362_0515140
546 Ga0451798_0073282
547 Ga0451837_0961165
548 Ga0451577_0575202
549 Ga0466969_0144597
550 Ga0453683_0545485
551 Ga0453683_0944089
552 Ga0466966_0497316
553 Ga0466963_0830315
554 Ga0466963_1233455
555 Ga0453684_0257841
556 Ga0453684_0759735
557 Ga0466970_0282268
558 Ga0451576_0058864
559 Ga0466967_1022657
560 Ga0495603_0544784
561 Ga0495629_0003800
562 Ga0495638_0646391
563 Ga0495641_0554213
564 Ga0495651_0002605
565 Ga0495653_0001872
566 Ga0495605_0261296
567 Ga0495639_0064974
568 Ga0495662_0154377
569 Ga0495664_0005368
570 Ga0495584_0260102
571 Ga0495594_0185772
572 Ga0495594_0506589
573 Ga0495608_0008594
574 Ga0495618_0005171
575 Ga0495628_0150738
576 Ga0495628_0191333
577 Ga0495630_0095840
578 Ga0495630_0590891
579 Ga0495630_0711698
580 Ga0495631_0394125
581 Ga0495632_0115844
582 Ga0495643_0184697
583 Ga0495666_0112008
584 Ga0495652_0017747
585 Ga0495665_0117851
586 Ga0495640_0003726
587 Ga0495587_0000685
588 Ga0495621_0462567
589 Ga0495645_0192577
590 Ga0495622_0035018
591 Ga0495667_0002333
592 Ga0495656_0519466
593 Ga0495634_0003291
594 Ga0495611_0407819
595 Ga0495635_0000771
596 Ga0495657_0040707
597 Ga0495599_0105977
598 Ga0495623_0004279
599 Ga0495646_0006965
600 Ga0495658_0082897
601 Ga0495658_0096764
602 Ga0495669_0141920
603 Ga0495613_0684193
604 Ga0495624_0109487
605 Ga0495624_0307285
606 Ga0495670_0157834
607 Ga0495589_0332542
608 Ga0495600_0001241
609 Ga0495581_0101781
610 Ga0495604_0000130
611 Ga0495674_0007329
612 Ga0495674_0095567
613 Ga0495680_0000701
614 Ga0495675_0017632
615 Ga0495684_0053669
616 Ga0495686_0079519
617 Ga0495593_0036813
618 Ga0495602_0013701
619 Ga0496102_1004650
620 Ga0496104_1117142
621 Ga0496106_0002763
622 Ga0496108_0293461
623 Ga0496108_0464193
624 Ga0496112_0277094
625 Ga0496116_0219523
626 Ga0496117_0032533
627 Ga0496118_0031039
628 Ga0496119_0199643
629 Ga0496121_0136734
630 Ga0496121_0540187
631 Ga0496124_0002831
632 Ga0496125_0045973
633 Ga0496125_0148938
634 Ga0496126_0002707
635 Ga0496126_0019215
636 Ga0496126_0411117
637 Ga0501031_0008622
638 Ga0501032_0006925
639 Ga0501033_0045514
640 Ga0501034_0451731
641 Ga0501034_0700524
642 Ga0501036_0160803
643 Ga0501036_0688070
644 Ga0501037_0003542
645 Ga0501038_0029768
646 Ga0501038_0881621
647 Ga0501039_0043119
648 Ga0501041_0044146
649 Ga0501042_0318557
650 Ga0501043_0021489
651 Ga0501043_0359986
652 Ga0501046_0105471
653 Ga0501047_0586784
654 Ga0501070_0294846
655 Ga0501073_0097512
656 Ga0501077_0435524
657 Ga0501080_0180188
658 Ga0501035_0012680
659 Ga0501035_0138410
660 Ga0501044_0036067
661 Ga0501044_0266217
662 nmdc:mga0yw44_745624_c1
663 nmdc:mga0rr50_5259_c1
664 nmdc:mga08x19_858715_c1
665 nmdc:mga0a205_226547_c1
666 nmdc:mga0sz30_72808_c1
667 Ga0495601_0161051
668 Ga0495612_0010368
669 Ga0500635_0066572
670 Ga0495595_0011853
671 Ga0495619_0002023
672 Ga0500566_0096096
673 Ga0500595_037916
674 Ga0500573_0030549
675 Ga0500577_0000487
676 Ga0500590_261005
677 Ga0500604_0092481
678 Ga0500638_028147
679 Ga0500638_338497
680 Ga0500639_111750
681 Ga0500636_0227678
682 Ga0500636_0380120
683 Ga0500637_0013267
684 Ga0500637_0386831
685 2509150148
686 2513718835
687 2545678856
688 2644290701
689 2723849319
690 2776257768
691 2828308681
692 2841912325
693 2841919906
694 2904707824
695 641646583
696 8002060904

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01722

BolA

BolA-like protein

21

98

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4pug-assembly2.cif.gz_B bola1 from arabidopsis thaliana 0.9494 1 89
4pui-assembly2.cif.gz_B bola domain of sufe1 from arabidopsis thaliana 0.9488 1 88
4pui-assembly1.cif.gz_A bola domain of sufe1 from arabidopsis thaliana 0.9278 1 88
4pug-assembly2.cif.gz_B bola1 from arabidopsis thaliana 0.9167 1 89
4pui-assembly2.cif.gz_B bola domain of sufe1 from arabidopsis thaliana 0.9063 1 88
ID Description Score Start End Superfamily
af_Q8I3V0_1_83_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.9517 1 86 3.10.20.90
af_Q5AKW1_24_116_3.30.300.90 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.9457 3 86 3.30.300.90
af_Q54G84_40_127_3.30.300.90 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.9381 3 86 3.30.300.90
af_P39724_22_112_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.9363 1 85 3.10.20.90
4puiA01 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.9327 5 88 3.30.300.90
ID Description Score Start End GO Terms
AF-A0A2E3XD41-F1-model_v4 BolA family transcriptional regulator 0.9826 1 86 GO:0016226
AF-A0A2H6B222-F1-model_v4 DNA-binding transcriptional regulator BolA 0.9821 3 86 GO:0003677
GO:0016226
AF-A0A2E0H1G4-F1-model_v4 BolA family transcriptional regulator 0.9794 2 89 GO:0016226
AF-A0A515KHH2-F1-model_v4 BolA family transcriptional regulator 0.9785 1 88
AF-A0A389MTY1-F1-model_v4 BolA family transcriptional regulator 0.9769 3 88 GO:0016226

Map