F417377

General Info

Members Datasets Scaffolds Average Seq Length
348 222 696 161

Family's Representative Sequence

Representative Sequence 3300005288|Ga0065714_10064426|Ga0065714_10064426166
Length 179
Sequence LSRGIEASGRPATIKLMPQKEHTLTISWKDPRVLVEAGRGLSGLEFLRKIVAGELPPPPIASLMNFDLVELHEGGATFAVNPAEYHYNPIGVVHGGLAATLLDSAMGCAIHSTLPAGAGYTTLEIKVNFVRAMTAETGRVRCEAKVIHVGGRTATAEGRIVDEAGKLYAHGTTTCLVLR

Samples

Sample ID Description Type Environment
1 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
64 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
65 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
68 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
69 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
70 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
71 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
76 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
137 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
138 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
139 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
140 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
141 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
142 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
143 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
144 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
145 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
146 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
147 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
148 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
149 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
150 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
151 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
152 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
153 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
154 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
155 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
156 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
157 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
158 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
159 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
160 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
161 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
162 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
163 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
164 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
165 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
166 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
167 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
168 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
169 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
170 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
171 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
172 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
173 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
174 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
175 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
176 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
177 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
178 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
179 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
180 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
181 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
182 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
183 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
184 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
190 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
191 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
192 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
193 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
194 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
195 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
196 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
197 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
198 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
199 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
200 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
202 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
