F417228

General Info

Members Datasets Scaffolds Average Seq Length
347 202 694 162

Family's Representative Sequence

Representative Sequence 3300039447|Ga0436361_0474756|Ga0436361_0474756_28_540
Length 154
Sequence MDSEPLRIEICPNCALSVRGARLFFGIACIVPCGIATALALKGFWPVLPFAGLEMALLGWALSVCLERRFHSQTICEHVVFPRHWAQVKLRRPAAGLHPSRLTIESQGRRCELGSFLTEEERRGLALRLQRLIGRMNESPSWHQGDARRGGLAS

Samples

Sample ID Description Type Environment
1 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
2 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
42 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
70 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
71 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
108 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
109 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
110 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
111 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
112 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
115 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
116 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
117 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
118 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
119 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
120 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
121 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
122 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
123 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
124 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
125 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
127 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
128 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
129 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
130 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
131 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
132 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
133 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
134 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
135 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
136 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
137 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
138 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
139 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
140 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
141 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
142 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
143 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
144 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
145 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
146 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
147 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
148 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
149 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
150 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
151 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
152 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
153 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
154 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
155 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
156 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
157 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
158 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
159 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
160 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
161 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
162 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
163 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
164 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
165 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
166 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
167 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
168 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
169 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
170 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
171 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
172 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
173 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
174 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
