F416952

General Info

Members Datasets Scaffolds Average Seq Length
346 324 692 183

Family's Representative Sequence

Representative Sequence 3300053162|Ga0500638_172754|Ga0500638_172754_175_792
Length 205
Sequence MMLAGRDRSGRDIVMCIREEFDMTTLLGISGSLRAQSFNTSLLRAAQSLAPPGVTLEAATLHGIPLYDGDTEQRDGIPMAVAELKERIVASDGVLLVTPEYNNGVPGVFKNAIDWLSRPAADIPRVFGNRPFALIGASPGGFGTILAQNGWLPVLRTLGTRYWSGGRLMVSRAHQAFDENGAIRDEALRKQLGDFLRGFAQFAAA

Samples

Sample ID Description Type Environment
1 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
7 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
8 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
9 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
10 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
11 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
12 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
13 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
14 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
15 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
16 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
17 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
18 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
19 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
20 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
21 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
22 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
23 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
24 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
25 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
35 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
36 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
38 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
39 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
40 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
41 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
42 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
43 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
44 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
45 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
46 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
47 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
48 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
49 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
50 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
51 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
52 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
53 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
54 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
55 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
56 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
57 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
58 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
59 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
60 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
61 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
62 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
63 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
64 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
65 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
66 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
67 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
68 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
69 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
70 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
71 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
72 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
73 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
74 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
75 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
76 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
77 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
78 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
79 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
80 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
81 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
82 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
83 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
84 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
85 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
86 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
87 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
89 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
92 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
93 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
94 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
95 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
96 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
97 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
99 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
100 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
101 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
102 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