203 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
204 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
205 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
206 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
207 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
208 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
209 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
210 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
211 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
212 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
213 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
214 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
215 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
216 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
217 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
218 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
219 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
220 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
221 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
222 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.7
Nodule 0
Rhizoplane 2.01
Rhizosphere 73.56
Stem 0
Stem Tuber 0
Unclassified 8.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065714_10064426 3300005288 Bacteria 186606
2 MRS1b_contig_2652586 2162886011 Bacteria 1796
3 rootL2_10219668 3300003322 Bacteria 2470
4 Ga0065704_10108933 3300005289 Bacteria 2016
5 Ga0065712_10067761 3300005290 Bacteria 50583
6 Ga0065715_10088939 3300005293 Bacteria 22796
7 Ga0070658_10014131 3300005327 Bacteria 6410
8 Ga0070676_10118568 3300005328 Bacteria 1658
9 Ga0070683_100023834 3300005329 Bacteria 5478
10 Ga0070690_100170686 3300005330 Bacteria 1497
11 Ga0070670_100098049 3300005331 Bacteria 2522
12 Ga0070680_100003334 3300005336 Bacteria 11980
13 Ga0070689_101667681 3300005340 Bacteria 580
14 Ga0070691_10048567 3300005341 Bacteria 2020
15 Ga0070691_10065874 3300005341 Bacteria 1750
16 Ga0070687_100371746 3300005343 Bacteria 929
17 Ga0070661_100025663 3300005344 Bacteria 4236
18 Ga0070692_10041370 3300005345 Bacteria 2360
19 Ga0070692_10136259 3300005345 Bacteria 1385
20 Ga0070669_100042809 3300005353 Bacteria 3296
21 Ga0070675_100299256 3300005354 Bacteria 1417
22 Ga0070674_100496347 3300005356 Bacteria 1016
23 Ga0070688_100274455 3300005365 Bacteria 1209
24 Ga0070659_100044743 3300005366 Bacteria 3467
25 Ga0070659_100117838 3300005366 Bacteria 2148
26 Ga0070709_10103953 3300005434 Bacteria 1897
27 Ga0070713_100279710 3300005436 Bacteria 1531
28 Ga0070713_101791390 3300005436 Bacteria 596
29 Ga0070701_10959480 3300005438 Bacteria 594
30 Ga0070711_101253442 3300005439 Unclassified 642
31 Ga0070700_100008408 3300005441 Bacteria 5621
32 Ga0070700_100122806 3300005441 Bacteria 1743
33 Ga0070694_100040552 3300005444 Bacteria 3104
34 Ga0070708_100028418 3300005445 Unclassified 4812
35 Ga0070708_100374998 3300005445 Bacteria 1341
36 Ga0070708_100462564 3300005445 Unclassified 1197
37 Ga0070663_101351691 3300005455 Bacteria 630
38 Ga0070681_10858164 3300005458 Bacteria 826
39 Ga0068867_100102965 3300005459 Bacteria 2183
40 Ga0070706_100131521 3300005467 Unclassified 2335
41 Ga0070707_100313963 3300005468 Bacteria 1523
42 Ga0070698_100008651 3300005471 Bacteria 10970
43 Ga0070698_100209098 3300005471 Bacteria 1886
44 Ga0070698_100672543 3300005471 Bacteria 977
45 Ga0070699_100016031 3300005518 Bacteria 6434
46 Ga0070699_100042678 3300005518 Unclassified 3925
47 Ga0070699_100131612 3300005518 Bacteria 2205
48 Ga0070679_100038634 3300005530 Bacteria 4746
49 Ga0070684_100025513 3300005535 Bacteria 4970
50 Ga0068853_100084415 3300005539 Bacteria 2782
51 Ga0068853_100744797 3300005539 Unclassified 936
52 Ga0070672_101372056 3300005543 Bacteria 632
53 Ga0070686_100490038 3300005544 Bacteria 952
54 Ga0070686_100966297 3300005544 Bacteria 697
55 Ga0070695_100304528 3300005545 Bacteria 1179
56 Ga0070696_100205428 3300005546 Bacteria 1472
57 Ga0070665_100063674 3300005548 Bacteria 3698
58 Ga0070665_100608105 3300005548 Bacteria 1106
59 Ga0070704_100657832 3300005549 Bacteria 925
60 Ga0068855_100051713 3300005563 Bacteria 4839
61 Ga0068855_100377354 3300005563 Bacteria 1557
62 Ga0070664_100040248 3300005564 Bacteria 3940
63 Ga0068857_100066942 3300005577 Bacteria 3196
64 Ga0068854_100907383 3300005578 Bacteria 775
