F417005

General Info

Members Datasets Scaffolds Average Seq Length
347 199 694 227

Family's Representative Sequence

Representative Sequence 3300005293|Ga0065715_10116871|Ga0065715_101168712
Length 256
Sequence MLRRRCAFRRASRLRRAKPPARRHAFLTLFMNIAIIAAAGAGARMASDRPKQFLQLAGTPVIIHTLKVFEQCESINEVILVLPAAESAGFISLAAKFGLRKVARVVPGGVTRADSVKRGLMAIRAATAEIVAVHDGVRPFVTAEEIDLTVAAAQTDGAAILVAPVTDTIKQVTDRRIERTLDRGGLRRALTPQCFRYELLRDAYQQADVNDPSLTDESALVEQLGHVVSIVEGSARNIKITTVEDLAIAEAILATD

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
134 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
135 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
136 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
137 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
138 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
139 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
140 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
141 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
142 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
143 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
144 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
145 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
146 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
147 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
148 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
149 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
150 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
151 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
152 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
153 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
154 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
155 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
156 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
162 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
163 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
164 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
165 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
166 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
167 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
168 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
169 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
170 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
171 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
172 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
173 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
174 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
175 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
176 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
177 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
178 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
179 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
180 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
181 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
182 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
183 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
184 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
185 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
187 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
188 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
189 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
190 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
191 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
192 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
193 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
194 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
195 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
196 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
197 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
198 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
199 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.15
Rhizosphere 98.56
Stem 0
Stem Tuber 0
Unclassified 14.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10116871 3300005293 Bacteria 2365