175 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
176 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
177 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
178 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
179 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
180 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
181 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
182 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
183 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
184 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
185 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
186 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
187 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
188 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
189 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
190 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
191 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
192 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
193 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
194 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
195 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
196 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
197 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
198 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
199 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
200 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
201 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
202 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.71
Metatranscriptomes 0.29
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.48
Nodule 0
Rhizoplane 7.2
Rhizosphere 82.71
Stem 0
Stem Tuber 0
Unclassified 13.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436361_0474756 3300039447 Bacteria 762
2 Ga0068869_100105123 3300005334 Bacteria 2141
3 Ga0070666_10470718 3300005335 Bacteria 909
4 Ga0070680_100494450 3300005336 Bacteria 1046
5 Ga0068868_100012692 3300005338 Bacteria 6162
6 Ga0070691_10178287 3300005341 Bacteria 1105
7 Ga0070671_100040997 3300005355 Bacteria 3847
8 Ga0070667_100033789 3300005367 Bacteria 4278
9 Ga0070667_100344065 3300005367 Viruses 1349
10 Ga0070703_10049436 3300005406 Bacteria 1339
11 Ga0070709_10004361 3300005434 Bacteria 7624
12 Ga0070714_100003075 3300005435 Bacteria 12380
13 Ga0070714_100124595 3300005435 Bacteria 2295
14 Ga0070713_100003377 3300005436 Bacteria 10543
15 Ga0070713_100124119 3300005436 Bacteria 2268
16 Ga0070713_100140476 3300005436 Bacteria 2139
17 Ga0070713_101141428 3300005436 Unclassified 754
18 Ga0070710_10232313 3300005437 Bacteria 1178
19 Ga0070711_100025820 3300005439 Bacteria 3845
20 Ga0070711_100054031 3300005439 Bacteria 2771
21 Ga0070711_100311063 3300005439 Bacteria 1256
22 Ga0070711_100685558 3300005439 Viruses 862
23 Ga0070711_101122201 3300005439 Unclassified 678
24 Ga0070694_100181521 3300005444 Bacteria 1557
25 Ga0070678_100036962 3300005456 Bacteria 3424
26 Ga0070681_10000480 3300005458 Bacteria 32571
27 Ga0070681_10002741 3300005458 Bacteria 16239
28 Ga0070681_10019467 3300005458 Bacteria 6795
29 Ga0068867_100228577 3300005459 Bacteria 1503
30 Ga0070706_100378314 3300005467 Bacteria 1319
31 Ga0070698_100111319 3300005471 Unclassified 2703
32 Ga0070699_100012588 3300005518 Bacteria 7296
33 Ga0070679_100014851 3300005530 Bacteria 7481
34 Ga0070679_100088123 3300005530 Bacteria 3091
35 Ga0070679_100927986 3300005530 Bacteria 814
36 Ga0070686_100391396 3300005544 Bacteria 1055
37 Ga0070695_100012976 3300005545 Bacteria 5004
38 Ga0070696_100247037 3300005546 Bacteria 1348
39 Ga0070693_100037975 3300005547 Bacteria 2689
40 Ga0070665_100004952 3300005548 Bacteria 13807
41 Ga0070665_100006983 3300005548 Bacteria 11477
42 Ga0070665_100008198 3300005548 Bacteria 10578
43 Ga0070665_100008567 3300005548 Bacteria 10349
44 Ga0070704_100219800 3300005549 Bacteria 1544
45 Ga0068855_100023519 3300005563 Bacteria 7377
46 Ga0068855_100065858 3300005563 Bacteria 4224
47 Ga0068855_100483958 3300005563 Bacteria 1347
48 Ga0068855_100548598 3300005563 Bacteria 1251
49 Ga0068857_100855225 3300005577 Unclassified 871
50 Ga0068856_100002004 3300005614 Bacteria 21240
51 Ga0068856_100156090 3300005614 Bacteria 2292
52 Ga0068856_100182429 3300005614 Bacteria 2112
53 Ga0068856_100373569 3300005614 Bacteria 1445