65 Ga0068856_100031654 3300005614 Bacteria 5176
66 Ga0068856_100597240 3300005614 Bacteria 1125
67 Ga0070702_100030270 3300005615 Bacteria 2950
68 Ga0068852_100160851 3300005616 Bacteria 2097
69 Ga0068852_100196641 3300005616 Bacteria 1906
70 Ga0068859_100019075 3300005617 Bacteria 6887
71 Ga0068859_100078936 3300005617 Bacteria 3332
72 Ga0068859_100169997 3300005617 Bacteria 2260
73 Ga0068859_100245563 3300005617 Bacteria 1880
74 Ga0068861_101124722 3300005719 Bacteria 756
75 Ga0068851_10174916 3300005834 Bacteria 1186
76 Ga0068863_100387185 3300005841 Bacteria 1366
77 Ga0068863_100997710 3300005841 Bacteria 840
78 Ga0068858_100039660 3300005842 Bacteria 4367
79 Ga0068858_100455623 3300005842 Bacteria 1233
80 Ga0068858_101170089 3300005842 Bacteria 756
81 Ga0068860_100168736 3300005843 Bacteria 2113
82 Ga0068860_100250434 3300005843 Bacteria 1725
83 Ga0068862_100806803 3300005844 Unclassified 917
84 Ga0068862_100845542 3300005844 Bacteria 896
85 Ga0081455_10001730 3300005937 Bacteria 26441
86 Ga0081455_10066289 3300005937 Bacteria 3016
87 Ga0081455_10270913 3300005937 Bacteria 1231
88 Ga0081538_10083105 3300005981 Bacteria 1694
89 Ga0081539_10002297 3300005985 Bacteria 27637
90 Ga0081539_10147980 3300005985 Bacteria 1133
91 Ga0075365_10014060 3300006038 Bacteria 4806
92 Ga0075365_10042069 3300006038 Bacteria 2986
93 Ga0075365_10080184 3300006038 Bacteria 2210
94 Ga0075365_10220231 3300006038 Bacteria 1331
95 Ga0075365_10348156 3300006038 Bacteria 1044
96 Ga0075368_10020042 3300006042 Bacteria 2529
97 Ga0075368_10074626 3300006042 Bacteria 1374
98 Ga0075363_100041092 3300006048 Bacteria 2439
99 Ga0075363_100051711 3300006048 Bacteria 2192
100 Ga0075363_100177244 3300006048 Bacteria 1212
101 Ga0075363_100211565 3300006048 Bacteria 1110
102 Ga0075363_100771319 3300006048 Bacteria 584
103 Ga0075364_10007534 3300006051 Bacteria 6471
104 Ga0075362_10010023 3300006177 Bacteria 3685
105 Ga0075362_10047895 3300006177 Bacteria 1905
106 Ga0075362_10061100 3300006177 Bacteria 1704
107 Ga0075362_10144537 3300006177 Bacteria 1138
108 Ga0075362_10179537 3300006177 Bacteria 1025
109 Ga0075362_10198379 3300006177 Bacteria 976
110 Ga0075362_10268747 3300006177 Bacteria 841
111 Ga0075367_10004468 3300006178 Bacteria 6834
112 Ga0075367_10009424 3300006178 Bacteria 5103
113 Ga0075367_10015729 3300006178 Bacteria 4118
114 Ga0075367_10043909 3300006178 Bacteria 2618
115 Ga0075367_10097760 3300006178 Bacteria 1791
116 Ga0075367_10410859 3300006178 Bacteria 856
117 Ga0075369_10010747 3300006186 Bacteria 3586
118 Ga0075369_10085255 3300006186 Bacteria 1405
119 Ga0075366_10041370 3300006195 Bacteria 2728
120 Ga0075366_10174294 3300006195 Bacteria 1305
121 Ga0075366_10232011 3300006195 Bacteria 1124
122 Ga0075366_10263280 3300006195 Bacteria 1052
123 Ga0075370_10062687 3300006353 Unclassified 2118
124 Ga0075370_10144676 3300006353 Bacteria 1391
125 Ga0075370_10170171 3300006353 Bacteria 1280
126 Ga0075370_10174662 3300006353 Bacteria 1263
127 Ga0075428_100254760 3300006844 Bacteria 1891
128 Ga0075431_100750414 3300006847 Unclassified 951
129 Ga0097620_100019076 3300006931 Bacteria 6887
130 Ga0097620_100078934 3300006931 Bacteria 3332
131 Ga0097620_100169995 3300006931 Bacteria 2260
132 Ga0097620_100245562 3300006931 Bacteria 1880
133 Ga0099794_10039260 3300007265 Bacteria 2246
134 Ga0099795_10199236 3300007788 Bacteria 844
135 Ga0105240_10125389 3300009093 Bacteria 3086
136 Ga0105245_10560404 3300009098 Bacteria 1165
137 Ga0105245_10711407 3300009098 Unclassified 1038
138 Ga0114129_10092602 3300009147 Bacteria 4187
139 Ga0105243_10546672 3300009148 Bacteria 1106
140 Ga0105241_10249896 3300009174 Bacteria 1503
141 Ga0105241_10734969 3300009174 Bacteria 904
142 Ga0105241_10956429 3300009174 Unclassified 799
143 Ga0105237_10393984 3300009545 Bacteria 1390
144 Ga0105238_10083464 3300009551 Bacteria 3184
145 Ga0105238_10136775 3300009551 Bacteria 2428
146 Ga0105249_10686138 3300009553 Bacteria 1083
147 Ga0105239_10289468 3300010375 Bacteria 1845
148 Ga0105239_11643556 3300010375 Bacteria 743
149 Ga0105246_10717613 3300011119 Bacteria 878
150 Ga0157373_10095770 3300013100 Bacteria 2090
151 Ga0157369_10056505 3300013105 Bacteria 4235
152 Ga0157374_10282675 3300013296 Bacteria 1638
153 Ga0157378_13053327 3300013297 Bacteria 520
154 Ga0163162_10050853 3300013306 Unclassified 4156
155 Ga0163162_10497629 3300013306 Bacteria 1349