103 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
104 2509276019 Ensifer aridi TW10 Isolate Nodule
105 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
106 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
107 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
108 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
109 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
110 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
111 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
112 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
113 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
114 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
115 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
116 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
117 2516143018 Ensifer sp. BR816 Isolate Nodule
118 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
119 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
120 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
121 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
122 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
123 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
124 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
125 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
126 2643221695 Lysobacter sp. Root494 Isolate Unclassified
127 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
128 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
129 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
130 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
131 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
132 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
133 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
134 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
135 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
136 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
137 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
138 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
139 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
140 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
141 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
142 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
143 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
144 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
145 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
146 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
147 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
148 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
149 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
150 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
151 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
152 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
153 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
154 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
155 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
156 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
157 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
158 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
159 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
160 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
161 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
162 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
163 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
164 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
165 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
166 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
167 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
168 2919675420 Luteimonas terrae 4099 Isolate Unclassified
169 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
170 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
171 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
172 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
173 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
174 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
175 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
176 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
177 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
178 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
179 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
180 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
181 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
182 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
183 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
184 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
185 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
186 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
187 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
188 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
189 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
190 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
191 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
192 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
193 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
194 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
195 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
196 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
197 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
198 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
199 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
200 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
201 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
202 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
203 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
204 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
205 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
206 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
207 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
208 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
209 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
210 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
211 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
212 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
213 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
214 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
215 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
216 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
217 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
218 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
219 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
220 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
221 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
222 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
223 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
224 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
225 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
226 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
227 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
228 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
229 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
230 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
231 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
232 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
233 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
234 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
235 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
236 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
237 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
238 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
239 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
240 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
241 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
242 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
243 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
244 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
245 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
246 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
247 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
248 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
249 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
250 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
251 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
252 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
253 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
254 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
255 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
256 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
257 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
258 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
259 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
260 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
261 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
262 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
263 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
264 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
265 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
266 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
267 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
268 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
269 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
270 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
271 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
272 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
273 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
274 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
275 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
276 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
277 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
278 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
279 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
280 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
281 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
