F416925

General Info

Members Datasets Scaffolds Average Seq Length
346 211 332 221

Family's Representative Sequence

Representative Sequence 3300049581|Ga0501047_0152833|Ga0501047_0152833_378_1109
Length 243
Sequence LPEGRLIRLLKISSRLPPRAAFVYDGPMNDATGAEADWASEAEQRVLDEALRLIPLKGWSQPMVLEAGRAAGLSAGETGLLLPHGPADLAALLSRRHDAQALAALGSTDPTSLKIRDRIARAVEARLDAACADEASVRRWTGFLALPPNMALGGRLLWESADVLWRWAGDVATDENHYSKRAILSAILATALAIRLTSGRTAALKHVSARIDNVMAFEKWKAGVKAPDVLRDIALALGKIRYR

Samples

Sample ID Description Type Environment
1 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
2 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
3 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
4 2643221640 Caulobacter sp. Root342 Isolate Unclassified
5 2643221642 Caulobacter sp. Root343 Isolate Unclassified
6 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
7 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
8 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
9 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
10 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
11 2851153111 Caulobacter radicis 736 Isolate Unclassified
12 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
13 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
14 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
15 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
16 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
17 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
18 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
19 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
20 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
71 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
72 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
73 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
77 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
112 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
113 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
114 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
115 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
116 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
117 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
118 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
119 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
120 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
121 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
122 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
124 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
125 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
126 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
127 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
128 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
129 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
130 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
131 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
132 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
133 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
134 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
135 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
136 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
137 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
138 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
139 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
140 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
141 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
142 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
143 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
144 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
145 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
146 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
147 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
148 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
149 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
150 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
151 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
152 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
153 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
154 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
155 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
156 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
157 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
158 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
159 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
160 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
161 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
162 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
163 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
164 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
165 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
166 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
167 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
168 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
169 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
170 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
171 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
172 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
177 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
179 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
180 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
181 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
182 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
183 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
184 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
185 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
186 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
187 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
188 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
189 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
190 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
191 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
192 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
193 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
194 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
195 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
196 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
197 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
198 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
199 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
200 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
201 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
202 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
203 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