156 Ga0157372_10007212 3300013307 Bacteria 11837
157 Ga0157375_10082741 3300013308 Bacteria 3253
158 Ga0157375_10090993 3300013308 Unclassified 3111
159 Ga0163163_12871298 3300014325 Bacteria 538
160 Ga0157380_11008993 3300014326 Bacteria 866
161 Ga0182008_10088959 3300014497 Bacteria 1522
162 Ga0157377_10441165 3300014745 Bacteria 896
163 Ga0157379_12179345 3300014968 Bacteria 550
164 Ga0157376_10609769 3300014969 Bacteria 1087
165 Ga0157376_10784874 3300014969 Bacteria 964
166 Ga0157376_11040513 3300014969 Bacteria 843
167 Ga0163161_11670559 3300017792 Unclassified 563
168 Ga0207426_1010804 3300025302 Bacteria 3523
169 Ga0207426_1025108 3300025302 Bacteria 2011
170 Ga0207647_10122254 3300025904 Bacteria 1534
171 Ga0207699_10060952 3300025906 Bacteria 2268
172 Ga0207705_10031183 3300025909 Bacteria 3803
173 Ga0207684_10071093 3300025910 Bacteria 2957
174 Ga0207684_10816559 3300025910 Unclassified 788
175 Ga0207707_10043085 3300025912 Bacteria 3938
176 Ga0207707_10265135 3300025912 Unclassified 1490
177 Ga0207695_10065323 3300025913 Bacteria 3741
178 Ga0207695_10105510 3300025913 Bacteria 2805
179 Ga0207671_10007698 3300025914 Bacteria 9299
180 Ga0207671_10393266 3300025914 Bacteria 1102
181 Ga0207663_10954054 3300025916 Unclassified 687
182 Ga0207660_10380592 3300025917 Bacteria 1134
183 Ga0207660_10561306 3300025917 Bacteria 929
184 Ga0207662_10374775 3300025918 Bacteria 960
185 Ga0207649_10054165 3300025920 Bacteria 2496
186 Ga0207652_10021553 3300025921 Bacteria 5318
187 Ga0207650_10120572 3300025925 Bacteria 2041
188 Ga0207650_10799167 3300025925 Bacteria 799
189 Ga0207659_10523284 3300025926 Bacteria 1006
190 Ga0207659_10617005 3300025926 Bacteria 925
191 Ga0207687_10081862 3300025927 Bacteria 2334
192 Ga0207700_10541767 3300025928 Bacteria 1032
193 Ga0207690_10029654 3300025932 Bacteria 3482
194 Ga0207669_10779036 3300025937 Bacteria 792
195 Ga0207691_10424231 3300025940 Bacteria 1133
196 Ga0207661_10054115 3300025944 Bacteria 3214
197 Ga0207661_10532665 3300025944 Bacteria 1075
198 Ga0207679_10025274 3300025945 Bacteria 4081
199 Ga0207667_10544185 3300025949 Bacteria 1175
200 Ga0207651_10699039 3300025960 Bacteria 893
201 Ga0207668_11228887 3300025972 Bacteria 674
202 Ga0207640_10178924 3300025981 Unclassified 1588
203 Ga0207639_10291987 3300026041 Bacteria 1438
204 Ga0207639_10309880 3300026041 Bacteria 1398
205 Ga0207702_10015599 3300026078 Bacteria 6288
206 Ga0207676_11220080 3300026095 Unclassified 746
207 Ga0207675_100233257 3300026118 Bacteria 1776
208 Ga0207675_100404983 3300026118 Bacteria 1345
209 Ga0207683_10551655 3300026121 Bacteria 1066
210 Ga0209813_10141519 3300027866 Bacteria 854
211 Ga0268266_10061983 3300028379 Bacteria 3226
212 Ga0268266_10155200 3300028379 Bacteria 2067
213 Ga0268265_10491987 3300028380 Bacteria 1154
214 Ga0268264_11121442 3300028381 Bacteria 795
215 Ga0265334_10013405 3300028573 Bacteria 3434
216 Ga0265340_10040628 3300031247 Bacteria 2291
217 Ga0265314_10139772 3300031711 Bacteria 1499
218 Ga0265342_10295315 3300031712 Bacteria 855
219 Ga0307405_10657597 3300031731 Bacteria 863
220 Ga0307405_11038480 3300031731 Unclassified 701
221 Ga0307413_10598113 3300031824 Bacteria 902
222 Ga0307406_10159168 3300031901 Bacteria 1621
223 Ga0307416_100696037 3300032002 Unclassified 1105
224 Ga0307414_10318527 3300032004 Unclassified 1323
225 Ga0307411_11314999 3300032005 Unclassified 659
226 Ga0307415_100166058 3300032126 Bacteria 1716
227 Ga0373926_0222024 3300035083 Archaea 730
228 Ga0373928_0085418 3300035084 Bacteria 802
229 Ga0373932_0019579 3300035112 Bacteria 1766
230 Ga0373943_0246770 3300035170 Bacteria 1002
231 Ga0373931_0042272 3300035691 Bacteria 2396
232 Ga0373927_0355347 3300035695 Bacteria 966
233 Ga0373947_0158910 3300035725 Bacteria 1460
234 Ga0373947_0839193 3300035725 Bacteria 627
235 Ga0373937_0113604 3300036401 Bacteria 2520
236 Ga0373925_0287678 3300037068 Bacteria 1325
237 Ga0395899_0002857 3300037312 Bacteria 13889
238 Ga0395899_0012450 3300037312 Bacteria 6517
239 Ga0395899_0288071 3300037312 Bacteria 1115
240 Ga0395900_0002549 3300037418 Bacteria 19963
241 Ga0395900_0006267 3300037418 Bacteria 12412
242 Ga0395900_0091997 3300037418 Bacteria 3116
243 Ga0395900_0136706 3300037418 Bacteria 2511
244 Ga0395898_0005884 3300037466 Bacteria 13184
245 Ga0395898_0049633 3300037466 Bacteria 4111
246 Ga0395905_0243989 3300037471 Bacteria 1678