282 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
283 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
284 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
285 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
286 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
287 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
288 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
289 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
290 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
291 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
292 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
293 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
294 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
295 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
296 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
297 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
298 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
299 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
300 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
301 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
302 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
303 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
304 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
305 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
306 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
307 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
308 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
309 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
310 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
311 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
312 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
313 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
314 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
315 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
316 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
317 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
318 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
319 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
320 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
321 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
322 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
323 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
324 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 35.55
Metatranscriptomes 0
Isolates 64.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.31
Nodule 61.85
Rhizoplane 2.31
Rhizosphere 25.72
Stem 0
Stem Tuber 0
Unclassified 0.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500638_172754 3300053162 Bacteria 940
2 rootH2_10183721 3300003320 Bacteria 1428
3 Ga0070670_101040743 3300005331 Bacteria 745
4 Ga0070666_10648621 3300005335 Bacteria 772
5 Ga0070682_100352908 3300005337 Bacteria 1097
6 Ga0070678_100637546 3300005456 Bacteria 955
7 Ga0068867_100581915 3300005459 Bacteria 974
8 Ga0068853_100000431 3300005539 Bacteria 28645
9 Ga0068853_100005264 3300005539 Bacteria 10126
10 Ga0070665_100031587 3300005548 Bacteria 5331
11 Ga0068855_100012183 3300005563 Bacteria 10392
12 Ga0068855_100085025 3300005563 Bacteria 3661
13 Ga0068857_100131849 3300005577 Bacteria 2254
14 Ga0068857_100535788 3300005577 Bacteria 1102
15 Ga0068852_100042986 3300005616 Bacteria 3830
16 Ga0081455_10533017 3300005937 Bacteria 781
17 Ga0075364_10012526 3300006051 Bacteria 5191
18 Ga0079104_1020997 3300006946 Bacteria 1786
19 Ga0105241_10130582 3300009174 Bacteria 2033
20 Ga0105239_10003689 3300010375 Bacteria 18664
21 Ga0105239_10008893 3300010375 Bacteria 11368
22 Ga0157373_10440085 3300013100 Bacteria 937
23 Ga0163161_10034422 3300017792 Bacteria 3624
24 Ga0214542_1034402 3300021321 Bacteria 1641
25 Ga0214543_1001578 3300021327 Bacteria 44277
26 Ga0228711_1000017 3300022739 Bacteria 121084
27 Ga0228710_1000005 3300022740 Bacteria 233531
28 Ga0209051_1024390 3300025303 Bacteria 2488
29 Ga0207691_10762129 3300025940 Bacteria 814
30 Ga0207667_10009078 3300025949 Bacteria 11757
31 Ga0207667_10109114 3300025949 Bacteria 2855
32 Ga0207668_10882889 3300025972 Bacteria 795
33 Ga0207639_10017597 3300026041 Bacteria 5068
34 Ga0207678_10056233 3300026067 Bacteria 3387
35 Ga0207641_10016697 3300026088 Bacteria 6012
36 Ga0207648_10586793 3300026089 Bacteria 1026
37 Ga0207674_10137388 3300026116 Bacteria 2405
38 Ga0207674_10173916 3300026116 Bacteria 2106
39 Ga0207683_10595481 3300026121 Bacteria 1023
40 Ga0207683_10994716 3300026121 Bacteria 778
41 Ga0209281_1000082 3300027111 Bacteria 257684
42 Ga0209281_1000484 3300027111 Bacteria 55133
43 Ga0209282_1000006 3300027666 Bacteria 276998
44 Ga0268266_10027690 3300028379 Bacteria 4819
45 Ga0268266_10140686 3300028379 Bacteria 2166
46 Ga0265337_1043946 3300028556 Bacteria 1276
47 Ga0265334_10005467 3300028573 Bacteria 5548
48 Ga0307515_10509653 3300028794 Bacteria 813
49 Ga0316182_1141509 3300030745 Bacteria 2250
50 Ga0307413_10073652 3300031824 Bacteria 2160
51 Ga0307413_10091400 3300031824 Bacteria 1983
52 Ga0307412_10614438 3300031911 Bacteria 922
