F417275

General Info

Members Datasets Scaffolds Average Seq Length
347 222 694 104

Family's Representative Sequence

Representative Sequence 3300046665|Ga0495661_0027720|Ga0495661_0027720_1492_1836
Length 114
Sequence MIYSMTSKKTPASKRTNLPRQSDYTKPFLRDWERLSHSGRYDMTRLKEVMLLLIENSAPLPAEWQDHALHHDWDGHRECHVGGDFLLIYKIDTSVKPEAVIFARAGTHSELFSS

Samples

Sample ID Description Type Environment
1 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
13 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
16 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
17 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
18 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
19 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
20 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
21 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
22 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
23 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
24 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
25 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
26 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
27 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
28 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
29 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
30 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
31 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
32 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
33 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
34 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
35 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
36 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
37 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
38 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
39 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
40 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
42 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
57 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
58 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
62 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
63 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
64 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
65 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
66 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
67 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
68 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
69 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
70 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
71 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
72 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
73 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
74 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
75 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
76 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
77 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
78 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
79 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
80 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
81 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
82 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
83 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
84 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
85 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
86 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
87 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
88 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
89 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
90 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
91 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
92 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
93 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
94 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
95 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
96 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
97 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
98 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
99 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
100 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
101 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
102 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
103 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
104 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
105 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
106 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
107 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
108 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
109 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
110 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
111 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
112 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