54 Ga0068852_101425108 3300005616 Unclassified 715
55 Ga0068859_100104423 3300005617 Bacteria 2893
56 Ga0068859_100350613 3300005617 Bacteria 1571
57 Ga0068866_10021788 3300005718 Bacteria 2956
58 Ga0068863_100032872 3300005841 Bacteria 4942
59 Ga0068863_100292591 3300005841 Bacteria 1579
60 Ga0068863_100434990 3300005841 Bacteria 1286
61 Ga0068858_100047048 3300005842 Bacteria 4000
62 Ga0068858_100431449 3300005842 Bacteria 1268
63 Ga0068860_100059715 3300005843 Bacteria 3625
64 Ga0068862_100258575 3300005844 Unclassified 1589
65 Ga0081539_10000007 3300005985 Bacteria 532790
66 Ga0070717_10072100 3300006028 Bacteria 2883
67 Ga0075368_10364774 3300006042 Unclassified 630
68 Ga0070715_10000539 3300006163 Bacteria 9936
69 Ga0070715_10131125 3300006163 Bacteria 1206
70 Ga0070715_10179508 3300006163 Bacteria 1061
71 Ga0070715_10344428 3300006163 Unclassified 812
72 Ga0070716_100009132 3300006173 Bacteria 4934
73 Ga0070716_100028573 3300006173 Bacteria 3006
74 Ga0070716_100296696 3300006173 Bacteria 1122
75 Ga0070712_100002886 3300006175 Bacteria 10658
76 Ga0070712_100299046 3300006175 Bacteria 1302
77 Ga0070712_100390808 3300006175 Bacteria 1147
78 Ga0097621_100015220 3300006237 Bacteria 5781
79 Ga0097621_100095320 3300006237 Bacteria 2496
80 Ga0097621_100737947 3300006237 Unclassified 909
81 Ga0068871_100004961 3300006358 Bacteria 9295
82 Ga0068871_100117751 3300006358 Bacteria 2241
83 Ga0068865_100036836 3300006881 Bacteria 3300
84 Ga0097620_100104417 3300006931 Bacteria 2893
85 Ga0097620_100350644 3300006931 Bacteria 1571
86 Ga0105240_10018998 3300009093 Bacteria 9202
87 Ga0105240_10062847 3300009093 Bacteria 4621
88 Ga0105240_10069449 3300009093 Bacteria 4360
89 Ga0105240_10075045 3300009093 Bacteria 4172
90 Ga0105240_10405908 3300009093 Bacteria 1534
91 Ga0105240_11532586 3300009093 Unclassified 698
92 Ga0105245_10093580 3300009098 Bacteria 2769
93 Ga0105247_10013095 3300009101 Bacteria 4975
94 Ga0105247_10235564 3300009101 Unclassified 1245
95 Ga0105243_10684391 3300009148 Bacteria 998
96 Ga0105243_11247557 3300009148 Unclassified 758
97 Ga0105241_10910658 3300009174 Bacteria 817
98 Ga0105242_10000749 3300009176 Bacteria 25295
99 Ga0105242_11309684 3300009176 Bacteria 748
100 Ga0105248_10032685 3300009177 Bacteria 5811
101 Ga0105237_10017710 3300009545 Bacteria 7384
102 Ga0105237_10074599 3300009545 Bacteria 3384
103 Ga0105237_10089670 3300009545 Bacteria 3064
104 Ga0105237_10288541 3300009545 Bacteria 1644
105 Ga0105238_10040811 3300009551 Bacteria 4701
106 Ga0105238_10200023 3300009551 Bacteria 1973
107 Ga0105238_10338888 3300009551 Bacteria 1491
108 Ga0105238_11692262 3300009551 Unclassified 664
109 Ga0105249_10402652 3300009553 Bacteria 1399
110 Ga0099796_10006648 3300010159 Bacteria 2975
111 Ga0105239_10016408 3300010375 Bacteria 8190
112 Ga0105239_10290770 3300010375 Bacteria 1840
113 Ga0105239_10632979 3300010375 Bacteria 1221
114 Ga0105239_10836013 3300010375 Viruses 1055
115 Ga0105239_10963661 3300010375 Bacteria 980
116 Ga0157374_10001494 3300013296 Bacteria 19733
117 Ga0157378_10095442 3300013297 Bacteria 2708
118 Ga0163162_10030586 3300013306 Bacteria 5335
119 Ga0157372_10338173 3300013307 Bacteria 1753
120 Ga0157372_10615654 3300013307 Bacteria 1265
121 Ga0157375_10021688 3300013308 Bacteria 5896
122 Ga0163163_10021902 3300014325 Bacteria 6040
123 Ga0163163_10093876 3300014325 Bacteria 3017
124 Ga0163163_10096301 3300014325 Unclassified 2979
125 Ga0157376_10096094 3300014969 Bacteria 2578
126 Ga0157376_10166252 3300014969 Bacteria 2005
127 Ga0157376_11152416 3300014969 Unclassified 802
128 Ga0206356_10930601 3300020070 Bacteria 2126
129 Ga0213873_10257929 3300021358 Unclassified 554
130 Ga0213874_10006427 3300021377 Bacteria 2780
131 Ga0213874_10017326 3300021377 Bacteria 1931
132 Ga0213874_10310215 3300021377 Unclassified 596
133 Ga0207692_10014214 3300025898 Bacteria 3473
134 Ga0207642_10011742 3300025899 Bacteria 3137
135 Ga0207710_10011492 3300025900 Bacteria 3727
136 Ga0207680_10195273 3300025903 Bacteria 1376
137 Ga0207680_10197973 3300025903 Bacteria 1367
138 Ga0207685_10219793 3300025905 Bacteria 903
139 Ga0207685_10264258 3300025905 Bacteria 838
140 Ga0207699_10001867 3300025906 Bacteria 9919
141 Ga0207699_10008226 3300025906 Bacteria 5135
142 Ga0207699_10187934 3300025906 Bacteria 1392
143 Ga0207699_10568072 3300025906 Bacteria 824
144 Ga0207684_10352162 3300025910 Bacteria 1267
145 Ga0207654_10103092 3300025911 Bacteria 1761