53 Ga0315914_1000003 3300031967 Bacteria 314370
54 Ga0307416_100259968 3300032002 Bacteria 1696
55 Ga0307414_10003667 3300032004 Bacteria 8229
56 Ga0307414_10165781 3300032004 Bacteria 1760
57 Ga0307414_10263664 3300032004 Bacteria 1439
58 Ga0307411_10059189 3300032005 Bacteria 2538
59 Ga0315913_1000001 3300033430 Bacteria 284459
60 Ga0315915_1000008 3300033464 Bacteria 258517
61 Ga0373935_0152129 3300035692 Archaea 1571
62 Ga0373937_0348578 3300036401 Unclassified 1402
63 Ga0395905_0492277 3300037471 Bacteria 1126
64 Ga0237819_00176 3300038705 Bacteria 23716
65 Ga0439439_0146932 3300041406 Bacteria 668
66 Ga0451787_252058 3300041441 Bacteria 1010
67 Ga0451791_0535232 3300041451 Bacteria 1245
68 Ga0451791_1167227 3300041451 Bacteria 677
69 Ga0451793_1438591 3300041452 Bacteria 2295
70 Ga0451797_1408819 3300041453 Bacteria 759
71 Ga0451795_0874852 3300041456 Bacteria 1652
72 Ga0451800_1342272 3300041459 Bacteria 1088
73 Ga0451802_0317235 3300041460 Bacteria 3067
74 Ga0451837_0292814 3300041494 Bacteria 815
75 Ga0451837_1367937 3300041494 Bacteria 830
76 Ga0451845_0207107 3300041501 Bacteria 649
77 Ga0451845_0849271 3300041501 Bacteria 674
78 Ga0451843_0085847 3300041509 Bacteria 786
79 Ga0451843_0781494 3300041509 Bacteria 594
80 Ga0451853_1873575 3300041512 Bacteria 2483
81 Ga0439433_0016454 3300041999 Bacteria 1639
82 Ga0439432_002628 3300042006 Bacteria 6743
83 Ga0439432_065795 3300042006 Bacteria 1111
84 Ga0439462_0019594 3300042015 Bacteria 1762
85 Ga0439462_0051915 3300042015 Bacteria 1103
86 Ga0439434_0159383 3300042435 Bacteria 749
87 Ga0439444_0072096 3300042437 Bacteria 741
88 Ga0451577_0002644 3300042876 Bacteria 20995
89 Ga0453683_0002942 3300044673 Bacteria 12822
90 Ga0453684_0008212 3300044712 Bacteria 18825
91 Ga0451576_0007873 3300045051 Bacteria 12631
92 Ga0495639_0161776 3300046475 Unclassified 1084
93 Ga0495586_0268222 3300046535 Bacteria 976
94 Ga0495656_0269657 3300046615 Bacteria 864
95 Ga0495659_0218453 3300046664 Bacteria 786
96 Ga0495647_0003512 3300046681 Bacteria 5018
97 Ga0495671_0153106 3300046692 Bacteria 1122
98 Ga0495636_0180610 3300047318 Bacteria 957
99 Ga0495686_0005017 3300047472 Bacteria 10625
100 Ga0496119_0008759 3300048922 Bacteria 8819
101 Ga0496120_0000374 3300048923 Bacteria 72781
102 Ga0501031_0009879 3300049568 Bacteria 6212
103 Ga0501031_0047106 3300049568 Bacteria 2810
104 Ga0501032_0036130 3300049569 Bacteria 3374
105 Ga0501033_0009357 3300049570 Bacteria 7541
106 Ga0501034_0003349 3300049571 Bacteria 18285
107 Ga0501034_0278127 3300049571 Bacteria 1614
108 Ga0501036_0469500 3300049572 Bacteria 1048
109 Ga0501038_0022631 3300049574 Bacteria 5628
110 Ga0501043_0100157 3300049579 Bacteria 2278
111 Ga0501047_0122743 3300049581 Bacteria 2479
112 Ga0501070_0118749 3300049586 Bacteria 2185
113 Ga0501073_0095981 3300049589 Bacteria 2059
114 Ga0501225_0033195 3300049705 Bacteria 1420
115 Ga0501080_0459473 3300049742 Bacteria 1141
116 Ga0501083_0768194 3300049744 Bacteria 627
117 Ga0501035_0055712 3300049822 Bacteria 3529
118 Ga0501044_0054429 3300049823 Bacteria 4113
119 nmdc:mga00v17_12033_c1 3300050491 Bacteria 4763
120 Ga0500610_0000805 3300053079 Bacteria 9951
121 Ga0500651_0000586 3300053093 Bacteria 18318
122 Ga0500651_0052238 3300053093 Bacteria 2563
123 Ga0500661_004722 3300055283 Bacteria 2547
124 2509107990 2508501122 Bacteria 6292184
125 2509376834 2509276019 Bacteria 6802256
126 2510304131 2510065057 Bacteria 6649661
127 2511502568 2511231052 Bacteria 6974333
128 2512533937 2512047086 Bacteria 6850303
129 2512970304 2512875026 Bacteria 6861065
130 2513583199 2513237086 Bacteria 7265287
131 2513601368 2513237089 Bacteria 6553624
132 2513621026 2513237091 Bacteria 6900273
133 2513881749 2513237140 Bacteria 7076289
134 2513904893 2513237143 Bacteria 6664116
135 2513983564 2513237156 Bacteria 6402557
136 2514003185 2513237160 Bacteria 6650282
137 2515609351 2515154107 Bacteria 6795637
138 2516206010 2516143018 Bacteria 6951533
139 2516893943 2516653046 Bacteria 6989037
140 2517570658 2517487022 Bacteria 7227575
141 2524448237 2524023207 Bacteria 6813453
142 2551675333 2551306084 Bacteria 8942552
143 2551676743 2551306084 Bacteria 8942552
144 2551689383 2551306085 Bacteria 7347181
145 2551731630 2551306091 Bacteria 7086830
146 2558865809 2558860100 Bacteria 8458965
147 2572254216 2571042365 Bacteria 3289345
148 2644528064 2643221695 Bacteria 3441323
149 2657684810 2657244999 Bacteria 5946535
150 2692315113 2690316117 Bacteria 6800650
151 2753463286 2751185821 Bacteria 6189929
152 2792581589 2791355082 Bacteria 5973319
153 2792620420 2791355091 Bacteria 6135441
154 2792625778 2791355092 Bacteria 6248105
155 2792641846 2791355094 Bacteria 7011481
156 2802716661 2802428858 Bacteria 6636079
157 2802725472 2802428859 Bacteria 6667919
158 2802730436 2802428860 Bacteria 6525526
159 2802737592 2802428861 Bacteria 6534206
160 2802743018 2802428862 Bacteria 6633353
161 2802750442 2802428863 Bacteria 6410669
162 2804753059 2802429268 Bacteria 6094027
163 2819245049 2818991272 Bacteria 4622173
164 2838079612 2838074704 Bacteria 6785777
165 2847419826 2847417321 Bacteria 6913799
166 2848994842 2848992105 Bacteria 6810864
167 2850081838 2850079185 Bacteria 6848280