247 Ga0395901_0001400 3300038443 Bacteria 25196
248 Ga0395901_0003670 3300038443 Bacteria 15482
249 Ga0395901_0010080 3300038443 Bacteria 9575
250 Ga0395901_0220756 3300038443 Bacteria 1981
251 Ga0436365_0988300 3300039437 Bacteria 1233
252 Ga0436360_1140185 3300039438 Bacteria 1892
253 Ga0439465_0194647 3300041413 Bacteria 737
254 Ga0451791_1610370 3300041451 Bacteria 1746
255 Ga0451793_0738410 3300041452 Bacteria 1223
256 Ga0451802_1785587 3300041460 Unclassified 882
257 Ga0451804_0124339 3300041463 Bacteria 1516
258 Ga0451807_1863881 3300041486 Unclassified 687
259 Ga0451837_1421889 3300041494 Bacteria 1099
260 Ga0451849_0626414 3300041505 Bacteria 912
261 Ga0439448_0053389 3300042005 Bacteria 1326
262 Ga0439458_0062559 3300042157 Bacteria 931
263 Ga0453684_0212456 3300044712 Bacteria 2248
264 Ga0466957_0755217 3300044842 Unclassified 689
265 Ga0466960_0104574 3300044901 Bacteria 1463
266 Ga0451576_1307360 3300045051 Bacteria 756
267 Ga0466967_0156293 3300045976 Bacteria 2136
268 Ga0466967_0328528 3300045976 Bacteria 1476
269 Ga0466967_1184924 3300045976 Bacteria 761
270 Ga0495629_0754987 3300046459 Bacteria 644
271 Ga0495647_0170509 3300046681 Bacteria 942
272 Ga0496104_0486094 3300048907 Bacteria 1146
273 Ga0496112_0420931 3300048915 Bacteria 1275
274 Ga0496120_0160121 3300048923 Bacteria 1123
275 Ga0496126_0026183 3300048929 Bacteria 5597
276 Ga0501032_0438195 3300049569 Bacteria 838
277 Ga0501034_0001800 3300049571 Bacteria 27358
278 Ga0501034_0007022 3300049571 Bacteria 12011
279 Ga0501034_0219902 3300049571 Bacteria 1852
280 Ga0501034_1116070 3300049571 Bacteria 669
281 Ga0501034_1273793 3300049571 Bacteria 612
282 Ga0501034_1391074 3300049571 Bacteria 577
283 Ga0501037_0155040 3300049573 Bacteria 1635
284 Ga0501038_0585402 3300049574 Bacteria 846
285 Ga0501047_0026598 3300049581 Bacteria 5568
286 Ga0501047_0246091 3300049581 Bacteria 1637
287 Ga0501068_0000930 3300049584 Bacteria 15380
288 Ga0501070_0067500 3300049586 Bacteria 2962
289 Ga0501070_0185374 3300049586 Bacteria 1712
290 Ga0501072_0231446 3300049588 Bacteria 1472
291 Ga0501076_0470152 3300049592 Bacteria 1036
292 Ga0501217_002968 3300049661 Bacteria 3395
293 Ga0501227_029256 3300049665 Bacteria 1313
294 Ga0501233_002907 3300049668 Bacteria 3055
295 Ga0501235_006386 3300049669 Bacteria 2567
296 Ga0501225_0042438 3300049705 Bacteria 1256
297 Ga0501080_0464955 3300049742 Bacteria 1133
298 Ga0501268_035510 3300049765 Unclassified 920
299 Ga0501044_0074848 3300049823 Bacteria 3439
300 Ga0501044_0213097 3300049823 Bacteria 1885
301 Ga0501044_0228774 3300049823 Bacteria 1808
302 Ga0501212_011779 3300049851 Bacteria 1265
303 nmdc:mga03683_102128_c1 3300050489 Bacteria 1261
304 nmdc:mga03683_17114_c1 3300050489 Bacteria 2738
305 nmdc:mga03683_260635_c1 3300050489 Bacteria 807
306 nmdc:mga03683_26922_c1 3300050489 Bacteria 2273
307 nmdc:mga03683_311_c2 3300050489 Bacteria 12270
308 nmdc:mga03683_325632_c1 3300050489 Bacteria 724
309 nmdc:mga03683_367980_c1 3300050489 Bacteria 683
310 nmdc:mga03683_490763_c1 3300050489 Bacteria 594
311 nmdc:mga03n38_204589_c1 3300050490 Bacteria 1023
312 nmdc:mga03n38_50502_c1 3300050490 Bacteria 1854
313 nmdc:mga0yw44_243827_c2 3300050492 Bacteria 656
314 nmdc:mga0yw44_271083_c1 3300050492 Bacteria 1133
315 nmdc:mga0yw44_30438_c1 3300050492 Bacteria 3128
316 nmdc:mga0yw44_304833_c1 3300050492 Bacteria 1068
317 nmdc:mga0yw44_365582_c1 3300050492 Bacteria 973
318 nmdc:mga0yw44_501173_c1 3300050492 Bacteria 824
319 nmdc:mga0yw44_590201_c1 3300050492 Bacteria 755
320 nmdc:mga0k408_368514_c1 3300050493 Bacteria 856
321 nmdc:mga0k408_4330_c1 3300050493 Bacteria 7538
322 nmdc:mga0k408_45436_c2 3300050493 Bacteria 1764
323 nmdc:mga06z11_14332_c1 3300050494 Bacteria 3509
324 nmdc:mga06z11_16919_c1 3300050494 Bacteria 2963
325 nmdc:mga06z11_53780_c1 3300050494 Bacteria 2072
326 nmdc:mga04h51_89544_c1 3300050495 Bacteria 1105
327 nmdc:mga07m45_175225_c1 3300050496 Bacteria 1247
328 nmdc:mga07m45_220471_c1 3300050496 Bacteria 1103
329 nmdc:mga07m45_49014_c1 3300050496 Bacteria 2376
330 nmdc:mga07m45_78814_c1 3300050496 Bacteria 1880
331 nmdc:mga05p37_176458_c1 3300050507 Bacteria 2603
332 nmdc:mga05p37_49914_c1 3300050507 Bacteria 5146
333 nmdc:mga06r32_577637_c1 3300050510 Unclassified 1096
334 nmdc:mga08y16_250688_c1 3300050511 Bacteria 1829
335 nmdc:mga0n895_1828725_c1 3300050512 Bacteria 567
336 nmdc:mga0sz30_1065_c1 3300050516 Bacteria 9894