113 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
114 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
115 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
116 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
117 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
118 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
119 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
120 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
121 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
122 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
123 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
124 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
125 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
126 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
127 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
128 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
129 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
130 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
131 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
132 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
133 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
134 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
135 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
136 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
137 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
138 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
139 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
140 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
141 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
142 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
143 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
144 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
145 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
146 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
147 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
148 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
149 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
150 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
151 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
152 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
153 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
154 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
155 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
156 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
157 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
158 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
159 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
160 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
161 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
162 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
163 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
164 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
165 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
166 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
167 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
168 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
169 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
170 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
172 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
173 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
174 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
175 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
176 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
177 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
178 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
179 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
180 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
181 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
182 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
183 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
184 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
185 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
186 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
187 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
188 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
189 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
190 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 2511231011 Pseudomonas sp. GM30 Isolate Nodule
194 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
195 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
196 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
197 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
198 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
199 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
200 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
201 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
202 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
203 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
204 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
205 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
206 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
207 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
208 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
209 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
210 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
211 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
212 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
213 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
214 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
215 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
216 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
217 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
218 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
219 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
220 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
221 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
222 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.91
Metatranscriptomes 1.15
Isolates 8.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.63
Nodule 2.88
Rhizoplane 1.44
Rhizosphere 80.69
Stem 0
Stem Tuber 0
Unclassified 1.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495661_0027720 3300046665 Bacteria 3633
2 MRS2a_Contig_9343 2124908027 Bacteria 3870
3 Ga0055524_1000162 3300003775 Bacteria 77486
4 Ga0065714_10036970 3300005288 Bacteria 628
5 Ga0065714_10037066 3300005288 Bacteria 626
6 Ga0065714_10150997 3300005288 Bacteria 1106
7 Ga0065704_10029546 3300005289 Bacteria 1484
8 Ga0065704_10208635 3300005289 Bacteria 1117
9 Ga0065704_10262592 3300005289 Bacteria 954
10 Ga0070683_100027346 3300005329 Bacteria 5144
11 Ga0070666_10010381 3300005335 Bacteria 5824
12 Ga0070680_100213470 3300005336 Bacteria 1628
13 Ga0070671_101031062 3300005355 Bacteria 721
14 Ga0070708_101312430 3300005445 Bacteria 676
15 Ga0070681_10493036 3300005458 Bacteria 1138
16 Ga0070699_100536598 3300005518 Bacteria 1064
17 Ga0070665_100793109 3300005548 Bacteria 960
18 Ga0068855_100803453 3300005563 Bacteria 1000
19 Ga0068860_100007195 3300005843 Bacteria 11127
20 Ga0068862_100000194 3300005844 Bacteria 67126
21 Ga0075364_10000103 3300006051 Bacteria 34574
22 Ga0075364_10106881 3300006051 Bacteria 1865
23 Ga0075364_10195783 3300006051 Bacteria 1369
24 Ga0075367_10049216 3300006178 Bacteria 2484
25 Ga0075369_10023097 3300006186 Bacteria 2569
26 Ga0075370_10029161 3300006353 Bacteria 3072
27 Ga0079104_1026571 3300006946 Bacteria 1493
28 Ga0099826_10029820 3300006948 Bacteria 3969
29 Ga0105251_10040954 3300009011 Bacteria 2257
30 Ga0105250_10001349 3300009092 Bacteria 13368
31 Ga0105250_10066300 3300009092 Bacteria 1456
32 Ga0105250_10223283 3300009092 Bacteria 799
33 Ga0105247_10003639 3300009101 Bacteria 10011
34 Ga0105242_10498594 3300009176 Bacteria 1158
35 Ga0105248_10055683 3300009177 Bacteria 4437
36 Ga0105237_10327809 3300009545 Bacteria 1535
37 Ga0105249_10000135 3300009553 Bacteria 96943
38 Ga0105239_10031074 3300010375 Bacteria 5875
39 Ga0105246_10001545 3300011119 Bacteria 13661
40 Ga0105246_11137255 3300011119 Bacteria 715
41 Ga0157371_11129538 3300013102 Bacteria 602
42 Ga0157370_10250119 3300013104 Bacteria 1639
43 Ga0163162_10813511 3300013306 Bacteria 1051
44 Ga0157372_10015370 3300013307 Bacteria 8202
45 Ga0157380_10239037 3300014326 Bacteria 1636
46 Ga0182008_10002046 3300014497 Bacteria 12931
47 Ga0182006_1030363 3300015261 Bacteria 2184
48 Ga0163161_10006353 3300017792 Bacteria 8177
49 Ga0163161_10102257 3300017792 Bacteria 2134
50 Ga0163161_10180519 3300017792 Bacteria 1618
51 Ga0163161_10197219 3300017792 Bacteria 1550
52 Ga0209563_101035 3300025230 Bacteria 8076
53 Ga0209256_1000072 3300025299 Bacteria 239812
54 Ga0207696_1000221 3300025711 Bacteria 82620
55 Ga0207696_1005562 3300025711 Bacteria 5209
56 Ga0207696_1064540 3300025711 Bacteria 1025
57 Ga0207655_1004556 3300025728 Bacteria 9769
58 Ga0207655_1012236 3300025728 Bacteria 5033
59 Ga0207655_1037040 3300025728 Bacteria 2154
60 Ga0207655_1052498 3300025728 Bacteria 1639
61 Ga0207713_1027571 3300025735 Bacteria 2578
62 Ga0207710_10010065 3300025900 Bacteria 3977
63 Ga0207680_10008636 3300025903 Bacteria 5014
64 Ga0207707_10487773 3300025912 Bacteria 1052
65 Ga0207695_10732879 3300025913 Bacteria 869
66 Ga0207671_10156221 3300025914 Bacteria 1764
67 Ga0207671_10479892 3300025914 Bacteria 991
68 Ga0207709_10000096 3300025935 Bacteria 136585
69 Ga0207711_10103613 3300025941 Bacteria 2520
70 Ga0207667_10148374 3300025949 Bacteria 2414
71 Ga0207712_10000101 3300025961 Bacteria 96961
72 Ga0207712_10145220 3300025961 Bacteria 1825
73 Ga0207639_10596745 3300026041 Bacteria 1018
74 Ga0207674_10176733 3300026116 Bacteria 2087
75 Ga0209281_1016808 3300027111 Bacteria 1497
76 Ga0209281_1034556 3300027111 Bacteria 883
77 Ga0209282_1096735 3300027666 Bacteria 1531