168 2855826665 2855825444 Bacteria 6785811
169 2855842059 2855839649 Bacteria 7135830
170 2855877342 2855872281 Bacteria 6964271
171 2858802733 2858800743 Bacteria 6603254
172 2881929920 2881927736 Bacteria 3993927
173 2887380690 2887375801 Bacteria 5334027
174 2896391273 2896384573 Bacteria 7700774
175 2915981201 2915980308 Bacteria 6624279
176 2915988401 2915986958 Bacteria 6739310
177 2915998573 2915993759 Bacteria 7016183
178 2916005649 2916000859 Bacteria 6865702
179 2916013503 2916007675 Bacteria 6898660
180 2916021458 2916014648 Bacteria 6946486
181 2916026860 2916021584 Bacteria 6854472
182 2916033016 2916028427 Bacteria 6748433
183 2916039299 2916035215 Bacteria 6755766
184 2916046520 2916041962 Bacteria 6820487
185 2916050484 2916048683 Bacteria 6543552
186 2916055971 2916055098 Bacteria 6758838
187 2916062062 2916061851 Bacteria 6737736
188 2916070522 2916068649 Bacteria 6943657
189 2916077209 2916076590 Bacteria 6596108
190 2919677486 2919675420 Bacteria 3969095
191 2920761124 2920760137 Bacteria 7427611
192 2921205466 2921201388 Bacteria 6926299
193 2921213955 2921208531 Bacteria 6745326
194 2921239321 2921237296 Bacteria 6876710
195 2921249931 2921244191 Bacteria 6568419
196 2921251708 2921250672 Bacteria 6677771
197 2921263122 2921257292 Bacteria 6808382
198 2921270274 2921263974 Bacteria 6864552
199 2921287197 2921282425 Bacteria 6826397
200 2921292045 2921289301 Bacteria 7316391
201 2921297290 2921296804 Bacteria 7176999
202 2924144904 2924144063 Bacteria 6883928
203 2924156135 2924150972 Bacteria 7169444
204 2924159948 2924158325 Bacteria 7188855
205 2924169500 2924165586 Bacteria 7260590
206 2924173565 2924172951 Bacteria 6749356
207 2924183788 2924179722 Bacteria 6843264
208 2924193152 2924186466 Bacteria 6876637
209 2924195075 2924193448 Bacteria 6955718
210 2924201613 2924200457 Bacteria 6757188
211 2924208226 2924207177 Bacteria 6917007
212 2924218537 2924214083 Bacteria 7080103
213 2924223573 2924221636 Bacteria 7113495
214 2924235200 2924228884 Bacteria 6633132
215 2937002813 2936996657 Bacteria 6298727
216 2937003914 2937002841 Bacteria 6934057
217 2937010776 2937009748 Bacteria 6746052
218 2937021815 2937016420 Bacteria 6782579
219 2937027391 2937023124 Bacteria 6815156
220 2937035690 2937029754 Bacteria 6424026
221 2937039353 2937036028 Bacteria 6846469
222 2937042910 2937042894 Bacteria 6741576
223 2937050341 2937049772 Bacteria 6757901
224 2937062870 2937056579 Bacteria 7107896
225 2937064549 2937063883 Bacteria 7199456
226 2937073242 2937071275 Bacteria 6984483
227 2937080752 2937078374 Bacteria 6610289
228 2937090621 2937084907 Bacteria 6618516
229 2937097376 2937091812 Bacteria 6979387
230 2937101091 2937098957 Bacteria 7249374
231 2937112224 2937106411 Bacteria 6947143
232 2937117624 2937113482 Bacteria 6505872
233 2937124455 2937119839 Bacteria 6597547
234 2937131513 2937126314 Bacteria 6771275
235 2941504541 2941499720 Bacteria 7599444
236 2957380635 2957375807 Bacteria 6425588
237 2957382573 2957382221 Bacteria 6737050
238 2957389449 2957388812 Bacteria 6778072
239 2957401953 2957395598 Bacteria 6822399
240 2957408375 2957402308 Bacteria 6741770
241 2957410171 2957408893 Bacteria 6558585
242 2957420059 2957415311 Bacteria 6991633
243 2957428487 2957422303 Bacteria 7172205
244 2957431005 2957430029 Bacteria 7022557
245 2957440122 2957437181 Bacteria 6568994
246 2957450627 2957443900 Bacteria 6869977
247 2957455276 2957450854 Bacteria 6765715
248 2957462676 2957457609 Bacteria 6967680
249 2957465631 2957464669 Bacteria 6568877
250 2957475695 2957471148 Bacteria 6797643
251 2957478963 2957478035 Bacteria 6756658
252 2957488902 2957484790 Bacteria 6703082
253 2957497935 2957491536 Bacteria 6695180
254 2957501747 2957498199 Bacteria 7126688
255 2957509900 2957505466 Bacteria 7253085
256 2960589119 2960584000 Bacteria 6864594
257 2960591865 2960591022 Bacteria 6622873
258 2960602051 2960597568 Bacteria 6550735
259 2960607928 2960603979 Bacteria 6898737
260 2960614810 2960610863 Bacteria 6691244
261 2960618053 2960617483 Bacteria 6727748
262 2960630044 2960624210 Bacteria 6875384
263 2960634066 2960631154 Bacteria 6732508
264 2960642583 2960637947 Bacteria 7296468
265 2960651168 2960645483 Bacteria 7211087
266 2960659489 2960652885 Bacteria 7083688
267 2960667182 2960660292 Bacteria 7041660
268 2960673692 2960667422 Bacteria 6763020
269 2960674803 2960674078 Bacteria 6609048
270 2960680750 2960680706 Bacteria 6624464
271 2960692224 2960687367 Bacteria 6535474
272 2960696532 2960693952 Bacteria 6749742
273 2964611358 2964607997 Bacteria 7101408
274 2964617119 2964615318 Bacteria 6809089
275 2964627176 2964621998 Bacteria 6834995
276 2964632865 2964628898 Bacteria 7083044
277 2964636797 2964636051 Bacteria 7091832
278 2964646305 2964643177 Bacteria 6820887
279 2964651193 2964649959 Bacteria 6675118
280 2964662754 2964656573 Bacteria 7100150
281 2964669255 2964663802 Bacteria 7019362
282 2964682433 2964678106 Bacteria 6792020
283 2964689395 2964685014 Bacteria 6839111
284 2964693935 2964691889 Bacteria 6802758
285 2964704797 2964698721 Bacteria 6765331
286 2964706444 2964705432 Bacteria 7114648
287 2964713399 2964712639 Bacteria 6695970
288 2964726254 2964719344 Bacteria 7286602