337 nmdc:mga0sz30_142099_c1 3300050516 Bacteria 1060
338 nmdc:mga0sz30_383794_c1 3300050516 Bacteria 629
339 nmdc:mga0sz30_63340_c1 3300050516 Bacteria 1583
340 Ga0500644_0010522 3300053088 Bacteria 2507
341 Ga0500647_0110490 3300053091 Bacteria 1307
342 Ga0500651_0081108 3300053093 Bacteria 2009
343 Ga0500641_0000437 3300053096 Bacteria 15110
344 Ga0500595_146658 3300053119 Bacteria 660
345 Ga0500616_0001240 3300053153 Bacteria 25589
346 Ga0500620_031399 3300053155 Bacteria 1684
347 Ga0500611_087812 3300053727 Bacteria 787
348 Ga0501082_0976490 3300060353 Bacteria 741
349 Ga0065714_10064426
350 MRS1b_contig_2652586
351 rootL2_10219668
352 Ga0065704_10108933
353 Ga0065712_10067761
354 Ga0065715_10088939
355 Ga0070658_10014131
356 Ga0070676_10118568
357 Ga0070683_100023834
358 Ga0070690_100170686
359 Ga0070670_100098049
360 Ga0070680_100003334
361 Ga0070689_101667681
362 Ga0070691_10048567
363 Ga0070691_10065874
364 Ga0070687_100371746
365 Ga0070661_100025663
366 Ga0070692_10041370
367 Ga0070692_10136259
368 Ga0070669_100042809
369 Ga0070675_100299256
370 Ga0070674_100496347
371 Ga0070688_100274455
372 Ga0070659_100044743
373 Ga0070659_100117838
374 Ga0070709_10103953
375 Ga0070713_100279710
376 Ga0070713_101791390
377 Ga0070701_10959480
378 Ga0070711_101253442
379 Ga0070700_100008408
380 Ga0070700_100122806
381 Ga0070694_100040552
382 Ga0070708_100028418
383 Ga0070708_100374998
384 Ga0070708_100462564
385 Ga0070663_101351691
386 Ga0070681_10858164
387 Ga0068867_100102965
388 Ga0070706_100131521
389 Ga0070707_100313963
390 Ga0070698_100008651
391 Ga0070698_100209098
392 Ga0070698_100672543
393 Ga0070699_100016031
394 Ga0070699_100042678
395 Ga0070699_100131612
396 Ga0070679_100038634
397 Ga0070684_100025513
398 Ga0068853_100084415
399 Ga0068853_100744797
400 Ga0070672_101372056
401 Ga0070686_100490038
402 Ga0070686_100966297
403 Ga0070695_100304528
404 Ga0070696_100205428
405 Ga0070665_100063674
406 Ga0070665_100608105
407 Ga0070704_100657832
408 Ga0068855_100051713
409 Ga0068855_100377354
410 Ga0070664_100040248
411 Ga0068857_100066942
412 Ga0068854_100907383
413 Ga0068856_100031654
414 Ga0068856_100597240
415 Ga0070702_100030270
416 Ga0068852_100160851
417 Ga0068852_100196641
418 Ga0068859_100019075
419 Ga0068859_100078936
420 Ga0068859_100169997
421 Ga0068859_100245563
422 Ga0068861_101124722
423 Ga0068851_10174916
424 Ga0068863_100387185
425 Ga0068863_100997710
426 Ga0068858_100039660
427 Ga0068858_100455623
428 Ga0068858_101170089
429 Ga0068860_100168736
430 Ga0068860_100250434
431 Ga0068862_100806803
432 Ga0068862_100845542
433 Ga0081455_10001730
434 Ga0081455_10066289
435 Ga0081455_10270913
436 Ga0081538_10083105
437 Ga0081539_10002297
438 Ga0081539_10147980
439 Ga0075365_10014060
440 Ga0075365_10042069
441 Ga0075365_10080184
442 Ga0075365_10220231
443 Ga0075365_10348156
444 Ga0075368_10020042
445 Ga0075368_10074626
446 Ga0075363_100041092
447 Ga0075363_100051711
448 Ga0075363_100177244
449 Ga0075363_100211565
450 Ga0075363_100771319
451 Ga0075364_10007534
452 Ga0075362_10010023
453 Ga0075362_10047895
454 Ga0075362_10061100
455 Ga0075362_10144537
456 Ga0075362_10179537
457 Ga0075362_10198379
458 Ga0075362_10268747
459 Ga0075367_10004468
460 Ga0075367_10009424
461 Ga0075367_10015729
462 Ga0075367_10043909
463 Ga0075367_10097760
464 Ga0075367_10410859
465 Ga0075369_10010747
466 Ga0075369_10085255
467 Ga0075366_10041370
468 Ga0075366_10174294
469 Ga0075366_10232011
470 Ga0075366_10263280
471 Ga0075370_10062687
472 Ga0075370_10144676
473 Ga0075370_10170171
474 Ga0075370_10174662
475 Ga0075428_100254760
476 Ga0075431_100750414
477 Ga0097620_100019076
478 Ga0097620_100078934
479 Ga0097620_100169995
480 Ga0097620_100245562
481 Ga0099794_10039260
482 Ga0099795_10199236
483 Ga0105240_10125389
484 Ga0105245_10560404
485 Ga0105245_10711407
486 Ga0114129_10092602
487 Ga0105243_10546672
488 Ga0105241_10249896
489 Ga0105241_10734969
490 Ga0105241_10956429
491 Ga0105237_10393984
492 Ga0105238_10083464
493 Ga0105238_10136775
494 Ga0105249_10686138
495 Ga0105239_10289468
496 Ga0105239_11643556
497 Ga0105246_10717613
498 Ga0157373_10095770
499 Ga0157369_10056505
500 Ga0157374_10282675
501 Ga0157378_13053327
502 Ga0163162_10050853
503 Ga0163162_10497629
504 Ga0157372_10007212
505 Ga0157375_10082741
506 Ga0157375_10090993
507 Ga0163163_12871298
508 Ga0157380_11008993
509 Ga0182008_10088959