78 Ga0268266_10573527 3300028379 Bacteria 1082
79 Ga0268266_10632860 3300028379 Bacteria 1029
80 Ga0268265_10000424 3300028380 Bacteria 45348
81 Ga0268264_10000303 3300028381 Bacteria 79730
82 Ga0316179_1100210 3300030734 Bacteria 4414
83 Ga0265327_10420060 3300031251 Bacteria 579
84 Ga0307408_100066270 3300031548 Bacteria 2651
85 Ga0307405_10125925 3300031731 Bacteria 1761
86 Ga0307406_10348024 3300031901 Bacteria 1157
87 Ga0307407_10207019 3300031903 Bacteria 1318
88 Ga0307416_102347036 3300032002 Bacteria 633
89 Ga0307414_10920145 3300032004 Bacteria 802
90 Ga0307411_10242233 3300032005 Bacteria 1412
91 Ga0316580_10015020 3300032139 Bacteria 2367
92 Ga0316588_1051532 3300033528 Bacteria 998
93 Ga0400488_09679 3300038741 Bacteria 1202
94 Ga0436361_0926828 3300039447 Bacteria 5456
95 Ga0436361_1005240 3300039447 Unclassified 1073
96 Ga0439438_001566 3300041405 Bacteria 10054
97 Ga0439447_150914 3300041407 Bacteria 534
98 Ga0439466_0050289 3300041411 Bacteria 1367
99 Ga0439466_0108909 3300041411 Bacteria 860
100 Ga0451791_1592998 3300041451 Bacteria 832
101 Ga0439432_054323 3300042006 Bacteria 1244
102 Ga0439451_019698 3300042009 Bacteria 1359
103 Ga0439452_036891 3300042010 Bacteria 1168
104 Ga0439456_024268 3300042013 Bacteria 1285
105 Ga0439456_039319 3300042013 Bacteria 1023
106 Ga0439456_164440 3300042013 Unclassified 520
107 Ga0439463_058709 3300042016 Bacteria 983
108 Ga0439463_075551 3300042016 Bacteria 864
109 Ga0450911_008828 3300042115 Bacteria 1425
110 Ga0450890_005083 3300042127 Bacteria 1699
111 Ga0450904_002743 3300042139 Bacteria 2017
112 Ga0439459_0056432 3300042438 Bacteria 876
113 Ga0450918_019804 3300042531 Bacteria 1175
114 Ga0451576_0000040 3300045051 Bacteria 349778
115 Ga0451576_0279711 3300045051 Bacteria 1745
116 Ga0495617_000960 3300046452 Bacteria 13411
117 Ga0495617_272370 3300046452 Bacteria 519
118 Ga0495627_003068 3300046453 Bacteria 7598
119 Ga0495627_011396 3300046453 Bacteria 3193
120 Ga0495627_018981 3300046453 Bacteria 2311
121 Ga0495627_211230 3300046453 Bacteria 534
122 Ga0495603_0002280 3300046455 Bacteria 11269
123 Ga0495603_0147079 3300046455 Bacteria 1369
124 Ga0495590_0008677 3300046457 Bacteria 3869
125 Ga0495591_004973 3300046458 Bacteria 6289
126 Ga0495591_006189 3300046458 Bacteria 5344
127 Ga0495591_010828 3300046458 Bacteria 3498
128 Ga0495591_011370 3300046458 Bacteria 3374
129 Ga0495638_0007825 3300046460 Bacteria 7630
130 Ga0495638_0027950 3300046460 Bacteria 3646
131 Ga0495638_0169527 3300046460 Bacteria 1253
132 Ga0495638_0254308 3300046460 Bacteria 967
133 Ga0495653_0000277 3300046463 Bacteria 41569
134 Ga0495653_0029155 3300046463 Bacteria 4409
135 Ga0495653_0066682 3300046463 Bacteria 2706
136 Ga0495650_0001735 3300046471 Bacteria 19913
137 Ga0495650_0007648 3300046471 Bacteria 6445
138 Ga0495582_0514875 3300046473 Bacteria 692
139 Ga0495605_0018643 3300046474 Bacteria 3715
140 Ga0495605_0054273 3300046474 Bacteria 1942
141 Ga0495639_0006310 3300046475 Bacteria 5094
142 Ga0495584_0001403 3300046491 Bacteria 14498
143 Ga0495584_0035783 3300046491 Bacteria 2509
144 Ga0495584_0076235 3300046491 Bacteria 1686
145 Ga0495584_0108320 3300046491 Bacteria 1405
146 Ga0495584_0120039 3300046491 Bacteria 1331
147 Ga0495585_0008995 3300046492 Bacteria 6019
148 Ga0495585_0062818 3300046492 Bacteria 2039
149 Ga0495594_0058600 3300046499 Bacteria 2128
150 Ga0495596_0113752 3300046500 Bacteria 1051
151 Ga0495607_0013133 3300046501 Bacteria 5437
152 Ga0495607_0013278 3300046501 Bacteria 5403
153 Ga0495607_0049541 3300046501 Bacteria 2449
154 Ga0495607_0265937 3300046501 Bacteria 819
155 Ga0495583_0021035 3300046506 Unclassified 3362
156 Ga0495583_0027846 3300046506 Bacteria 2784
157 Ga0495583_0031684 3300046506 Bacteria 2560
158 Ga0495606_0001011 3300046507 Bacteria 40888
159 Ga0495606_0004014 3300046507 Bacteria 15013
160 Ga0495606_0004255 3300046507 Bacteria 14452
161 Ga0495610_0008914 3300046512 Bacteria 6425
162 Ga0495610_0085297 3300046512 Bacteria 1441
163 Ga0495610_0128726 3300046512 Bacteria 1101
164 Ga0495616_0002888 3300046513 Bacteria 11215
165 Ga0495616_0178190 3300046513 Bacteria 946
166 Ga0495620_0001997 3300046515 Bacteria 11924
167 Ga0495620_0068492 3300046515 Bacteria 1457
168 Ga0495630_0512819 3300046517 Bacteria 919
169 Ga0495630_0876046 3300046517 Bacteria 684
170 Ga0495631_0002138 3300046518 Bacteria 11428
171 Ga0495631_0193092 3300046518 Bacteria 871
172 Ga0495631_0325493 3300046518 Bacteria 654
173 Ga0495632_0000656 3300046519 Bacteria 31786
174 Ga0495632_0068051 3300046519 Bacteria 1716
175 Ga0495632_0096920 3300046519 Bacteria 1392
176 Ga0495637_0000666 3300046520 Bacteria 23945
177 Ga0495637_0088895 3300046520 Bacteria 1221
178 Ga0495637_0089457 3300046520 Bacteria 1217
179 Ga0495643_0007267 3300046522 Bacteria 7160
180 Ga0495643_0269480 3300046522 Bacteria 787
181 Ga0495643_0444216 3300046522 Bacteria 565
182 Ga0495643_0465391 3300046522 Bacteria 548
183 Ga0495644_0003985 3300046523 Bacteria 5805
184 Ga0495644_0154748 3300046523 Bacteria 878