2 CNAas_1000801 3300000532 Bacteria 2987
3 JGI24751J29686_10000071 3300002459 Bacteria 58417
4 JGI25406J46586_10017038 3300003203 Unclassified 3011
5 rootH2_10053774 3300003320 Unclassified 1436
6 Ga0065714_10064464 3300005288 Bacteria 65432
7 Ga0065712_10000137 3300005290 Bacteria 65446
8 Ga0065712_10191127 3300005290 Bacteria 1148
9 Ga0065715_10000563 3300005293 Bacteria 10247
10 Ga0065715_10022271 3300005293 Bacteria 1307
11 Ga0065715_10089347 3300005293 Bacteria 10986
12 Ga0065715_10100607 3300005293 Bacteria 3286
13 Ga0065715_10168991 3300005293 Bacteria 1562
14 Ga0065715_10210746 3300005293 Unclassified 1311
15 Ga0065707_10460293 3300005295 Unclassified 792
16 Ga0065707_10481639 3300005295 Bacteria 773
17 Ga0070690_100016042 3300005330 Bacteria 4479
18 Ga0070670_100000070 3300005331 Bacteria 103166
19 Ga0070670_100035075 3300005331 Bacteria 4317
20 Ga0070670_100071464 3300005331 Bacteria 2979
21 Ga0068869_100221944 3300005334 Bacteria 1498
22 Ga0070680_100012376 3300005336 Bacteria 6625
23 Ga0070680_100236095 3300005336 Bacteria 1545
24 Ga0070680_100595032 3300005336 Unclassified 949
25 Ga0070682_100003141 3300005337 Bacteria 9147
26 Ga0070682_100010482 3300005337 Bacteria 5261
27 Ga0068868_100015467 3300005338 Bacteria 5644
28 Ga0070689_100000879 3300005340 Bacteria 18723
29 Ga0070689_100108679 3300005340 Bacteria 2203
30 Ga0070687_100089260 3300005343 Bacteria 1701
31 Ga0070692_10008386 3300005345 Bacteria 4608
32 Ga0070692_10082214 3300005345 Bacteria 1736
33 Ga0070669_100024247 3300005353 Bacteria 4349
34 Ga0070673_100101951 3300005364 Bacteria 2365
35 Ga0070703_10000463 3300005406 Bacteria 16097
36 Ga0070709_10258579 3300005434 Bacteria 1257
37 Ga0070705_100002403 3300005440 Bacteria 9426
38 Ga0070700_100000283 3300005441 Bacteria 26787
39 Ga0070700_100007697 3300005441 Bacteria 5833
40 Ga0070700_100122930 3300005441 Bacteria 1742
41 Ga0070700_100153713 3300005441 Bacteria 1576
42 Ga0070700_100229064 3300005441 Bacteria 1321
43 Ga0070700_100306963 3300005441 Bacteria 1160
44 Ga0070700_100386881 3300005441 Bacteria 1048
45 Ga0070694_100017006 3300005444 Bacteria 4589
46 Ga0070694_100076990 3300005444 Bacteria 2310
47 Ga0070694_100166170 3300005444 Bacteria 1622
48 Ga0070662_100571757 3300005457 Bacteria 949
49 Ga0070681_10000108 3300005458 Bacteria 61616
50 Ga0070681_10002318 3300005458 Bacteria 17402
51 Ga0068867_100063368 3300005459 Bacteria 2747
52 Ga0068867_100133613 3300005459 Bacteria 1931
53 Ga0068867_100283428 3300005459 Bacteria 1359
54 Ga0068867_100369449 3300005459 Bacteria 1202
55 Ga0070707_100027017 3300005468 Bacteria 5456
56 Ga0070707_100663092 3300005468 Bacteria 1006
57 Ga0070698_100020419 3300005471 Bacteria 6943
58 Ga0070699_100008159 3300005518 Bacteria 9087
59 Ga0070699_100597982 3300005518 Unclassified 1006
60 Ga0070679_100000130 3300005530 Bacteria 60396
61 Ga0070679_100639124 3300005530 Bacteria 1007
62 Ga0070697_100031557 3300005536 Bacteria 4263
63 Ga0068853_100002741 3300005539 Bacteria 13300
64 Ga0070672_100575238 3300005543 Unclassified 980
65 Ga0070686_100001061 3300005544 Bacteria 15853
66 Ga0070695_100036774 3300005545 Bacteria 3082
67 Ga0070695_100167649 3300005545 Bacteria 1547
68 Ga0070696_100177009 3300005546 Bacteria 1580
69 Ga0070693_100003344 3300005547 Bacteria 7454
70 Ga0070693_100107138 3300005547 Bacteria 1712
71 Ga0070693_100202024 3300005547 Bacteria 1291
72 Ga0070704_100015994 3300005549 Bacteria 4728
73 Ga0070704_100114463 3300005549 Bacteria 2059
74 Ga0070704_100176048 3300005549 Bacteria 1706
75 Ga0068857_100250675 3300005577 Bacteria 1623
76 Ga0068857_100375395 3300005577 Bacteria 1319
77 Ga0068857_100701054 3300005577 Unclassified 962
78 Ga0068854_100053886 3300005578 Bacteria 2890
79 Ga0070702_100002516 3300005615 Bacteria 7948
80 Ga0070702_100075515 3300005615 Bacteria 2003
81 Ga0070702_100081749 3300005615 Bacteria 1937
82 Ga0068859_100015477 3300005617 Bacteria 7663
83 Ga0068859_100057048 3300005617 Bacteria 3933
84 Ga0068859_100079641 3300005617 Bacteria 3316
85 Ga0068859_100102121 3300005617 Bacteria 2925
86 Ga0068864_100325039 3300005618 Bacteria 1445
87 Ga0068864_100681994 3300005618 Bacteria 1002