146 Ga0207707_10002193 3300025912 Bacteria 17690
147 Ga0207707_10005550 3300025912 Bacteria 11032
148 Ga0207707_10038101 3300025912 Bacteria 4201
149 Ga0207707_10038919 3300025912 Bacteria 4157
150 Ga0207695_10003505 3300025913 Bacteria 22004
151 Ga0207695_10055441 3300025913 Bacteria 4130
152 Ga0207695_10123721 3300025913 Bacteria 2552
153 Ga0207695_10125305 3300025913 Bacteria 2532
154 Ga0207671_10070385 3300025914 Bacteria 2608
155 Ga0207671_10262603 3300025914 Bacteria 1359
156 Ga0207693_10000064 3300025915 Bacteria 92381
157 Ga0207693_10088148 3300025915 Bacteria 2432
158 Ga0207693_10230748 3300025915 Bacteria 1454
159 Ga0207693_10334189 3300025915 Bacteria 1186
160 Ga0207663_10039633 3300025916 Bacteria 2856
161 Ga0207663_10055696 3300025916 Bacteria 2483
162 Ga0207663_10427760 3300025916 Bacteria 1017
163 Ga0207652_10001697 3300025921 Bacteria 19284
164 Ga0207652_10107889 3300025921 Bacteria 2466
165 Ga0207652_10189831 3300025921 Bacteria 1848
166 Ga0207652_10440677 3300025921 Unclassified 1174
167 Ga0207652_10839832 3300025921 Bacteria 814
168 Ga0207694_10006666 3300025924 Bacteria 8773
169 Ga0207694_10034931 3300025924 Bacteria 3855
170 Ga0207694_10236627 3300025924 Bacteria 1492
171 Ga0207694_10380711 3300025924 Bacteria 1171
172 Ga0207694_10467928 3300025924 Bacteria 1053
173 Ga0207659_10832581 3300025926 Unclassified 793
174 Ga0207700_10050699 3300025928 Bacteria 3094
175 Ga0207700_10992887 3300025928 Unclassified 751
176 Ga0207664_10007171 3300025929 Bacteria 7730
177 Ga0207664_10205469 3300025929 Bacteria 1702
178 Ga0207664_11179030 3300025929 Unclassified 683
179 Ga0207644_10243834 3300025931 Bacteria 1431
180 Ga0207686_10058315 3300025934 Bacteria 2434
181 Ga0207665_10007919 3300025939 Bacteria 7019
182 Ga0207665_10077409 3300025939 Bacteria 2283
183 Ga0207665_10112463 3300025939 Bacteria 1915
184 Ga0207689_10414521 3300025942 Unclassified 1123
185 Ga0207689_10483947 3300025942 Bacteria 1036
186 Ga0207667_10000918 3300025949 Bacteria 37560
187 Ga0207667_10025740 3300025949 Bacteria 6436
188 Ga0207667_10134418 3300025949 Bacteria 2547
189 Ga0207658_10009657 3300025986 Bacteria 6545
190 Ga0207703_10054404 3300026035 Bacteria 3254
191 Ga0207703_10707956 3300026035 Bacteria 958
192 Ga0207703_11386193 3300026035 Bacteria 676
193 Ga0207639_10264078 3300026041 Bacteria 1507
194 Ga0207639_11413413 3300026041 Bacteria 653
195 Ga0207702_10124953 3300026078 Bacteria 2308
196 Ga0207702_10251360 3300026078 Bacteria 1660
197 Ga0207702_10779222 3300026078 Unclassified 945
198 Ga0207702_10784811 3300026078 Bacteria 941
199 Ga0207702_10992951 3300026078 Unclassified 833
200 Ga0207702_11413523 3300026078 Bacteria 689
201 Ga0207641_10022642 3300026088 Bacteria 5172
202 Ga0207641_10413929 3300026088 Bacteria 1297
203 Ga0207641_10450246 3300026088 Bacteria 1244
204 Ga0207648_10056021 3300026089 Bacteria 3441
205 Ga0207674_10174752 3300026116 Bacteria 2100
206 Ga0207675_100228278 3300026118 Bacteria 1795
207 Ga0207683_10009298 3300026121 Bacteria 8374
208 Ga0207698_10040206 3300026142 Bacteria 3472
209 Ga0207698_10768350 3300026142 Bacteria 964
210 Ga0268266_10001089 3300028379 Bacteria 34078
211 Ga0268266_10011145 3300028379 Bacteria 7827
212 Ga0268266_10053402 3300028379 Bacteria 3471
213 Ga0268265_10133637 3300028380 Bacteria 2066
214 Ga0268264_10043806 3300028381 Bacteria 3710
215 Ga0307515_10031299 3300028794 Bacteria 8878
216 Ga0265331_10034583 3300031250 Bacteria 2491
217 Ga0307513_10061947 3300031456 Bacteria 3956
218 Ga0307509_10126694 3300031507 Bacteria 2518
219 Ga0307509_10322718 3300031507 Bacteria 1280
220 Ga0307408_101102756 3300031548 Unclassified 736
221 Ga0307412_10783558 3300031911 Unclassified 826
222 Ga0307416_100109476 3300032002 Bacteria 2430
223 Ga0307510_10031099 3300033180 Bacteria 6036
224 Ga0373923_0050942 3300035111 Bacteria 1736
225 Ga0373923_0403455 3300035111 Unclassified 658
226 Ga0373953_0146423 3300035117 Bacteria 1011
227 Ga0373954_0059327 3300035118 Bacteria 1803
228 Ga0373956_0210368 3300035119 Bacteria 922
229 Ga0373943_0027069 3300035170 Bacteria 2691
230 Ga0373955_0058453 3300035172 Bacteria 2122
231 Ga0373924_0228514 3300035410 Bacteria 822
232 Ga0373935_0111300 3300035692 Bacteria 1818
233 Ga0373927_0045630 3300035695 Bacteria 2834
234 Ga0373933_0057371 3300035724 Bacteria 2340
235 Ga0373937_0009112 3300036401 Bacteria 8613
236 Ga0373937_0011931 3300036401 Bacteria 7626