289 2967670280 2967664464 Bacteria 6948836
290 2967676227 2967671571 Bacteria 7021409
291 2967685878 2967678726 Bacteria 7264382
292 2967691021 2967686174 Bacteria 6678622
293 2967699004 2967693043 Bacteria 6804451
294 2967705484 2967699805 Bacteria 6854538
295 2967711622 2967706974 Bacteria 7186053
296 2967720441 2967714385 Bacteria 7000047
297 2967724376 2967721400 Bacteria 7073753
298 2967732349 2967728569 Bacteria 6641507
299 2967739918 2967735183 Bacteria 6827012
300 2967745845 2967742019 Bacteria 6794534
301 2967749362 2967748971 Bacteria 6733771
302 2967759600 2967755722 Bacteria 6814706
303 2967767188 2967762386 Bacteria 6923502
304 2967770520 2967769361 Bacteria 6587838
305 2967776894 2967775926 Bacteria 6738189
306 2970025801 2970019648 Bacteria 7072033
307 2970027529 2970026789 Bacteria 6785236
308 2970036038 2970033650 Bacteria 7118744
309 2970046135 2970040964 Bacteria 6731123
310 2970054534 2970047711 Bacteria 7088379
311 2970056281 2970054988 Bacteria 6611507
312 2970065992 2970061556 Bacteria 7099761
313 2970071047 2970068827 Bacteria 7123112
314 2970082473 2970076120 Bacteria 6697332
315 2970088310 2970082768 Bacteria 6183754
316 2970094217 2970088815 Bacteria 6933825
317 2970100754 2970095765 Bacteria 6936963
318 2970104425 2970102677 Bacteria 6812532
319 2970115015 2970109326 Bacteria 6863976
320 2970120613 2970116247 Bacteria 6501857
321 2970123399 2970122695 Bacteria 6625855
322 2970135905 2970129317 Bacteria 6806560
323 2970140870 2970136068 Bacteria 7207982
324 2970144786 2970143518 Bacteria 6446480
325 2970154906 2970149975 Bacteria 6779706
326 2970161322 2970156795 Bacteria 7168044
327 2970168329 2970164137 Bacteria 6861252
328 2970173860 2970170962 Bacteria 6876229
329 2970181053 2970177841 Bacteria 6768001
330 2970186298 2970184632 Bacteria 7054431
331 2970196095 2970191845 Bacteria 7032787
332 2977519365 2977516862 Bacteria 6940108
333 2977530456 2977523885 Bacteria 6960446
334 2977536339 2977530762 Bacteria 6951399
335 2977543283 2977537788 Bacteria 6929320
336 2977545225 2977544691 Bacteria 6875412
337 2977553079 2977551784 Bacteria 7125765
338 2977565237 2977558990 Bacteria 6863948
339 2977567002 2977565890 Bacteria 6901543
340 2977574032 2977572785 Bacteria 6763888
341 2977585892 2977579622 Bacteria 6772100
342 648738762 648276728 Bacteria 6968865
343 8003994500 8003992118 Bacteria 7266902
344 8004002196 8003999396 Bacteria 7063185
345 8015399173 8015394850 Bacteria 5064660
346 8049295673 8049293176 Bacteria 6128433
347 Ga0500638_172754
348 rootH2_10183721
349 Ga0070670_101040743
350 Ga0070666_10648621
351 Ga0070682_100352908
352 Ga0070678_100637546
353 Ga0068867_100581915
354 Ga0068853_100000431
355 Ga0068853_100005264
356 Ga0070665_100031587
357 Ga0068855_100012183
358 Ga0068855_100085025
359 Ga0068857_100131849
360 Ga0068857_100535788
361 Ga0068852_100042986
362 Ga0081455_10533017
363 Ga0075364_10012526
364 Ga0079104_1020997
365 Ga0105241_10130582
366 Ga0105239_10003689
367 Ga0105239_10008893
368 Ga0157373_10440085
369 Ga0163161_10034422
370 Ga0214542_1034402
371 Ga0214543_1001578
372 Ga0228711_1000017
373 Ga0228710_1000005
374 Ga0209051_1024390
375 Ga0207691_10762129
376 Ga0207667_10009078
377 Ga0207667_10109114
378 Ga0207668_10882889
379 Ga0207639_10017597
380 Ga0207678_10056233
381 Ga0207641_10016697
382 Ga0207648_10586793
383 Ga0207674_10137388
384 Ga0207674_10173916
385 Ga0207683_10595481
386 Ga0207683_10994716
387 Ga0209281_1000082
388 Ga0209281_1000484
389 Ga0209282_1000006
390 Ga0268266_10027690
391 Ga0268266_10140686
392 Ga0265337_1043946
393 Ga0265334_10005467
394 Ga0307515_10509653
395 Ga0316182_1141509
396 Ga0307413_10073652
397 Ga0307413_10091400
398 Ga0307412_10614438
399 Ga0315914_1000003
400 Ga0307416_100259968
401 Ga0307414_10003667
402 Ga0307414_10165781
403 Ga0307414_10263664
404 Ga0307411_10059189
405 Ga0315913_1000001
406 Ga0315915_1000008
407 Ga0373935_0152129
408 Ga0373937_0348578
409 Ga0395905_0492277
410 Ga0237819_00176
411 Ga0439439_0146932
412 Ga0451787_252058
413 Ga0451791_0535232
414 Ga0451791_1167227
415 Ga0451793_1438591
416 Ga0451797_1408819
417 Ga0451795_0874852
418 Ga0451800_1342272
419 Ga0451802_0317235
420 Ga0451837_0292814
421 Ga0451837_1367937
422 Ga0451845_0207107
423 Ga0451845_0849271
424 Ga0451843_0085847
425 Ga0451843_0781494
426 Ga0451853_1873575
427 Ga0439433_0016454
428 Ga0439432_002628
429 Ga0439432_065795
430 Ga0439462_0019594
431 Ga0439462_0051915
432 Ga0439434_0159383
433 Ga0439444_0072096
434 Ga0451577_0002644
435 Ga0453683_0002942
436 Ga0453684_0008212
437 Ga0451576_0007873
438 Ga0495639_0161776
439 Ga0495586_0268222
440 Ga0495656_0269657
441 Ga0495659_0218453
442 Ga0495647_0003512
443 Ga0495671_0153106
444 Ga0495636_0180610
445 Ga0495686_0005017
446 Ga0496119_0008759
447 Ga0496120_0000374
448 Ga0501031_0009879
449 Ga0501031_0047106
450 Ga0501032_0036130
451 Ga0501033_0009357
452 Ga0501034_0003349
453 Ga0501034_0278127
454 Ga0501036_0469500
455 Ga0501038_0022631
456 Ga0501043_0100157
457 Ga0501047_0122743
458 Ga0501070_0118749
459 Ga0501073_0095981
460 Ga0501225_0033195
461 Ga0501080_0459473
462 Ga0501083_0768194
463 Ga0501035_0055712
464 Ga0501044_0054429
465 nmdc:mga00v17_12033_c1
466 Ga0500610_0000805