88 Ga0068866_10007320 3300005718 Bacteria 4620
89 Ga0068866_10336943 3300005718 Bacteria 954
90 Ga0068861_100061649 3300005719 Bacteria 2879
91 Ga0068861_100138328 3300005719 Bacteria 1984
92 Ga0068851_10011096 3300005834 Bacteria 4220
93 Ga0068863_100364396 3300005841 Bacteria 1409
94 Ga0068863_100419085 3300005841 Bacteria 1311
95 Ga0068863_100697907 3300005841 Unclassified 1008
96 Ga0068858_100025494 3300005842 Bacteria 5501
97 Ga0068858_100089182 3300005842 Bacteria 2869
98 Ga0068860_100057077 3300005843 Bacteria 3710
99 Ga0068860_100226425 3300005843 Bacteria 1816
100 Ga0068862_100043437 3300005844 Bacteria 3832
101 Ga0068862_100212714 3300005844 Unclassified 1747
102 Ga0081455_10203552 3300005937 Bacteria 1480
103 Ga0081539_10003141 3300005985 Bacteria 21027
104 Ga0081539_10213651 3300005985 Unclassified 882
105 Ga0070715_10000005 3300006163 Bacteria 298716
106 Ga0075431_100076204 3300006847 Bacteria 3461
107 Ga0075433_10068604 3300006852 Bacteria 3113
108 Ga0075433_10081240 3300006852 Bacteria 2857
109 Ga0075433_10115804 3300006852 Bacteria 2378
110 Ga0075433_10300732 3300006852 Bacteria 1421
111 Ga0075434_100008484 3300006871 Bacteria 9560
112 Ga0075434_100104802 3300006871 Bacteria 2838
113 Ga0075429_100218730 3300006880 Unclassified 1669
114 Ga0075436_100000221 3300006914 Bacteria 35387
115 Ga0097620_100015476 3300006931 Bacteria 7663
116 Ga0097620_100057048 3300006931 Bacteria 3933
117 Ga0097620_100079641 3300006931 Bacteria 3316
118 Ga0097620_100102119 3300006931 Bacteria 2925
119 Ga0075435_100008902 3300007076 Bacteria 7233
120 Ga0075435_100019845 3300007076 Bacteria 5142
121 Ga0105251_10052215 3300009011 Bacteria 1947
122 Ga0105251_10140829 3300009011 Bacteria 1091
123 Ga0105240_10024057 3300009093 Bacteria 8043
124 Ga0105240_10435671 3300009093 Bacteria 1470
125 Ga0111539_10004231 3300009094 Bacteria 18817
126 Ga0111539_10006298 3300009094 Bacteria 15318
127 Ga0111539_10672266 3300009094 Bacteria 1206
128 Ga0111539_10789115 3300009094 Bacteria 1105
129 Ga0105245_10978646 3300009098 Unclassified 890
130 Ga0105247_10005644 3300009101 Bacteria 7846
131 Ga0105247_10258065 3300009101 Bacteria 1194
132 Ga0105247_10296109 3300009101 Unclassified 1121
133 Ga0114129_10052597 3300009147 Bacteria 5716
134 Ga0114129_10103513 3300009147 Bacteria 3936
135 Ga0114129_10568146 3300009147 Bacteria 1473
136 Ga0114129_10858928 3300009147 Unclassified 1153
137 Ga0105243_10124895 3300009148 Bacteria 2175
138 Ga0105243_10161559 3300009148 Bacteria 1932
139 Ga0105243_10288611 3300009148 Bacteria 1481
140 Ga0105243_10771486 3300009148 Bacteria 945
141 Ga0105241_10049867 3300009174 Bacteria 3190
142 Ga0105241_10124680 3300009174 Bacteria 2079
143 Ga0105242_10296286 3300009176 Bacteria 1475
144 Ga0105242_10422457 3300009176 Bacteria 1249
145 Ga0105248_10000847 3300009177 Bacteria 34381
146 Ga0105248_10719385 3300009177 Bacteria 1126
147 Ga0105237_10001294 3300009545 Bacteria 33284
148 Ga0105237_10082776 3300009545 Bacteria 3200
149 Ga0105237_10216484 3300009545 Bacteria 1915
150 Ga0105238_10011099 3300009551 Bacteria 9055
151 Ga0105238_10038762 3300009551 Bacteria 4838
152 Ga0105249_10010527 3300009553 Bacteria 8124
153 Ga0105249_10017048 3300009553 Bacteria 6446
154 Ga0105249_10788637 3300009553 Bacteria 1014
155 Ga0105239_10504144 3300010375 Bacteria 1376
156 Ga0105239_10678184 3300010375 Bacteria 1178
157 Ga0105239_11240947 3300010375 Unclassified 859
158 Ga0105246_10969443 3300011119 Unclassified 768
159 Ga0157373_10067415 3300013100 Bacteria 2531
160 Ga0157378_10098324 3300013297 Bacteria 2668
161 Ga0157378_10172180 3300013297 Bacteria 2031
162 Ga0163162_10292255 3300013306 Bacteria 1761
163 Ga0157372_10053602 3300013307 Bacteria 4496
164 Ga0157372_10429349 3300013307 Bacteria 1540
165 Ga0157372_10879435 3300013307 Bacteria 1040
166 Ga0157375_10319287 3300013308 Bacteria 1718
167 Ga0163163_10318439 3300014325 Bacteria 1609
168 Ga0163163_10530544 3300014325 Unclassified 1239
169 Ga0157380_10002737 3300014326 Bacteria 11973
170 Ga0157380_10541437 3300014326 Bacteria 1140
171 Ga0157377_10090698 3300014745 Bacteria 1804
172 Ga0157379_10479149 3300014968 Unclassified 1151