510 Ga0157377_10441165
511 Ga0157379_12179345
512 Ga0157376_10609769
513 Ga0157376_10784874
514 Ga0157376_11040513
515 Ga0163161_11670559
516 Ga0207426_1010804
517 Ga0207426_1025108
518 Ga0207647_10122254
519 Ga0207699_10060952
520 Ga0207705_10031183
521 Ga0207684_10071093
522 Ga0207684_10816559
523 Ga0207707_10043085
524 Ga0207707_10265135
525 Ga0207695_10065323
526 Ga0207695_10105510
527 Ga0207671_10007698
528 Ga0207671_10393266
529 Ga0207663_10954054
530 Ga0207660_10380592
531 Ga0207660_10561306
532 Ga0207662_10374775
533 Ga0207649_10054165
534 Ga0207652_10021553
535 Ga0207650_10120572
536 Ga0207650_10799167
537 Ga0207659_10523284
538 Ga0207659_10617005
539 Ga0207687_10081862
540 Ga0207700_10541767
541 Ga0207690_10029654
542 Ga0207669_10779036
543 Ga0207691_10424231
544 Ga0207661_10054115
545 Ga0207661_10532665
546 Ga0207679_10025274
547 Ga0207667_10544185
548 Ga0207651_10699039
549 Ga0207668_11228887
550 Ga0207640_10178924
551 Ga0207639_10291987
552 Ga0207639_10309880
553 Ga0207702_10015599
554 Ga0207676_11220080
555 Ga0207675_100233257
556 Ga0207675_100404983
557 Ga0207683_10551655
558 Ga0209813_10141519
559 Ga0268266_10061983
560 Ga0268266_10155200
561 Ga0268265_10491987
562 Ga0268264_11121442
563 Ga0265334_10013405
564 Ga0265340_10040628
565 Ga0265314_10139772
566 Ga0265342_10295315
567 Ga0307405_10657597
568 Ga0307405_11038480
569 Ga0307413_10598113
570 Ga0307406_10159168
571 Ga0307416_100696037
572 Ga0307414_10318527
573 Ga0307411_11314999
574 Ga0307415_100166058
575 Ga0373926_0222024
576 Ga0373928_0085418
577 Ga0373932_0019579
578 Ga0373943_0246770
579 Ga0373931_0042272
580 Ga0373927_0355347
581 Ga0373947_0158910
582 Ga0373947_0839193
583 Ga0373937_0113604
584 Ga0373925_0287678
585 Ga0395899_0002857
586 Ga0395899_0012450
587 Ga0395899_0288071
588 Ga0395900_0002549
589 Ga0395900_0006267
590 Ga0395900_0091997
591 Ga0395900_0136706
592 Ga0395898_0005884
593 Ga0395898_0049633
594 Ga0395905_0243989
595 Ga0395901_0001400
596 Ga0395901_0003670
597 Ga0395901_0010080
598 Ga0395901_0220756
599 Ga0436365_0988300
600 Ga0436360_1140185
601 Ga0439465_0194647
602 Ga0451791_1610370
603 Ga0451793_0738410
604 Ga0451802_1785587
605 Ga0451804_0124339
606 Ga0451807_1863881
607 Ga0451837_1421889
608 Ga0451849_0626414
609 Ga0439448_0053389
610 Ga0439458_0062559
611 Ga0453684_0212456
612 Ga0466957_0755217
613 Ga0466960_0104574
614 Ga0451576_1307360
615 Ga0466967_0156293
616 Ga0466967_0328528
617 Ga0466967_1184924
618 Ga0495629_0754987
619 Ga0495647_0170509
620 Ga0496104_0486094
621 Ga0496112_0420931
622 Ga0496120_0160121
623 Ga0496126_0026183
624 Ga0501032_0438195
625 Ga0501034_0001800
626 Ga0501034_0007022
627 Ga0501034_0219902
628 Ga0501034_1116070
629 Ga0501034_1273793
630 Ga0501034_1391074
631 Ga0501037_0155040
632 Ga0501038_0585402
633 Ga0501047_0026598
634 Ga0501047_0246091
635 Ga0501068_0000930
636 Ga0501070_0067500
637 Ga0501070_0185374
638 Ga0501072_0231446
639 Ga0501076_0470152
640 Ga0501217_002968
641 Ga0501227_029256
642 Ga0501233_002907
643 Ga0501235_006386
644 Ga0501225_0042438
645 Ga0501080_0464955
646 Ga0501268_035510
647 Ga0501044_0074848
648 Ga0501044_0213097
649 Ga0501044_0228774
650 Ga0501212_011779
651 nmdc:mga03683_102128_c1
652 nmdc:mga03683_17114_c1
653 nmdc:mga03683_260635_c1
654 nmdc:mga03683_26922_c1
655 nmdc:mga03683_311_c2
656 nmdc:mga03683_325632_c1
657 nmdc:mga03683_367980_c1
658 nmdc:mga03683_490763_c1
659 nmdc:mga03n38_204589_c1
660 nmdc:mga03n38_50502_c1
661 nmdc:mga0yw44_243827_c2
662 nmdc:mga0yw44_271083_c1
663 nmdc:mga0yw44_30438_c1
664 nmdc:mga0yw44_304833_c1
665 nmdc:mga0yw44_365582_c1
666 nmdc:mga0yw44_501173_c1
667 nmdc:mga0yw44_590201_c1
668 nmdc:mga0k408_368514_c1
669 nmdc:mga0k408_4330_c1
670 nmdc:mga0k408_45436_c2
671 nmdc:mga06z11_14332_c1
672 nmdc:mga06z11_16919_c1
673 nmdc:mga06z11_53780_c1
674 nmdc:mga04h51_89544_c1
675 nmdc:mga07m45_175225_c1
676 nmdc:mga07m45_220471_c1
677 nmdc:mga07m45_49014_c1
678 nmdc:mga07m45_78814_c1
679 nmdc:mga05p37_176458_c1
680 nmdc:mga05p37_49914_c1
681 nmdc:mga06r32_577637_c1
682 nmdc:mga08y16_250688_c1
683 nmdc:mga0n895_1828725_c1
684 nmdc:mga0sz30_1065_c1
685 nmdc:mga0sz30_142099_c1
686 nmdc:mga0sz30_383794_c1
687 nmdc:mga0sz30_63340_c1
688 Ga0500644_0010522
689 Ga0500647_0110490
690 Ga0500651_0081108
691 Ga0500641_0000437
692 Ga0500595_146658
693 Ga0500616_0001240
694 Ga0500620_031399
695 Ga0500611_087812
696 Ga0501082_0976490