185 Ga0495648_0218533 3300046524 Bacteria 941
186 Ga0495648_0470091 3300046524 Bacteria 545
187 Ga0495648_0507847 3300046524 Unclassified 516
188 Ga0495666_0012912 3300046526 Bacteria 4162
189 Ga0495666_0440004 3300046526 Bacteria 584
190 Ga0495642_0000762 3300046528 Bacteria 15840
191 Ga0495654_0002056 3300046530 Bacteria 13206
192 Ga0495654_0005266 3300046530 Bacteria 7547
193 Ga0495654_0079891 3300046530 Bacteria 1535
194 Ga0495654_0307209 3300046530 Bacteria 646
195 Ga0495587_0006668 3300046536 Bacteria 7521
196 Ga0495609_0007255 3300046538 Bacteria 5555
197 Ga0495609_0089796 3300046538 Bacteria 1336
198 Ga0495597_0015930 3300046542 Bacteria 3555
199 Ga0495597_0062629 3300046542 Bacteria 1617
200 Ga0495597_0171798 3300046542 Bacteria 879
201 Ga0495622_0000870 3300046557 Bacteria 16561
202 Ga0495622_0011959 3300046557 Bacteria 4014
203 Ga0495633_0469109 3300046558 Bacteria 568
204 Ga0495656_0003260 3300046615 Bacteria 5473
205 Ga0495656_0191395 3300046615 Bacteria 1010
206 Ga0495668_0092396 3300046616 Bacteria 1657
207 Ga0495634_0002027 3300046642 Bacteria 17227
208 Ga0495611_0102164 3300046648 Bacteria 1332
209 Ga0495611_0204566 3300046648 Bacteria 920
210 Ga0495625_0000014 3300046660 Bacteria 323486
211 Ga0495625_0009632 3300046660 Bacteria 8054
212 Ga0495625_0017962 3300046660 Bacteria 5528
213 Ga0495625_0068140 3300046660 Bacteria 2502
214 Ga0495625_0176265 3300046660 Bacteria 1424
215 Ga0495635_0002749 3300046663 Bacteria 12064
216 Ga0495659_0003879 3300046664 Bacteria 4744
217 Ga0495661_0114630 3300046665 Bacteria 1497
218 Ga0495588_0021766 3300046674 Bacteria 3163
219 Ga0495588_0103968 3300046674 Bacteria 1494
220 Ga0495646_0006060 3300046680 Bacteria 7669
221 Ga0495669_0000674 3300046684 Bacteria 14845
222 Ga0495669_0108340 3300046684 Bacteria 1295
223 Ga0495670_0029355 3300046691 Bacteria 2729
224 Ga0495670_0124166 3300046691 Bacteria 1342
225 Ga0495670_0274886 3300046691 Bacteria 900
226 Ga0495671_0008710 3300046692 Bacteria 5698
227 Ga0495671_0008765 3300046692 Bacteria 5681
228 Ga0495671_0024880 3300046692 Bacteria 3115
229 Ga0495671_0030916 3300046692 Bacteria 2740
230 Ga0495649_0000343 3300046694 Bacteria 40082
231 Ga0495649_0008540 3300046694 Bacteria 6154
232 Ga0495649_0029675 3300046694 Bacteria 3023
233 Ga0495589_0002897 3300046794 Bacteria 9492
234 Ga0495600_0083001 3300046809 Bacteria 2091
235 Ga0495660_0010155 3300046810 Bacteria 5474
236 Ga0495660_0051518 3300046810 Bacteria 2239
237 Ga0495660_0166876 3300046810 Bacteria 1075
238 Ga0495604_0242210 3300047317 Bacteria 1232
239 Ga0495604_0249582 3300047317 Bacteria 1210
240 Ga0495604_0272429 3300047317 Bacteria 1146
241 Ga0495636_0057467 3300047318 Bacteria 1638
242 Ga0495672_0012708 3300047320 Bacteria 5854
243 Ga0495672_0144825 3300047320 Bacteria 1237
244 Ga0495672_0282603 3300047320 Bacteria 792
245 Ga0495676_0006350 3300047321 Bacteria 10886
246 Ga0495680_0013236 3300047322 Bacteria 7206
247 Ga0495680_0023631 3300047322 Bacteria 5108
248 Ga0495683_0004633 3300047323 Bacteria 7751
249 Ga0495675_0007920 3300047444 Bacteria 6565
250 Ga0495677_0001416 3300047445 Bacteria 9631
251 Ga0495679_000894 3300047446 Bacteria 18697
252 Ga0495679_014543 3300047446 Bacteria 2910
253 Ga0495679_025858 3300047446 Bacteria 1956
254 Ga0495685_127302 3300047447 Bacteria 834
255 Ga0495673_0001695 3300047469 Bacteria 16894
256 Ga0495673_0001852 3300047469 Bacteria 15883
257 Ga0495673_0011374 3300047469 Bacteria 4787
258 Ga0495681_0033254 3300047470 Bacteria 2585
259 Ga0495681_0165755 3300047470 Bacteria 917
260 Ga0495681_0312810 3300047470 Bacteria 605
261 Ga0495686_0167801 3300047472 Bacteria 1278
262 Ga0495593_0081430 3300047673 Bacteria 1674
263 Ga0495593_0144318 3300047673 Bacteria 1205
264 Ga0495626_0000065 3300048091 Bacteria 141689
265 Ga0496110_0294108 3300048913 Bacteria 1479
266 Ga0496111_0229595 3300048914 Bacteria 1379
267 Ga0496111_0652937 3300048914 Bacteria 767
268 Ga0496116_0000639 3300048919 Bacteria 45734
269 Ga0496118_0040303 3300048921 Bacteria 3715
270 Ga0496119_0211667 3300048922 Bacteria 997
271 Ga0496120_0177507 3300048923 Bacteria 1048
272 Ga0496121_0071772 3300048924 Bacteria 2783
273 Ga0496122_0004167 3300048925 Bacteria 18226
274 Ga0496122_0012740 3300048925 Bacteria 8322
275 Ga0496123_0010545 3300048926 Bacteria 8147
276 Ga0496123_0063022 3300048926 Bacteria 2371
277 Ga0496123_0216348 3300048926 Bacteria 969
278 Ga0496124_0081530 3300048927 Bacteria 2658
279 Ga0496124_0179327 3300048927 Bacteria 1632
280 Ga0496125_0017480 3300048928 Bacteria 6833
281 Ga0496125_0312200 3300048928 Bacteria 957
282 Ga0496126_0020021 3300048929 Bacteria 6572
283 Ga0496126_0411734 3300048929 Bacteria 1095
284 Ga0495678_004040 3300049459 Bacteria 8720
285 Ga0495678_006432 3300049459 Bacteria 6249
286 Ga0495678_010728 3300049459 Bacteria 4429
287 Ga0495678_171581 3300049459 Bacteria 686
288 Ga0495682_0017672 3300049460 Bacteria 2688
289 Ga0501034_0439970 3300049571 Bacteria 1223
290 Ga0501077_0790618 3300049593 Unclassified 610
291 Ga0501201_007854 3300049651 Bacteria 1023