173 Ga0182007_10039543 3300015262 Bacteria 1578
174 Ga0163161_10158641 3300017792 Bacteria 1724
175 Ga0207656_10004005 3300025321 Bacteria 5108
176 Ga0207653_10000545 3300025885 Bacteria 13919
177 Ga0207642_10081130 3300025899 Bacteria 1575
178 Ga0207710_10005431 3300025900 Bacteria 5490
179 Ga0207647_10015356 3300025904 Bacteria 5251
180 Ga0207685_10000020 3300025905 Bacteria 138584
181 Ga0207699_10184839 3300025906 Bacteria 1403
182 Ga0207645_10094984 3300025907 Bacteria 1920
183 Ga0207643_10008755 3300025908 Bacteria 5431
184 Ga0207643_10116097 3300025908 Bacteria 1581
185 Ga0207684_10000117 3300025910 Bacteria 148207
186 Ga0207654_10225483 3300025911 Unclassified 1245
187 Ga0207654_10287040 3300025911 Bacteria 1115
188 Ga0207707_10000013 3300025912 Bacteria 264517
189 Ga0207707_10002535 3300025912 Bacteria 16393
190 Ga0207695_10354347 3300025913 Unclassified 1354
191 Ga0207695_10588973 3300025913 Unclassified 993
192 Ga0207671_10001043 3300025914 Bacteria 33697
193 Ga0207671_10270114 3300025914 Bacteria 1340
194 Ga0207660_10104682 3300025917 Bacteria 2119
195 Ga0207662_10162771 3300025918 Unclassified 1426
196 Ga0207652_10000071 3300025921 Bacteria 109636
197 Ga0207652_10434010 3300025921 Bacteria 1184
198 Ga0207681_10027391 3300025923 Bacteria 3684
199 Ga0207681_10052755 3300025923 Bacteria 2758
200 Ga0207694_10006513 3300025924 Bacteria 8885
201 Ga0207694_10171211 3300025924 Bacteria 1758
202 Ga0207650_10000017 3300025925 Bacteria 354674
203 Ga0207650_10047315 3300025925 Bacteria 3169
204 Ga0207650_10052763 3300025925 Bacteria 3012
205 Ga0207650_10556881 3300025925 Bacteria 961
206 Ga0207659_10084543 3300025926 Bacteria 2355
207 Ga0207706_10209667 3300025933 Bacteria 1708
208 Ga0207706_10236786 3300025933 Bacteria 1596
209 Ga0207706_10249745 3300025933 Bacteria 1550
210 Ga0207686_10053776 3300025934 Bacteria 2519
211 Ga0207686_10148233 3300025934 Unclassified 1630
212 Ga0207709_10002707 3300025935 Bacteria 10955
213 Ga0207709_10220365 3300025935 Bacteria 1368
214 Ga0207709_10284701 3300025935 Bacteria 1222
215 Ga0207670_10005493 3300025936 Bacteria 6967
216 Ga0207670_10461331 3300025936 Unclassified 1026
217 Ga0207704_10496537 3300025938 Bacteria 983
218 Ga0207665_10166909 3300025939 Bacteria 1587
219 Ga0207711_10050475 3300025941 Bacteria 3561
220 Ga0207711_10078721 3300025941 Bacteria 2876
221 Ga0207711_10324484 3300025941 Bacteria 1423
222 Ga0207711_10552492 3300025941 Bacteria 1074
223 Ga0207689_10157012 3300025942 Bacteria 1875
224 Ga0207689_10479232 3300025942 Unclassified 1042
225 Ga0207689_10645861 3300025942 Unclassified 891
226 Ga0207689_10760132 3300025942 Unclassified 818
227 Ga0207651_10259948 3300025960 Bacteria 1425
228 Ga0207712_10328209 3300025961 Bacteria 1265
229 Ga0207640_10067585 3300025981 Bacteria 2392
230 Ga0207677_10036010 3300026023 Bacteria 3220
231 Ga0207703_10279771 3300026035 Bacteria 1515
232 Ga0207703_10495137 3300026035 Unclassified 1147
233 Ga0207639_10011950 3300026041 Bacteria 6041
234 Ga0207639_10520317 3300026041 Bacteria 1089
235 Ga0207639_11039557 3300026041 Unclassified 767
236 Ga0207708_10000057 3300026075 Bacteria 97103
237 Ga0207708_10005423 3300026075 Bacteria 9399
238 Ga0207708_10022396 3300026075 Bacteria 4771
239 Ga0207708_10092132 3300026075 Bacteria 2338
240 Ga0207708_10299184 3300026075 Bacteria 1308
241 Ga0207641_10112781 3300026088 Bacteria 2413
242 Ga0207648_10069053 3300026089 Bacteria 3079
243 Ga0207648_10073023 3300026089 Bacteria 2990
244 Ga0207648_10088986 3300026089 Bacteria 2696
245 Ga0207648_10096366 3300026089 Bacteria 2589
246 Ga0207676_10284943 3300026095 Bacteria 1501
247 Ga0207674_10155293 3300026116 Bacteria 2244
248 Ga0207674_10405761 3300026116 Bacteria 1317
249 Ga0207674_10591716 3300026116 Unclassified 1072
250 Ga0207674_10635986 3300026116 Unclassified 1030
251 Ga0207675_100086147 3300026118 Bacteria 2950
252 Ga0207675_100095813 3300026118 Bacteria 2793
253 Ga0207675_100116260 3300026118 Bacteria 2528
254 Ga0207675_100146239 3300026118 Bacteria 2247
255 Ga0207698_10250834 3300026142 Unclassified 1619
256 Ga0207698_10686137 3300026142 Unclassified 1018
257 Ga0207428_10002259 3300027907 Bacteria 19342