467 Ga0500651_0000586
468 Ga0500651_0052238
469 Ga0500661_004722
470 2509107990
471 2509376834
472 2510304131
473 2511502568
474 2512533937
475 2512970304
476 2513583199
477 2513601368
478 2513621026
479 2513881749
480 2513904893
481 2513983564
482 2514003185
483 2515609351
484 2516206010
485 2516893943
486 2517570658
487 2524448237
488 2551675333
489 2551676743
490 2551689383
491 2551731630
492 2558865809
493 2572254216
494 2644528064
495 2657684810
496 2692315113
497 2753463286
498 2792581589
499 2792620420
500 2792625778
501 2792641846
502 2802716661
503 2802725472
504 2802730436
505 2802737592
506 2802743018
507 2802750442
508 2804753059
509 2819245049
510 2838079612
511 2847419826
512 2848994842
513 2850081838
514 2855826665
515 2855842059
516 2855877342
517 2858802733
518 2881929920
519 2887380690
520 2896391273
521 2915981201
522 2915988401
523 2915998573
524 2916005649
525 2916013503
526 2916021458
527 2916026860
528 2916033016
529 2916039299
530 2916046520
531 2916050484
532 2916055971
533 2916062062
534 2916070522
535 2916077209
536 2919677486
537 2920761124
538 2921205466
539 2921213955
540 2921239321
541 2921249931
542 2921251708
543 2921263122
544 2921270274
545 2921287197
546 2921292045
547 2921297290
548 2924144904
549 2924156135
550 2924159948
551 2924169500
552 2924173565
553 2924183788
554 2924193152
555 2924195075
556 2924201613
557 2924208226
558 2924218537
559 2924223573
560 2924235200
561 2937002813
562 2937003914
563 2937010776
564 2937021815
565 2937027391
566 2937035690
567 2937039353
568 2937042910
569 2937050341
570 2937062870
571 2937064549
572 2937073242
573 2937080752
574 2937090621
575 2937097376
576 2937101091
577 2937112224
578 2937117624
579 2937124455
580 2937131513
581 2941504541
582 2957380635
583 2957382573
584 2957389449
585 2957401953
586 2957408375
587 2957410171
588 2957420059
589 2957428487
590 2957431005
591 2957440122
592 2957450627
593 2957455276
594 2957462676
595 2957465631
596 2957475695
597 2957478963
598 2957488902
599 2957497935
600 2957501747
601 2957509900
602 2960589119
603 2960591865
604 2960602051
605 2960607928
606 2960614810
607 2960618053
608 2960630044
609 2960634066
610 2960642583
611 2960651168
612 2960659489
613 2960667182
614 2960673692
615 2960674803
616 2960680750
617 2960692224
618 2960696532
619 2964611358
620 2964617119
621 2964627176
622 2964632865
623 2964636797
624 2964646305
625 2964651193
626 2964662754
627 2964669255
628 2964682433
629 2964689395
630 2964693935
631 2964704797
632 2964706444
633 2964713399
634 2964726254
635 2967670280
636 2967676227
637 2967685878
638 2967691021
639 2967699004
640 2967705484
641 2967711622
642 2967720441
643 2967724376
644 2967732349
645 2967739918
646 2967745845
647 2967749362
648 2967759600
649 2967767188
650 2967770520
651 2967776894
652 2970025801
653 2970027529
654 2970036038
655 2970046135
656 2970054534
657 2970056281
658 2970065992
659 2970071047
660 2970082473
661 2970088310
662 2970094217
663 2970100754
664 2970104425
665 2970115015
666 2970120613
667 2970123399
668 2970135905
669 2970140870
670 2970144786
671 2970154906
672 2970161322
673 2970168329
674 2970173860
675 2970181053
676 2970186298
677 2970196095
678 2977519365
679 2977530456
680 2977536339
681 2977543283
682 2977545225
683 2977553079
684 2977565237
685 2977567002
686 2977574032
687 2977585892
688 648738762
689 8003994500
690 8004002196
691 8015399173
692 8049295673

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03358

FMN_red

NADPH-dependent FMN reductase

24

175

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1x77-assembly1.cif.gz_B crystal structure of a nad(p)h-dependent fmn reductase complexed with fmn 0.9567 2 178
1x77-assembly1.cif.gz_B crystal structure of a nad(p)h-dependent fmn reductase complexed with fmn 0.9461 2 178
3svl-assembly1.cif.gz_B structural basis of the improvement of chrr - a multi-purpose enzyme 0.9424 1 183
4h6p-assembly1.cif.gz_A crystal structure of a putative chromate reductase from gluconacetobacter hansenii, gh-chrr, containing a r101a substitution. 0.9407 2 182
3svl-assembly1.cif.gz_B structural basis of the improvement of chrr - a multi-purpose enzyme 0.9374 1 183
ID Description Score Start End Superfamily
1x77B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9567 2 178 3.40.50.360
1x77B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9461 2 178 3.40.50.360
3svlA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9408 1 181 3.40.50.360
3svlA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9308 1 181 3.40.50.360
af_P95105_3_183_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8905 2 179 3.40.50.360
ID Description Score Start End GO Terms
AF-A0A5C8J521-F1-model_v4 NAD(P)H-dependent oxidoreductase 0.9856 3 181 GO:0005829
GO:0010181
GO:0016491
AF-A0A1I0DXL6-F1-model_v4 NAD(P)H-dependent FMN reductase 0.9854 2 182 GO:0005829
GO:0010181
GO:0016491
AF-A0A2N8M675-F1-model_v4 NADPH-dependent FMN reductase 0.9854 57 182 GO:0005829
GO:0010181
GO:0016491
AF-A0A4U5JZ13-F1-model_v4 NAD(P)H-dependent oxidoreductase 0.9835 1 182 GO:0005829
GO:0010181
GO:0016491
AF-L0DFE7-F1-model_v4 Putative flavoprotein 0.9829 1 183 GO:0005829
GO:0010181
GO:0016491

Map