292 Ga0501208_000010 3300049655 Bacteria 19795
293 Ga0501223_004214 3300049663 Bacteria 3096
294 Ga0501240_000023 3300049673 Bacteria 12662
295 Ga0501249_000041 3300049679 Bacteria 55705
296 Ga0501252_001250 3300049682 Bacteria 2294
297 Ga0501245_006377 3300049708 Bacteria 1648
298 Ga0501212_012049 3300049851 Bacteria 1253
299 nmdc:mga00v17_142911_c1 3300050491 Bacteria 1535
300 nmdc:mga00v17_174789_c1 3300050491 Bacteria 1385
301 nmdc:mga00v17_177_c1 3300050491 Bacteria 37610
302 nmdc:mga00v17_283650_c1 3300050491 Bacteria 1075
303 nmdc:mga00v17_431880_c1 3300050491 Bacteria 855
304 nmdc:mga06z11_11548_c1 3300050494 Bacteria 3812
305 nmdc:mga07m45_128659_c1 3300050496 Bacteria 1465
306 nmdc:mga0sz30_37235_c1 3300050516 Bacteria 2036
307 Ga0500643_038791 3300053087 Bacteria 1410
308 Ga0500618_003642 3300053125 Bacteria 5217
309 Ga0500618_012853 3300053125 Bacteria 2180
310 Ga0500568_0093710 3300053139 Bacteria 1131
311 Ga0500573_0009804 3300053140 Bacteria 5332
312 Ga0500616_0103411 3300053153 Bacteria 1388
313 Ga0501084_1082569 3300054114 Bacteria 673
314 Ga0587088_027033 3300059508 Bacteria 1000
315 Ga0587090_003624 3300059510 Bacteria 1810
316 Ga0587072_002393 3300059643 Bacteria 2500
317 2511293840 2511231011 Bacteria 6149768
318 2555672617 2554235341 Bacteria 6867980
319 2574431655 2574179768 Bacteria 4907129
320 2585261880 2582581305 Bacteria 4895574
321 2599603488 2599185210 Bacteria 5624189
322 2643846116 2643221565 Bacteria 6216018
323 2644038475 2643221605 Bacteria 4772303
324 2644189610 2643221633 Bacteria 6733554
325 2739311139 2738543025 Bacteria 6600348
326 2778123240 2775507255 Bacteria 3945731
327 2778126451 2775507255 Bacteria 3945731
328 2808955709 2808606382 Bacteria 6841132
329 2809217838 2808606445 Bacteria 6057339
330 2819242688 2818991272 Bacteria 4622173
331 2819686590 2818991461 Bacteria 7026071
332 2826581763 2826581358 Bacteria 5963467
333 2839995214 2839993093 Bacteria 5512535
334 2841912636 2841911363 Bacteria 6173697
335 2841918391 2841917233 Bacteria 6173500
336 2844666787 2844665904 Bacteria 6817974
337 2860344895 2860339153 Bacteria 6846989
338 2931398686 2931396565 Bacteria 7251677
339 2977869555 2977864932 Bacteria 7534097
340 2998140323 2998139840 Bacteria 6073514
341 3005448111 3005445848 Bacteria 6906074
342 3007517732 3007511990 Bacteria 6481491
343 3007617403 3007614139 Bacteria 6053559
344 643822762 643692032 Bacteria 6891900
345 8056166739 8056161164 Bacteria 6106669
346 8056176845 8056172158 Bacteria 6133900
347 8056183951 8056177738 Bacteria 6748268
348 Ga0495661_0027720
349 MRS2a_Contig_9343
350 Ga0055524_1000162
351 Ga0065714_10036970
352 Ga0065714_10037066
353 Ga0065714_10150997
354 Ga0065704_10029546
355 Ga0065704_10208635
356 Ga0065704_10262592
357 Ga0070683_100027346
358 Ga0070666_10010381
359 Ga0070680_100213470
360 Ga0070671_101031062
361 Ga0070708_101312430
362 Ga0070681_10493036
363 Ga0070699_100536598
364 Ga0070665_100793109
365 Ga0068855_100803453
366 Ga0068860_100007195
367 Ga0068862_100000194
368 Ga0075364_10000103
369 Ga0075364_10106881
370 Ga0075364_10195783
371 Ga0075367_10049216
372 Ga0075369_10023097
373 Ga0075370_10029161
374 Ga0079104_1026571
375 Ga0099826_10029820
376 Ga0105251_10040954
377 Ga0105250_10001349
378 Ga0105250_10066300
379 Ga0105250_10223283
380 Ga0105247_10003639
381 Ga0105242_10498594
382 Ga0105248_10055683
383 Ga0105237_10327809
384 Ga0105249_10000135
385 Ga0105239_10031074
386 Ga0105246_10001545
387 Ga0105246_11137255
388 Ga0157371_11129538
389 Ga0157370_10250119
390 Ga0163162_10813511
391 Ga0157372_10015370
392 Ga0157380_10239037
393 Ga0182008_10002046
394 Ga0182006_1030363
395 Ga0163161_10006353
396 Ga0163161_10102257
397 Ga0163161_10180519
398 Ga0163161_10197219
399 Ga0209563_101035
400 Ga0209256_1000072
401 Ga0207696_1000221
402 Ga0207696_1005562
403 Ga0207696_1064540
404 Ga0207655_1004556
405 Ga0207655_1012236
406 Ga0207655_1037040
407 Ga0207655_1052498
408 Ga0207713_1027571
409 Ga0207710_10010065
410 Ga0207680_10008636
411 Ga0207707_10487773
412 Ga0207695_10732879
413 Ga0207671_10156221
414 Ga0207671_10479892
415 Ga0207709_10000096
416 Ga0207711_10103613
417 Ga0207667_10148374
418 Ga0207712_10000101
419 Ga0207712_10145220
420 Ga0207639_10596745
421 Ga0207674_10176733
422 Ga0209281_1016808
423 Ga0209281_1034556
424 Ga0209282_1096735
425 Ga0268266_10573527
426 Ga0268266_10632860
427 Ga0268265_10000424
428 Ga0268264_10000303
429 Ga0316179_1100210
430 Ga0265327_10420060
431 Ga0307408_100066270
432 Ga0307405_10125925
433 Ga0307406_10348024
434 Ga0307407_10207019
435 Ga0307416_102347036
436 Ga0307414_10920145
437 Ga0307411_10242233
438 Ga0316580_10015020
439 Ga0316588_1051532
440 Ga0400488_09679
441 Ga0436361_0926828
442 Ga0436361_1005240
443 Ga0439438_001566
444 Ga0439447_150914
445 Ga0439466_0050289
446 Ga0439466_0108909
447 Ga0451791_1592998
448 Ga0439432_054323
449 Ga0439451_019698
450 Ga0439452_036891
451 Ga0439456_024268
452 Ga0439456_039319
453 Ga0439456_164440
454 Ga0439463_058709
455 Ga0439463_075551
456 Ga0450911_008828
457 Ga0450890_005083