258 Ga0207428_10014377 3300027907 Bacteria 6880
259 Ga0268265_10393348 3300028380 Bacteria 1279
260 Ga0268265_10609385 3300028380 Bacteria 1045
261 Ga0268264_10068897 3300028381 Bacteria 2991
262 Ga0268264_10103372 3300028381 Bacteria 2481
263 Ga0268264_10301911 3300028381 Bacteria 1508
264 Ga0307408_100079596 3300031548 Bacteria 2445
265 Ga0307405_10028182 3300031731 Bacteria 3268
266 Ga0307413_10027108 3300031824 Bacteria 3169
267 Ga0307410_10010965 3300031852 Bacteria 5162
268 Ga0307406_10057185 3300031901 Bacteria 2501
269 Ga0307407_10043732 3300031903 Bacteria 2520
270 Ga0307412_10018093 3300031911 Bacteria 4231
271 Ga0307414_10074592 3300032004 Bacteria 2458
272 Ga0307411_10049089 3300032005 Bacteria 2740
273 Ga0307415_100104056 3300032126 Bacteria 2090
274 Ga0373940_0005162 3300035088 Bacteria 2813
275 Ga0373951_0000593 3300035091 Bacteria 9982
276 Ga0373951_0045803 3300035091 Unclassified 1065
277 Ga0373941_0023887 3300035115 Bacteria 1750
278 Ga0395901_0514540 3300038443 Bacteria 1217
279 Ga0439455_0016955 3300042012 Unclassified 1691
280 Ga0439458_0007800 3300042157 Bacteria 2383
281 Ga0496107_0218746 3300048910 Bacteria 1417
282 Ga0496110_0106685 3300048913 Bacteria 2514
283 Ga0496112_0225823 3300048915 Bacteria 1828
284 Ga0496113_0259988 3300048916 Bacteria 1387
285 Ga0501291_001675 3300049514 Bacteria 2584
286 Ga0501298_005604 3300049521 Bacteria 2021
287 Ga0501298_070195 3300049521 Unclassified 755
288 Ga0501299_036680 3300049522 Unclassified 968
289 Ga0501036_0496321 3300049572 Bacteria 1016
290 Ga0501037_0082901 3300049573 Bacteria 2323
291 Ga0501037_0282197 3300049573 Bacteria 1157
292 Ga0501039_0099852 3300049575 Bacteria 2265
293 Ga0501040_0104960 3300049576 Bacteria 1974
294 Ga0501040_0285124 3300049576 Bacteria 1180
295 Ga0501041_0553594 3300049577 Bacteria 733
296 Ga0501071_0033111 3300049587 Bacteria 3672
297 Ga0501072_0023800 3300049588 Bacteria 4758
298 Ga0501075_0078186 3300049591 Bacteria 2504
299 Ga0501206_013491 3300049653 Bacteria 1117
300 Ga0501207_000342 3300049654 Bacteria 5025
301 Ga0501209_008498 3300049656 Bacteria 2028
302 Ga0501216_042825 3300049660 Unclassified 870
303 Ga0501217_000550 3300049661 Bacteria 6273
304 Ga0501217_010171 3300049661 Bacteria 2057
305 Ga0501223_002648 3300049663 Bacteria 3945
306 Ga0501224_005324 3300049664 Bacteria 1841
307 Ga0501227_003124 3300049665 Bacteria 3599
308 Ga0501227_045967 3300049665 Unclassified 1091
309 Ga0501230_012084 3300049667 Bacteria 1377
310 Ga0501233_039535 3300049668 Bacteria 1103
311 Ga0501235_011585 3300049669 Bacteria 1934
312 Ga0501249_006429 3300049679 Bacteria 2416
313 Ga0501257_033547 3300049686 Unclassified 1244
314 Ga0501225_0012501 3300049705 Bacteria 2384
315 Ga0501229_003024 3300049706 Bacteria 2000
316 Ga0501234_000348 3300049707 Bacteria 6852
317 Ga0501079_0038380 3300049741 Bacteria 3693
318 Ga0501079_0044424 3300049741 Bacteria 3429
319 Ga0501080_0001892 3300049742 Bacteria 18029
320 Ga0501081_0076067 3300049743 Bacteria 2344
321 Ga0501268_011795 3300049765 Unclassified 1386
322 Ga0501270_053040 3300049767 Unclassified 740
323 Ga0501035_0520620 3300049822 Bacteria 977
324 Ga0501204_027756 3300049850 Unclassified 772
325 Ga0501212_007039 3300049851 Bacteria 1531
326 Ga0501226_007397 3300049853 Unclassified 1232
327 nmdc:mga05p37_1023914_c1 3300050507 Bacteria 874
328 nmdc:mga05p37_53859_c1 3300050507 Bacteria 4949
329 nmdc:mga05p37_83287_c1 3300050507 Bacteria 3940
330 nmdc:mga05p37_977305_c1 3300050507 Unclassified 902
331 nmdc:mga09592_154663_c1 3300050508 Bacteria 1979
332 nmdc:mga09592_266520_c1 3300050508 Bacteria 1486
333 nmdc:mga0qj67_61614_c1 3300050509 Bacteria 2979
334 nmdc:mga06r32_699900_c1 3300050510 Unclassified 979
335 nmdc:mga08y16_1096224_c1 3300050511 Unclassified 771
336 nmdc:mga08y16_163650_c1 3300050511 Bacteria 2311
337 nmdc:mga08y16_16471_c1 3300050511 Bacteria 7774
338 nmdc:mga08y16_2220_c1 3300050511 Bacteria 19906
339 nmdc:mga0n895_57872_c1 3300050512 Bacteria 3821
340 nmdc:mga0rr50_308_c1 3300050513 Bacteria 14520
341 nmdc:mga08x19_8_c1 3300050514 Bacteria 427794
342 nmdc:mga0a205_109281_c1 3300050515 Bacteria 2664
343 nmdc:mga0a205_135713_c1 3300050515 Bacteria 2361