237 Ga0395899_0346379 3300037312 Bacteria 995
238 Ga0395898_0017904 3300037466 Bacteria 7228
239 Ga0395898_0061006 3300037466 Bacteria 3664
240 Ga0395898_0106633 3300037466 Bacteria 2687
241 Ga0436364_1517092 3300037853 Bacteria 1180
242 Ga0395901_1375734 3300038443 Unclassified 665
243 Ga0436365_1094843 3300039437 Bacteria 1451
244 Ga0436360_0210891 3300039438 Bacteria 674
245 Ga0436360_0312011 3300039438 Bacteria 1102
246 Ga0436360_0787761 3300039438 Bacteria 1311
247 Ga0436360_0807622 3300039438 Bacteria 1685
248 Ga0436360_0930715 3300039438 Bacteria 1109
249 Ga0436360_1036698 3300039438 Bacteria 5066
250 Ga0436360_1290803 3300039438 Bacteria 1436
251 Ga0436361_0242051 3300039447 Bacteria 2236
252 Ga0436361_0422985 3300039447 Unclassified 1411
253 Ga0436361_0450498 3300039447 Bacteria 1769
254 Ga0436361_0878634 3300039447 Bacteria 1269
255 Ga0436363_1310179 3300039450 Bacteria 2095
256 Ga0436363_1481931 3300039450 Bacteria 3912
257 Ga0436362_0355303 3300039453 Unclassified 538
258 Ga0436362_1157986 3300039453 Bacteria 2116
259 Ga0451800_1055967 3300041459 Bacteria 1615
260 Ga0451807_1888871 3300041486 Bacteria 1338
261 Ga0439435_0133324 3300042436 Unclassified 786
262 Ga0466969_0002465 3300044656 Bacteria 9881
263 Ga0466969_0021937 3300044656 Bacteria 3300
264 Ga0466969_0099202 3300044656 Unclassified 1373
265 Ga0466969_0152539 3300044656 Bacteria 1064
266 Ga0466972_0389171 3300044658 Bacteria 653
267 Ga0466965_0075274 3300044683 Unclassified 1702
268 Ga0466966_0000659 3300044684 Bacteria 22000
269 Ga0466966_0160253 3300044684 Bacteria 1370
270 Ga0466961_0004047 3300044693 Bacteria 9186
271 Ga0466963_0056590 3300044694 Bacteria 2610
272 Ga0466964_0001776 3300044706 Bacteria 7475
273 Ga0466971_0000112 3300044719 Bacteria 29241
274 Ga0466970_0000362 3300044765 Bacteria 22033
275 Ga0466957_0027358 3300044842 Bacteria 3389
276 Ga0466959_0002656 3300045049 Bacteria 11476
277 Ga0466959_0005080 3300045049 Bacteria 8949
278 Ga0466959_0168763 3300045049 Bacteria 1535
279 Ga0466958_0153396 3300045836 Bacteria 1453
280 Ga0466967_1050754 3300045976 Unclassified 811
281 Ga0495651_0037018 3300046462 Bacteria 3799
282 Ga0495653_0456530 3300046463 Bacteria 803
283 Ga0495580_0186591 3300046472 Unclassified 1431
284 Ga0495584_0544244 3300046491 Unclassified 592
285 Ga0495618_0124173 3300046514 Bacteria 1653
286 Ga0495628_0559892 3300046516 Unclassified 820
287 Ga0495630_0155276 3300046517 Bacteria 1742
288 Ga0495665_0056670 3300046531 Bacteria 2069
289 Ga0495586_0106838 3300046535 Bacteria 1557
290 Ga0495657_0383424 3300046675 Bacteria 829
291 Ga0495623_0175081 3300046679 Bacteria 1251
292 Ga0495658_0276968 3300046683 Bacteria 1058
293 Ga0495669_0555549 3300046684 Unclassified 559
294 Ga0495613_0836233 3300046689 Unclassified 599
295 Ga0495674_0413261 3300047319 Bacteria 1088
296 Ga0495602_0145071 3300048088 Bacteria 1874
297 Ga0496100_0014004 3300048903 Bacteria 4644
298 Ga0496101_0004350 3300048904 Bacteria 8893
299 Ga0496101_0381926 3300048904 Bacteria 1108
300 Ga0496102_0070679 3300048905 Bacteria 3205
301 Ga0496102_0074910 3300048905 Bacteria 3111
302 Ga0496103_0585621 3300048906 Unclassified 711
303 Ga0496104_0498709 3300048907 Bacteria 1128
304 Ga0496105_0303269 3300048908 Bacteria 1283
305 Ga0496106_0083643 3300048909 Bacteria 2454
306 Ga0496106_0380524 3300048909 Bacteria 1134
307 Ga0496107_0015602 3300048910 Bacteria 5326
308 Ga0496107_0046579 3300048910 Bacteria 3121
309 Ga0496108_0006566 3300048911 Bacteria 9438
310 Ga0496109_0037320 3300048912 Bacteria 4390
311 Ga0496110_0001462 3300048913 Bacteria 17139
312 Ga0496110_1209994 3300048913 Unclassified 664
313 Ga0496111_0006258 3300048914 Bacteria 7716
314 Ga0496112_0623611 3300048915 Bacteria 1009
315 Ga0496113_0046727 3300048916 Bacteria 3215
316 Ga0496113_0391476 3300048916 Bacteria 1116
317 Ga0496114_0007610 3300048917 Bacteria 8564
318 Ga0496115_0236673 3300048918 Bacteria 1505
319 Ga0496115_0382930 3300048918 Bacteria 1144
320 Ga0496117_0290808 3300048920 Unclassified 870
321 Ga0496118_0074913 3300048921 Bacteria 2417
322 Ga0496126_0008221 3300048929 Bacteria 11283
323 Ga0496126_0150513 3300048929 Bacteria 1995
324 nmdc:mga0n895_152402_c1 3300050512 Bacteria 2342
325 nmdc:mga08x19_109605_c1 3300050514 Bacteria 1840
326 Ga0495612_0079960 3300053078 Bacteria 1373
327 Ga0495595_0229819 3300053084 Bacteria 927
328 Ga0500644_0047205 3300053088 Bacteria 1460
329 Ga0500644_0106313 3300053088 Bacteria 1074