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

90

169

0.94

PF13622

4HBT_3

Acyl-CoA thioesterase N-terminal domain

84

177

0.82

PF14539

DUF4442

Domain of unknown function (DUF4442)

54

177

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hmb-assembly1.cif.gz_A crystal structure of s. sahachiroi azig 0.9611 42 163
1zki-assembly1.cif.gz_B structure of conserved protein pa5202 from pseudomonas aeruginosa 0.9557 41 162
2dsl-assembly1.cif.gz_A mutant n33d structure of phenylacetic acid degradation protein paai from thermus thermophilus hb8 0.9557 42 160
3s4k-assembly1.cif.gz_A structure of a putative esterase rv1847/mt1895 from mycobacterium tuberculosis 0.9508 42 163
1wlu-assembly1.cif.gz_A crystal structure of tt0310 protein from thermus thermophilus hb8 0.9495 41 160
ID Description Score Start End Superfamily
1zkiB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9524 41 162 3.10.129.10
3s4kB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9503 42 163 3.10.129.10
1wluA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9495 41 160 3.10.129.10
4m20A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9452 42 163 3.10.129.10
4m20A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9377 42 163 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A1F4BJ79-F1-model_v4 Thioesterase domain-containing protein 0.9938 51 163 GO:0005829
GO:0061522
AF-A0A535UKC9-F1-model_v4 PaaI family thioesterase 0.9924 25 162 GO:0047617
AF-A0A2N5KNE4-F1-model_v4 Aromatic compound degradation protein PaaI 0.9919 25 163 GO:0005829
GO:0061522
AF-A0A7W9ZE49-F1-model_v4 Uncharacterized protein (TIGR00369 family) 0.9909 23 162 GO:0005829
GO:0061522
AF-A0A7W4ZJL8-F1-model_v4 Uncharacterized protein (TIGR00369 family) 0.9906 25 162 GO:0005829
GO:0061522

Map