344 nmdc:mga0a205_328426_c1 3300050515 Bacteria 1399
345 nmdc:mga0a205_618441_c1 3300050515 Unclassified 936
346 Ga0501084_0072636 3300054114 Bacteria 2882
347 Ga0530510_0073140 3300061734 Bacteria 2488
348 Ga0065715_10116871
349 CNAas_1000801
350 JGI24751J29686_10000071
351 JGI25406J46586_10017038
352 rootH2_10053774
353 Ga0065714_10064464
354 Ga0065712_10000137
355 Ga0065712_10191127
356 Ga0065715_10000563
357 Ga0065715_10022271
358 Ga0065715_10089347
359 Ga0065715_10100607
360 Ga0065715_10168991
361 Ga0065715_10210746
362 Ga0065707_10460293
363 Ga0065707_10481639
364 Ga0070690_100016042
365 Ga0070670_100000070
366 Ga0070670_100035075
367 Ga0070670_100071464
368 Ga0068869_100221944
369 Ga0070680_100012376
370 Ga0070680_100236095
371 Ga0070680_100595032
372 Ga0070682_100003141
373 Ga0070682_100010482
374 Ga0068868_100015467
375 Ga0070689_100000879
376 Ga0070689_100108679
377 Ga0070687_100089260
378 Ga0070692_10008386
379 Ga0070692_10082214
380 Ga0070669_100024247
381 Ga0070673_100101951
382 Ga0070703_10000463
383 Ga0070709_10258579
384 Ga0070705_100002403
385 Ga0070700_100000283
386 Ga0070700_100007697
387 Ga0070700_100122930
388 Ga0070700_100153713
389 Ga0070700_100229064
390 Ga0070700_100306963
391 Ga0070700_100386881
392 Ga0070694_100017006
393 Ga0070694_100076990
394 Ga0070694_100166170
395 Ga0070662_100571757
396 Ga0070681_10000108
397 Ga0070681_10002318
398 Ga0068867_100063368
399 Ga0068867_100133613
400 Ga0068867_100283428
401 Ga0068867_100369449
402 Ga0070707_100027017
403 Ga0070707_100663092
404 Ga0070698_100020419
405 Ga0070699_100008159
406 Ga0070699_100597982
407 Ga0070679_100000130
408 Ga0070679_100639124
409 Ga0070697_100031557
410 Ga0068853_100002741
411 Ga0070672_100575238
412 Ga0070686_100001061
413 Ga0070695_100036774
414 Ga0070695_100167649
415 Ga0070696_100177009
416 Ga0070693_100003344
417 Ga0070693_100107138
418 Ga0070693_100202024
419 Ga0070704_100015994
420 Ga0070704_100114463
421 Ga0070704_100176048
422 Ga0068857_100250675
423 Ga0068857_100375395
424 Ga0068857_100701054
425 Ga0068854_100053886
426 Ga0070702_100002516
427 Ga0070702_100075515
428 Ga0070702_100081749
429 Ga0068859_100015477
430 Ga0068859_100057048
431 Ga0068859_100079641
432 Ga0068859_100102121
433 Ga0068864_100325039
434 Ga0068864_100681994
435 Ga0068866_10007320
436 Ga0068866_10336943
437 Ga0068861_100061649
438 Ga0068861_100138328
439 Ga0068851_10011096
440 Ga0068863_100364396
441 Ga0068863_100419085
442 Ga0068863_100697907
443 Ga0068858_100025494
444 Ga0068858_100089182
445 Ga0068860_100057077
446 Ga0068860_100226425
447 Ga0068862_100043437
448 Ga0068862_100212714
449 Ga0081455_10203552
450 Ga0081539_10003141
451 Ga0081539_10213651
452 Ga0070715_10000005
453 Ga0075431_100076204
454 Ga0075433_10068604
455 Ga0075433_10081240
456 Ga0075433_10115804
457 Ga0075433_10300732
458 Ga0075434_100008484
459 Ga0075434_100104802
460 Ga0075429_100218730
461 Ga0075436_100000221
462 Ga0097620_100015476
463 Ga0097620_100057048
464 Ga0097620_100079641
465 Ga0097620_100102119
466 Ga0075435_100008902
467 Ga0075435_100019845
468 Ga0105251_10052215
469 Ga0105251_10140829
470 Ga0105240_10024057
471 Ga0105240_10435671
472 Ga0111539_10004231
473 Ga0111539_10006298
474 Ga0111539_10672266
475 Ga0111539_10789115
476 Ga0105245_10978646
477 Ga0105247_10005644
478 Ga0105247_10258065
479 Ga0105247_10296109
480 Ga0114129_10052597
481 Ga0114129_10103513
482 Ga0114129_10568146
483 Ga0114129_10858928
484 Ga0105243_10124895
485 Ga0105243_10161559
486 Ga0105243_10288611
487 Ga0105243_10771486
488 Ga0105241_10049867
489 Ga0105241_10124680
490 Ga0105242_10296286
491 Ga0105242_10422457
492 Ga0105248_10000847
493 Ga0105248_10719385
494 Ga0105237_10001294
495 Ga0105237_10082776
496 Ga0105237_10216484
497 Ga0105238_10011099
498 Ga0105238_10038762
499 Ga0105249_10010527
500 Ga0105249_10017048
501 Ga0105249_10788637
502 Ga0105239_10504144
503 Ga0105239_10678184
504 Ga0105239_11240947
505 Ga0105246_10969443
506 Ga0157373_10067415
507 Ga0157378_10098324
508 Ga0157378_10172180
509 Ga0163162_10292255
510 Ga0157372_10053602
511 Ga0157372_10429349
512 Ga0157372_10879435
513 Ga0157375_10319287
514 Ga0163163_10318439