330 Ga0500583_0006340 3300053092 Bacteria 4060
331 Ga0500651_0197336 3300053093 Bacteria 1189
332 Ga0500651_0393662 3300053093 Unclassified 779
333 Ga0500641_0044063 3300053096 Bacteria 1813
334 Ga0500641_0052714 3300053096 Unclassified 1677
335 Ga0500556_0008340 3300053104 Bacteria 2987
336 Ga0500569_009357 3300053109 Bacteria 2275
337 Ga0500593_047917 3300053117 Bacteria 1902
338 Ga0500595_024352 3300053119 Bacteria 2114
339 Ga0500617_024151 3300053124 Bacteria 2691
340 Ga0500568_0050980 3300053139 Bacteria 1630
341 Ga0500568_0223487 3300053139 Unclassified 688
342 Ga0500616_0000074 3300053153 Bacteria 222910
343 Ga0500616_0011901 3300053153 Bacteria 5114
344 Ga0500633_0091201 3300053160 Unclassified 1113
345 Ga0500636_0333830 3300053177 Unclassified 731
346 Ga0466962_0000401 3300061719 Bacteria 18699
347 Ga0466962_0424905 3300061719 Unclassified 667
348 Ga0436361_0474756
349 Ga0068869_100105123
350 Ga0070666_10470718
351 Ga0070680_100494450
352 Ga0068868_100012692
353 Ga0070691_10178287
354 Ga0070671_100040997
355 Ga0070667_100033789
356 Ga0070667_100344065
357 Ga0070703_10049436
358 Ga0070709_10004361
359 Ga0070714_100003075
360 Ga0070714_100124595
361 Ga0070713_100003377
362 Ga0070713_100124119
363 Ga0070713_100140476
364 Ga0070713_101141428
365 Ga0070710_10232313
366 Ga0070711_100025820
367 Ga0070711_100054031
368 Ga0070711_100311063
369 Ga0070711_100685558
370 Ga0070711_101122201
371 Ga0070694_100181521
372 Ga0070678_100036962
373 Ga0070681_10000480
374 Ga0070681_10002741
375 Ga0070681_10019467
376 Ga0068867_100228577
377 Ga0070706_100378314
378 Ga0070698_100111319
379 Ga0070699_100012588
380 Ga0070679_100014851
381 Ga0070679_100088123
382 Ga0070679_100927986
383 Ga0070686_100391396
384 Ga0070695_100012976
385 Ga0070696_100247037
386 Ga0070693_100037975
387 Ga0070665_100004952
388 Ga0070665_100006983
389 Ga0070665_100008198
390 Ga0070665_100008567
391 Ga0070704_100219800
392 Ga0068855_100023519
393 Ga0068855_100065858
394 Ga0068855_100483958
395 Ga0068855_100548598
396 Ga0068857_100855225
397 Ga0068856_100002004
398 Ga0068856_100156090
399 Ga0068856_100182429
400 Ga0068856_100373569
401 Ga0068852_101425108
402 Ga0068859_100104423
403 Ga0068859_100350613
404 Ga0068866_10021788
405 Ga0068863_100032872
406 Ga0068863_100292591
407 Ga0068863_100434990
408 Ga0068858_100047048
409 Ga0068858_100431449
410 Ga0068860_100059715
411 Ga0068862_100258575
412 Ga0081539_10000007
413 Ga0070717_10072100
414 Ga0075368_10364774
415 Ga0070715_10000539
416 Ga0070715_10131125
417 Ga0070715_10179508
418 Ga0070715_10344428
419 Ga0070716_100009132
420 Ga0070716_100028573
421 Ga0070716_100296696
422 Ga0070712_100002886
423 Ga0070712_100299046
424 Ga0070712_100390808
425 Ga0097621_100015220
426 Ga0097621_100095320
427 Ga0097621_100737947
428 Ga0068871_100004961
429 Ga0068871_100117751
430 Ga0068865_100036836
431 Ga0097620_100104417
432 Ga0097620_100350644
433 Ga0105240_10018998
434 Ga0105240_10062847
435 Ga0105240_10069449
436 Ga0105240_10075045
437 Ga0105240_10405908
438 Ga0105240_11532586
439 Ga0105245_10093580
440 Ga0105247_10013095
441 Ga0105247_10235564
442 Ga0105243_10684391
443 Ga0105243_11247557
444 Ga0105241_10910658
445 Ga0105242_10000749
446 Ga0105242_11309684
447 Ga0105248_10032685
448 Ga0105237_10017710
449 Ga0105237_10074599
450 Ga0105237_10089670
451 Ga0105237_10288541
452 Ga0105238_10040811
453 Ga0105238_10200023
454 Ga0105238_10338888
455 Ga0105238_11692262
456 Ga0105249_10402652
457 Ga0099796_10006648
458 Ga0105239_10016408
459 Ga0105239_10290770
460 Ga0105239_10632979
461 Ga0105239_10836013
462 Ga0105239_10963661
463 Ga0157374_10001494
464 Ga0157378_10095442
465 Ga0163162_10030586
466 Ga0157372_10338173
467 Ga0157372_10615654
468 Ga0157375_10021688
469 Ga0163163_10021902
470 Ga0163163_10093876
471 Ga0163163_10096301
472 Ga0157376_10096094
473 Ga0157376_10166252
474 Ga0157376_11152416
475 Ga0206356_10930601
476 Ga0213873_10257929
477 Ga0213874_10006427
478 Ga0213874_10017326
479 Ga0213874_10310215
480 Ga0207692_10014214
481 Ga0207642_10011742
482 Ga0207710_10011492
483 Ga0207680_10195273
484 Ga0207680_10197973
485 Ga0207685_10219793
486 Ga0207685_10264258
487 Ga0207699_10001867
488 Ga0207699_10008226
489 Ga0207699_10187934
490 Ga0207699_10568072
491 Ga0207684_10352162
492 Ga0207654_10103092
493 Ga0207707_10002193
494 Ga0207707_10005550
495 Ga0207707_10038101
496 Ga0207707_10038919
497 Ga0207695_10003505
498 Ga0207695_10055441