458 Ga0450904_002743
459 Ga0439459_0056432
460 Ga0450918_019804
461 Ga0451576_0000040
462 Ga0451576_0279711
463 Ga0495617_000960
464 Ga0495617_272370
465 Ga0495627_003068
466 Ga0495627_011396
467 Ga0495627_018981
468 Ga0495627_211230
469 Ga0495603_0002280
470 Ga0495603_0147079
471 Ga0495590_0008677
472 Ga0495591_004973
473 Ga0495591_006189
474 Ga0495591_010828
475 Ga0495591_011370
476 Ga0495638_0007825
477 Ga0495638_0027950
478 Ga0495638_0169527
479 Ga0495638_0254308
480 Ga0495653_0000277
481 Ga0495653_0029155
482 Ga0495653_0066682
483 Ga0495650_0001735
484 Ga0495650_0007648
485 Ga0495582_0514875
486 Ga0495605_0018643
487 Ga0495605_0054273
488 Ga0495639_0006310
489 Ga0495584_0001403
490 Ga0495584_0035783
491 Ga0495584_0076235
492 Ga0495584_0108320
493 Ga0495584_0120039
494 Ga0495585_0008995
495 Ga0495585_0062818
496 Ga0495594_0058600
497 Ga0495596_0113752
498 Ga0495607_0013133
499 Ga0495607_0013278
500 Ga0495607_0049541
501 Ga0495607_0265937
502 Ga0495583_0021035
503 Ga0495583_0027846
504 Ga0495583_0031684
505 Ga0495606_0001011
506 Ga0495606_0004014
507 Ga0495606_0004255
508 Ga0495610_0008914
509 Ga0495610_0085297
510 Ga0495610_0128726
511 Ga0495616_0002888
512 Ga0495616_0178190
513 Ga0495620_0001997
514 Ga0495620_0068492
515 Ga0495630_0512819
516 Ga0495630_0876046
517 Ga0495631_0002138
518 Ga0495631_0193092
519 Ga0495631_0325493
520 Ga0495632_0000656
521 Ga0495632_0068051
522 Ga0495632_0096920
523 Ga0495637_0000666
524 Ga0495637_0088895
525 Ga0495637_0089457
526 Ga0495643_0007267
527 Ga0495643_0269480
528 Ga0495643_0444216
529 Ga0495643_0465391
530 Ga0495644_0003985
531 Ga0495644_0154748
532 Ga0495648_0218533
533 Ga0495648_0470091
534 Ga0495648_0507847
535 Ga0495666_0012912
536 Ga0495666_0440004
537 Ga0495642_0000762
538 Ga0495654_0002056
539 Ga0495654_0005266
540 Ga0495654_0079891
541 Ga0495654_0307209
542 Ga0495587_0006668
543 Ga0495609_0007255
544 Ga0495609_0089796
545 Ga0495597_0015930
546 Ga0495597_0062629
547 Ga0495597_0171798
548 Ga0495622_0000870
549 Ga0495622_0011959
550 Ga0495633_0469109
551 Ga0495656_0003260
552 Ga0495656_0191395
553 Ga0495668_0092396
554 Ga0495634_0002027
555 Ga0495611_0102164
556 Ga0495611_0204566
557 Ga0495625_0000014
558 Ga0495625_0009632
559 Ga0495625_0017962
560 Ga0495625_0068140
561 Ga0495625_0176265
562 Ga0495635_0002749
563 Ga0495659_0003879
564 Ga0495661_0114630
565 Ga0495588_0021766
566 Ga0495588_0103968
567 Ga0495646_0006060
568 Ga0495669_0000674
569 Ga0495669_0108340
570 Ga0495670_0029355
571 Ga0495670_0124166
572 Ga0495670_0274886
573 Ga0495671_0008710
574 Ga0495671_0008765
575 Ga0495671_0024880
576 Ga0495671_0030916
577 Ga0495649_0000343
578 Ga0495649_0008540
579 Ga0495649_0029675
580 Ga0495589_0002897
581 Ga0495600_0083001
582 Ga0495660_0010155
583 Ga0495660_0051518
584 Ga0495660_0166876
585 Ga0495604_0242210
586 Ga0495604_0249582
587 Ga0495604_0272429
588 Ga0495636_0057467
589 Ga0495672_0012708
590 Ga0495672_0144825
591 Ga0495672_0282603
592 Ga0495676_0006350
593 Ga0495680_0013236
594 Ga0495680_0023631
595 Ga0495683_0004633
596 Ga0495675_0007920
597 Ga0495677_0001416
598 Ga0495679_000894
599 Ga0495679_014543
600 Ga0495679_025858
601 Ga0495685_127302
602 Ga0495673_0001695
603 Ga0495673_0001852
604 Ga0495673_0011374
605 Ga0495681_0033254
606 Ga0495681_0165755
607 Ga0495681_0312810
608 Ga0495686_0167801
609 Ga0495593_0081430
610 Ga0495593_0144318
611 Ga0495626_0000065
612 Ga0496110_0294108
613 Ga0496111_0229595
614 Ga0496111_0652937
615 Ga0496116_0000639
616 Ga0496118_0040303
617 Ga0496119_0211667
618 Ga0496120_0177507
619 Ga0496121_0071772
620 Ga0496122_0004167
621 Ga0496122_0012740
622 Ga0496123_0010545
623 Ga0496123_0063022
624 Ga0496123_0216348
625 Ga0496124_0081530
626 Ga0496124_0179327
627 Ga0496125_0017480
628 Ga0496125_0312200
629 Ga0496126_0020021
630 Ga0496126_0411734
631 Ga0495678_004040
632 Ga0495678_006432
633 Ga0495678_010728
634 Ga0495678_171581
635 Ga0495682_0017672
636 Ga0501034_0439970
637 Ga0501077_0790618
638 Ga0501201_007854
639 Ga0501208_000010
640 Ga0501223_004214
641 Ga0501240_000023
642 Ga0501249_000041
643 Ga0501252_001250
644 Ga0501245_006377
645 Ga0501212_012049
646 nmdc:mga00v17_142911_c1
647 nmdc:mga00v17_174789_c1
648 nmdc:mga00v17_177_c1
649 nmdc:mga00v17_283650_c1
650 nmdc:mga00v17_431880_c1
651 nmdc:mga06z11_11548_c1
652 nmdc:mga07m45_128659_c1
653 nmdc:mga0sz30_37235_c1
654 Ga0500643_038791
655 Ga0500618_003642
656 Ga0500618_012853
657 Ga0500568_0093710
658 Ga0500573_0009804
659 Ga0500616_0103411
660 Ga0501084_1082569
661 Ga0587088_027033
662 Ga0587090_003624
663 Ga0587072_002393
664 2511293840
665 2555672617
666 2574431655
667 2585261880
668 2599603488
669 2643846116
670 2644038475
671 2644189610
672 2739311139
673 2778123240
674 2778126451
675 2808955709
676 2809217838
677 2819242688
678 2819686590
679 2826581763
680 2839995214
681 2841912636
682 2841918391
683 2844666787
684 2860344895
685 2931398686
686 2977869555
687 2998140323
688 3005448111
689 3007517732
690 3007617403
691 643822762
692 8056166739
693 8056176845
694 8056183951