515 Ga0163163_10530544
516 Ga0157380_10002737
517 Ga0157380_10541437
518 Ga0157377_10090698
519 Ga0157379_10479149
520 Ga0182007_10039543
521 Ga0163161_10158641
522 Ga0207656_10004005
523 Ga0207653_10000545
524 Ga0207642_10081130
525 Ga0207710_10005431
526 Ga0207647_10015356
527 Ga0207685_10000020
528 Ga0207699_10184839
529 Ga0207645_10094984
530 Ga0207643_10008755
531 Ga0207643_10116097
532 Ga0207684_10000117
533 Ga0207654_10225483
534 Ga0207654_10287040
535 Ga0207707_10000013
536 Ga0207707_10002535
537 Ga0207695_10354347
538 Ga0207695_10588973
539 Ga0207671_10001043
540 Ga0207671_10270114
541 Ga0207660_10104682
542 Ga0207662_10162771
543 Ga0207652_10000071
544 Ga0207652_10434010
545 Ga0207681_10027391
546 Ga0207681_10052755
547 Ga0207694_10006513
548 Ga0207694_10171211
549 Ga0207650_10000017
550 Ga0207650_10047315
551 Ga0207650_10052763
552 Ga0207650_10556881
553 Ga0207659_10084543
554 Ga0207706_10209667
555 Ga0207706_10236786
556 Ga0207706_10249745
557 Ga0207686_10053776
558 Ga0207686_10148233
559 Ga0207709_10002707
560 Ga0207709_10220365
561 Ga0207709_10284701
562 Ga0207670_10005493
563 Ga0207670_10461331
564 Ga0207704_10496537
565 Ga0207665_10166909
566 Ga0207711_10050475
567 Ga0207711_10078721
568 Ga0207711_10324484
569 Ga0207711_10552492
570 Ga0207689_10157012
571 Ga0207689_10479232
572 Ga0207689_10645861
573 Ga0207689_10760132
574 Ga0207651_10259948
575 Ga0207712_10328209
576 Ga0207640_10067585
577 Ga0207677_10036010
578 Ga0207703_10279771
579 Ga0207703_10495137
580 Ga0207639_10011950
581 Ga0207639_10520317
582 Ga0207639_11039557
583 Ga0207708_10000057
584 Ga0207708_10005423
585 Ga0207708_10022396
586 Ga0207708_10092132
587 Ga0207708_10299184
588 Ga0207641_10112781
589 Ga0207648_10069053
590 Ga0207648_10073023
591 Ga0207648_10088986
592 Ga0207648_10096366
593 Ga0207676_10284943
594 Ga0207674_10155293
595 Ga0207674_10405761
596 Ga0207674_10591716
597 Ga0207674_10635986
598 Ga0207675_100086147
599 Ga0207675_100095813
600 Ga0207675_100116260
601 Ga0207675_100146239
602 Ga0207698_10250834
603 Ga0207698_10686137
604 Ga0207428_10002259
605 Ga0207428_10014377
606 Ga0268265_10393348
607 Ga0268265_10609385
608 Ga0268264_10068897
609 Ga0268264_10103372
610 Ga0268264_10301911
611 Ga0307408_100079596
612 Ga0307405_10028182
613 Ga0307413_10027108
614 Ga0307410_10010965
615 Ga0307406_10057185
616 Ga0307407_10043732
617 Ga0307412_10018093
618 Ga0307414_10074592
619 Ga0307411_10049089
620 Ga0307415_100104056
621 Ga0373940_0005162
622 Ga0373951_0000593
623 Ga0373951_0045803
624 Ga0373941_0023887
625 Ga0395901_0514540
626 Ga0439455_0016955
627 Ga0439458_0007800
628 Ga0496107_0218746
629 Ga0496110_0106685
630 Ga0496112_0225823
631 Ga0496113_0259988
632 Ga0501291_001675
633 Ga0501298_005604
634 Ga0501298_070195
635 Ga0501299_036680
636 Ga0501036_0496321
637 Ga0501037_0082901
638 Ga0501037_0282197
639 Ga0501039_0099852
640 Ga0501040_0104960
641 Ga0501040_0285124
642 Ga0501041_0553594
643 Ga0501071_0033111
644 Ga0501072_0023800
645 Ga0501075_0078186
646 Ga0501206_013491
647 Ga0501207_000342
648 Ga0501209_008498
649 Ga0501216_042825
650 Ga0501217_000550
651 Ga0501217_010171
652 Ga0501223_002648
653 Ga0501224_005324
654 Ga0501227_003124
655 Ga0501227_045967
656 Ga0501230_012084
657 Ga0501233_039535
658 Ga0501235_011585
659 Ga0501249_006429
660 Ga0501257_033547
661 Ga0501225_0012501
662 Ga0501229_003024
663 Ga0501234_000348
664 Ga0501079_0038380
665 Ga0501079_0044424
666 Ga0501080_0001892
667 Ga0501081_0076067
668 Ga0501268_011795
669 Ga0501270_053040
670 Ga0501035_0520620
671 Ga0501204_027756
672 Ga0501212_007039
673 Ga0501226_007397
674 nmdc:mga05p37_1023914_c1
675 nmdc:mga05p37_53859_c1
676 nmdc:mga05p37_83287_c1
677 nmdc:mga05p37_977305_c1
678 nmdc:mga09592_154663_c1
679 nmdc:mga09592_266520_c1
680 nmdc:mga0qj67_61614_c1
681 nmdc:mga06r32_699900_c1
682 nmdc:mga08y16_1096224_c1
683 nmdc:mga08y16_163650_c1
684 nmdc:mga08y16_16471_c1
685 nmdc:mga08y16_2220_c1
686 nmdc:mga0n895_57872_c1
687 nmdc:mga0rr50_308_c1
688 nmdc:mga08x19_8_c1
689 nmdc:mga0a205_109281_c1
690 nmdc:mga0a205_135713_c1
691 nmdc:mga0a205_328426_c1
692 nmdc:mga0a205_618441_c1
693 Ga0501084_0072636
694 Ga0530510_0073140