499 Ga0207695_10123721
500 Ga0207695_10125305
501 Ga0207671_10070385
502 Ga0207671_10262603
503 Ga0207693_10000064
504 Ga0207693_10088148
505 Ga0207693_10230748
506 Ga0207693_10334189
507 Ga0207663_10039633
508 Ga0207663_10055696
509 Ga0207663_10427760
510 Ga0207652_10001697
511 Ga0207652_10107889
512 Ga0207652_10189831
513 Ga0207652_10440677
514 Ga0207652_10839832
515 Ga0207694_10006666
516 Ga0207694_10034931
517 Ga0207694_10236627
518 Ga0207694_10380711
519 Ga0207694_10467928
520 Ga0207659_10832581
521 Ga0207700_10050699
522 Ga0207700_10992887
523 Ga0207664_10007171
524 Ga0207664_10205469
525 Ga0207664_11179030
526 Ga0207644_10243834
527 Ga0207686_10058315
528 Ga0207665_10007919
529 Ga0207665_10077409
530 Ga0207665_10112463
531 Ga0207689_10414521
532 Ga0207689_10483947
533 Ga0207667_10000918
534 Ga0207667_10025740
535 Ga0207667_10134418
536 Ga0207658_10009657
537 Ga0207703_10054404
538 Ga0207703_10707956
539 Ga0207703_11386193
540 Ga0207639_10264078
541 Ga0207639_11413413
542 Ga0207702_10124953
543 Ga0207702_10251360
544 Ga0207702_10779222
545 Ga0207702_10784811
546 Ga0207702_10992951
547 Ga0207702_11413523
548 Ga0207641_10022642
549 Ga0207641_10413929
550 Ga0207641_10450246
551 Ga0207648_10056021
552 Ga0207674_10174752
553 Ga0207675_100228278
554 Ga0207683_10009298
555 Ga0207698_10040206
556 Ga0207698_10768350
557 Ga0268266_10001089
558 Ga0268266_10011145
559 Ga0268266_10053402
560 Ga0268265_10133637
561 Ga0268264_10043806
562 Ga0307515_10031299
563 Ga0265331_10034583
564 Ga0307513_10061947
565 Ga0307509_10126694
566 Ga0307509_10322718
567 Ga0307408_101102756
568 Ga0307412_10783558
569 Ga0307416_100109476
570 Ga0307510_10031099
571 Ga0373923_0050942
572 Ga0373923_0403455
573 Ga0373953_0146423
574 Ga0373954_0059327
575 Ga0373956_0210368
576 Ga0373943_0027069
577 Ga0373955_0058453
578 Ga0373924_0228514
579 Ga0373935_0111300
580 Ga0373927_0045630
581 Ga0373933_0057371
582 Ga0373937_0009112
583 Ga0373937_0011931
584 Ga0395899_0346379
585 Ga0395898_0017904
586 Ga0395898_0061006
587 Ga0395898_0106633
588 Ga0436364_1517092
589 Ga0395901_1375734
590 Ga0436365_1094843
591 Ga0436360_0210891
592 Ga0436360_0312011
593 Ga0436360_0787761
594 Ga0436360_0807622
595 Ga0436360_0930715
596 Ga0436360_1036698
597 Ga0436360_1290803
598 Ga0436361_0242051
599 Ga0436361_0422985
600 Ga0436361_0450498
601 Ga0436361_0878634
602 Ga0436363_1310179
603 Ga0436363_1481931
604 Ga0436362_0355303
605 Ga0436362_1157986
606 Ga0451800_1055967
607 Ga0451807_1888871
608 Ga0439435_0133324
609 Ga0466969_0002465
610 Ga0466969_0021937
611 Ga0466969_0099202
612 Ga0466969_0152539
613 Ga0466972_0389171
614 Ga0466965_0075274
615 Ga0466966_0000659
616 Ga0466966_0160253
617 Ga0466961_0004047
618 Ga0466963_0056590
619 Ga0466964_0001776
620 Ga0466971_0000112
621 Ga0466970_0000362
622 Ga0466957_0027358
623 Ga0466959_0002656
624 Ga0466959_0005080
625 Ga0466959_0168763
626 Ga0466958_0153396
627 Ga0466967_1050754
628 Ga0495651_0037018
629 Ga0495653_0456530
630 Ga0495580_0186591
631 Ga0495584_0544244
632 Ga0495618_0124173
633 Ga0495628_0559892
634 Ga0495630_0155276
635 Ga0495665_0056670
636 Ga0495586_0106838
637 Ga0495657_0383424
638 Ga0495623_0175081
639 Ga0495658_0276968
640 Ga0495669_0555549
641 Ga0495613_0836233
642 Ga0495674_0413261
643 Ga0495602_0145071
644 Ga0496100_0014004
645 Ga0496101_0004350
646 Ga0496101_0381926
647 Ga0496102_0070679
648 Ga0496102_0074910
649 Ga0496103_0585621
650 Ga0496104_0498709
651 Ga0496105_0303269
652 Ga0496106_0083643
653 Ga0496106_0380524
654 Ga0496107_0015602
655 Ga0496107_0046579
656 Ga0496108_0006566
657 Ga0496109_0037320
658 Ga0496110_0001462
659 Ga0496110_1209994
660 Ga0496111_0006258
661 Ga0496112_0623611
662 Ga0496113_0046727
663 Ga0496113_0391476
664 Ga0496114_0007610
665 Ga0496115_0236673
666 Ga0496115_0382930
667 Ga0496117_0290808
668 Ga0496118_0074913
669 Ga0496126_0008221
670 Ga0496126_0150513
671 nmdc:mga0n895_152402_c1
672 nmdc:mga08x19_109605_c1
673 Ga0495612_0079960
674 Ga0495595_0229819
675 Ga0500644_0047205
676 Ga0500644_0106313
677 Ga0500583_0006340
678 Ga0500651_0197336
679 Ga0500651_0393662
680 Ga0500641_0044063
681 Ga0500641_0052714
682 Ga0500556_0008340
683 Ga0500569_009357
684 Ga0500593_047917
685 Ga0500595_024352
686 Ga0500617_024151
687 Ga0500568_0050980
688 Ga0500568_0223487
689 Ga0500616_0000074
690 Ga0500616_0011901
691 Ga0500633_0091201
692 Ga0500636_0333830
693 Ga0466962_0000401
694 Ga0466962_0424905