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF15738

YafQ_toxin

Bacterial toxin of type II toxin-antitoxin system, YafQ

20

113

0.94

PF05016

ParE_toxin

ParE toxin of type II toxin-antitoxin system, parDE

23

112

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lsy-assembly1.cif.gz_A crystal structure of copper-bound l66s mutant toxin from helicobacter pylori 0.9323 16 103
4mmj-assembly1.cif.gz_A crystal structure of yafq from e.coli strain bl21(de3) 0.9315 15 104
4mmg-assembly2.cif.gz_B crystal structure of yafq mutant h87q from e.coli 0.9239 15 104
4ml0-assembly1.cif.gz_D crystal structure of e.coli dinj-yafq complex 0.919 15 104
4nrn-assembly1.cif.gz_A crystal structure of metal-bound toxin from helicobacter pylori 0.9126 16 103
ID Description Score Start End Superfamily
4ml0D00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.919 15 104 3.30.2310.20
4ml0D00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.9 15 104 3.30.2310.20
4bydY00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.8721 17 99 3.30.2310.20
af_P9WF09_1_85_3.30.2310.20 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.8721 15 99 3.30.2310.20
af_P9WF09_1_85_3.30.2310.20 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.8442 15 99 3.30.2310.20
ID Description Score Start End GO Terms
AF-A0A1V6K1N3-F1-model_v4 mRNA interferase YafQ (EC 3.1.-.-) 0.9677 16 103 GO:0004521
GO:0006402
GO:0006415
AF-A0A7C1DHD4-F1-model_v4 Type II toxin-antitoxin system YafQ family toxin 0.9639 15 104 GO:0004521
GO:0006402
GO:0006415
AF-A0A1K1LHW7-F1-model_v4 YafQ toxin protein 0.9626 35 104 GO:0004521
GO:0006402
GO:0006415
AF-A0A7X9IH56-F1-model_v4 Type II toxin-antitoxin system YafQ family toxin 0.9613 17 104 GO:0004521
GO:0006402
GO:0006415
AF-A0A251ZTI7-F1-model_v4 Addiction module toxin, RelE/StbE family protein 0.9609 15 104 GO:0004521
GO:0006402
GO:0006415

Map