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01128

IspD

2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase

32

255

0.97

PF12804

NTP_transf_3

MobA-like NTP transferase domain

34

226

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
2xwm-assembly1.cif.gz_A crystal structure of ispd from mycobacterium smegmatis in complex with cmp 0.9168 1 225
3okr-assembly2.cif.gz_D structure of mtb apo 2-c-methyl-d-erythritol 4-phosphate cytidyltransferase (ispd) 0.9142 1 224
4nai-assembly1.cif.gz_A-2 arabidopsis thaliana ispd apo 0.9097 3 224
5hs2-assembly1.cif.gz_A crystal structure of ispd complexed with ctp and mg2+ from bacillus subtilis at 1.90 angstroms resolution 0.9095 2 225
1vpa-assembly1.cif.gz_B crystal structure of 2-c-methyl-d-erythritol 4-phosphate cytidylyltransferase (tm1393) from thermotoga maritima at 2.67 a resolution 0.9091 1 225
ID Description Score Start End Superfamily
af_B4FP01_68_298_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9268 2 225 3.90.550.10
1vpaB00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9091 1 225 3.90.550.10
4kt7B00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9076 2 224 3.90.550.10
3okrA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9035 2 224 3.90.550.10
af_A0A0P0VBA2_1_174_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8977 58 225 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A831T3Y0-F1-model_v4 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (EC 2.7.7.60) (4-diphosphocytidyl-2C-methyl-D-erythritol synthase) (MEP cytidylyltransferase) (MCT) 0.9654 1 227 GO:0019288
GO:0050518
AF-A0A2V8PFF5-F1-model_v4 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (EC 2.7.7.60) (4-diphosphocytidyl-2C-methyl-D-erythritol synthase) (MEP cytidylyltransferase) (MCT) 0.9648 1 224 GO:0019288
GO:0050518
AF-A0A537LG15-F1-model_v4 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (EC 2.7.7.60) 0.9636 2 221 GO:0008685
GO:0016114
GO:0050518
AF-A0A7C2GTW3-F1-model_v4 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (EC 2.7.7.60) (4-diphosphocytidyl-2C-methyl-D-erythritol synthase) (MEP cytidylyltransferase) (MCT) 0.9621 2 227 GO:0019288
GO:0050518
AF-A0A7W1W5V5-F1-model_v4 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase 0.9614 47 225 GO:0050518

Map