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10003

DUF2244

Integral membrane protein (DUF2244)

10

78

0.94

PF10003

DUF2244

Integral membrane protein (DUF2244)

68

133

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5zu5-assembly1.cif.gz_A crystal structure of a full length alginate lyase with cbm domain 0.8459 72 99
7w12-assembly1.cif.gz_A complex structure of alginate lyase alyb-ou02 with g9 0.8423 72 99
2qzu-assembly1.cif.gz_A crystal structure of the putative sulfatase yidj from bacteroides fragilis. northeast structural genomics consortium target bfr123 0.7363 70 100
2a22-assembly1.cif.gz_A structure of vacuolar protein sorting 29 from cryptosporidium parvum 0.7345 72 99
2adz-assembly1.cif.gz_A solution structure of the joined ph domain of alpha1-syntrophin 0.7263 89 151
ID Description Score Start End Superfamily
af_Q86KL0_4_212_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.9294 72 99 1.20.140.150
af_Q54Q28_3_218_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.8883 72 99 1.20.140.150
af_Q9N3J6_1_183_3.80.10.10 Alpha Beta;Alpha-Beta Horseshoe;Leucine-rich repeat, LRR (right-handed beta-alpha superhelix);Ribonuclease Inhibitor 0.8195 72 99 3.80.10.10
af_Q966P3_27_236_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.819 72 100 1.20.140.150
af_Q960K3_7_221_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.8038 72 101 1.20.140.150
ID Description Score Start End GO Terms
AF-B8GPT5-F1-model_v4 DUF2244 domain-containing protein 0.9387 2 151 GO:0016020
AF-A0A2K8Y176-F1-model_v4 deleted 0.9385 6 149
AF-A0A523MRH8-F1-model_v4 DUF2244 domain-containing protein 0.9274 78 152
AF-A0A534IHF9-F1-model_v4 DUF2244 domain-containing protein 0.9227 1 160 GO:0016020
AF-A0A250L287-F1-model_v4 DUF2244 domain-containing protein 0.9225 8 153 GO:0016020

Map