204 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
205 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
206 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
207 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
208 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
209 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
210 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
211 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.95
Metatranscriptomes 0
Isolates 4.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.52
Nodule 0
Rhizoplane 3.76
Rhizosphere 67.34
Stem 0
Stem Tuber 0
Unclassified 8.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055524_1047998 3300003775 Bacteria 1000
2 Ga0055536_1009567 3300003781 Bacteria 3986
3 Ga0055528_1005584 3300003790 Bacteria 5821
4 Ga0055528_1005883 3300003790 Bacteria 5632
5 Ga0055530_10007656 3300003791 Bacteria 4500
6 Ga0055540_1033032 3300003792 Bacteria 1176
7 Ga0055531_10003368 3300003794 Bacteria 10220
8 Ga0055531_10005526 3300003794 Bacteria 7381
9 Ga0055531_10010235 3300003794 Bacteria 4689
10 Ga0065165_1000622 3300005262 Bacteria 51482
11 Ga0065165_1013611 3300005262 Bacteria 3221
12 Ga0070658_10139086 3300005327 Bacteria 2027
13 Ga0070658_10196539 3300005327 Bacteria 1701
14 Ga0070670_100065381 3300005331 Bacteria 3121
15 Ga0070670_100093445 3300005331 Bacteria 2587
16 Ga0070670_100098650 3300005331 Bacteria 2514
17 Ga0070666_10125745 3300005335 Bacteria 1780
18 Ga0070680_100299433 3300005336 Bacteria 1364
19 Ga0070660_100222121 3300005339 Bacteria 1536
20 Ga0070691_10026852 3300005341 Bacteria 2685
21 Ga0070668_100000042 3300005347 Bacteria 78694
22 Ga0070668_100007991 3300005347 Bacteria 7858
23 Ga0070668_100012234 3300005347 Bacteria 6394
24 Ga0070668_100051502 3300005347 Bacteria 3172
25 Ga0070668_100083711 3300005347 Bacteria 2504
26 Ga0070669_100001732 3300005353 Bacteria 15750
27 Ga0070671_100034751 3300005355 Bacteria 4174
28 Ga0070671_100053623 3300005355 Bacteria 3352
29 Ga0070671_100336077 3300005355 Bacteria 1288
30 Ga0070659_100035674 3300005366 Bacteria 3873
31 Ga0070667_100000508 3300005367 Bacteria 39312
32 Ga0070667_100018211 3300005367 Bacteria 5823
33 Ga0070667_100398765 3300005367 Bacteria 1252
34 Ga0070667_100576898 3300005367 Bacteria 1035
35 Ga0070678_100211375 3300005456 Bacteria 1607
36 Ga0070681_10019109 3300005458 Bacteria 6858
37 Ga0068853_100052429 3300005539 Bacteria 3514
38 Ga0068853_100124086 3300005539 Bacteria 2306
39 Ga0068853_100128819 3300005539 Bacteria 2263
40 Ga0070665_100002287 3300005548 Bacteria 21311
41 Ga0070665_100047592 3300005548 Bacteria 4304
42 Ga0070665_100104982 3300005548 Bacteria 2827
43 Ga0068855_100692171 3300005563 Bacteria 1092
44 Ga0070664_100120177 3300005564 Bacteria 2300
45 Ga0068854_100070726 3300005578 Bacteria 2551
46 Ga0068854_100521483 3300005578 Bacteria 1004
47 Ga0068856_100125293 3300005614 Bacteria 2572
48 Ga0068856_100534086 3300005614 Bacteria 1194
49 Ga0068852_101184790 3300005616 Bacteria 785
50 Ga0068859_100002919 3300005617 Bacteria 17364
51 Ga0068859_100004040 3300005617 Bacteria 14959
52 Ga0068859_100125552 3300005617 Bacteria 2635
53 Ga0068864_100000135 3300005618 Bacteria 71759
54 Ga0068864_100191986 3300005618 Bacteria 1873
55 Ga0068861_100302200 3300005719 Bacteria 1387
56 Ga0068863_100012986 3300005841 Bacteria 8032
57 Ga0068863_100028469 3300005841 Bacteria 5335
58 Ga0068863_100080562 3300005841 Bacteria 3084
59 Ga0068863_100211778 3300005841 Bacteria 1866
60 Ga0068858_100163937 3300005842 Bacteria 2094
61 Ga0068860_100000133 3300005843 Bacteria 120382
62 Ga0068860_100000327 3300005843 Bacteria 64590
63 Ga0068860_100005399 3300005843 Bacteria 12968
64 Ga0068862_100000619 3300005844 Bacteria 36984
65 Ga0068862_100121215 3300005844 Bacteria 2305
66 Ga0068862_100803775 3300005844 Unclassified 918
67 Ga0075363_100012342 3300006048 Bacteria 4116
68 Ga0075364_10002894 3300006051 Bacteria 9679
69 Ga0075367_10050533 3300006178 Bacteria 2455
70 Ga0075366_10012408 3300006195 Bacteria 4833
71 Ga0075366_10132173 3300006195 Bacteria 1506
72 Ga0068865_100003426 3300006881 Bacteria 9489
73 Ga0097620_100002919 3300006931 Bacteria 17364
74 Ga0097620_100004040 3300006931 Bacteria 14959
75 Ga0097620_100125555 3300006931 Bacteria 2635
76 Ga0105240_10029544 3300009093 Bacteria 7139
77 Ga0105240_10298959 3300009093 Bacteria 1842
78 Ga0105240_10624337 3300009093 Bacteria 1184
79 Ga0105240_10649027 3300009093 Bacteria 1157
80 Ga0105240_10831575 3300009093 Bacteria 998
81 Ga0105245_10197647 3300009098 Bacteria 1930
82 Ga0105241_10140741 3300009174 Bacteria 1964
83 Ga0105242_11251970 3300009176 Bacteria 763
84 Ga0105248_10003203 3300009177 Bacteria 18150
85 Ga0105248_10406857 3300009177 Bacteria 1532
86 Ga0105237_10147317 3300009545 Bacteria 2349
87 Ga0105238_10012550 3300009551 Bacteria 8551
88 Ga0105238_10026662 3300009551 Bacteria 5891
89 Ga0105238_10066127 3300009551 Bacteria 3617
90 Ga0105238_10340904 3300009551 Bacteria 1487
91 Ga0105238_10432035 3300009551 Unclassified 1312
92 Ga0105249_10001002 3300009553 Bacteria 25047
93 Ga0105249_10119720 3300009553 Bacteria 2501
94 Ga0105249_10850001 3300009553 Bacteria 978
95 Ga0105239_10356105 3300010375 Bacteria 1652
96 Ga0157369_10649338 3300013105 Bacteria 1088
97 Ga0157369_11375386 3300013105 Bacteria 719
98 Ga0163162_10058517 3300013306 Bacteria 3883
99 Ga0157375_10037572 3300013308 Bacteria 4641
100 Ga0163163_10005645 3300014325 Bacteria 10844
101 Ga0163163_10147343 3300014325 Bacteria 2398
102 Ga0163163_10752123 3300014325 Bacteria 1038
103 Ga0157379_10002866 3300014968 Bacteria 14544
104 Ga0157379_10174128 3300014968 Bacteria 1943
105 Ga0157379_10217714 3300014968 Bacteria 1730
106 Ga0157376_10658068 3300014969 Bacteria 1049
107 Ga0157376_11365457 3300014969 Bacteria 740
108 Ga0213872_10002032 3300021361 Bacteria 12295
109 Ga0213876_10238172 3300021384 Unclassified 967
110 Ga0209026_1009372 3300025250 Bacteria 1929
111 Ga0209565_1001766 3300025263 Bacteria 8804
112 Ga0209673_1000788 3300025273 Bacteria 42315
113 Ga0209676_1000163 3300025292 Bacteria 157845
114 Ga0209676_1000188 3300025292 Bacteria 141232
115 Ga0209758_1007549 3300025297 Bacteria 7355
116 Ga0209050_1000073 3300025298 Bacteria 292046
117 Ga0209050_1001523 3300025298 Bacteria 24437
118 Ga0209050_1002911 3300025298 Bacteria 13441
119 Ga0209256_1006331 3300025299 Bacteria 6320
120 Ga0209051_1003688 3300025303 Bacteria 9895
121 Ga0209257_1000099 3300025304 Bacteria 255304
122 Ga0209257_1001816 3300025304 Bacteria 23363
123 Ga0209257_1004182 3300025304 Bacteria 11450
124 Ga0207680_10129949 3300025903 Bacteria 1659
125 Ga0207680_10372537 3300025903 Bacteria 1005
126 Ga0207705_10118761 3300025909 Bacteria 1960
127 Ga0207705_10235873 3300025909 Bacteria 1392
128 Ga0207695_10000321 3300025913 Bacteria 116087
129 Ga0207695_10001284 3300025913 Bacteria 42684
130 Ga0207695_10055216 3300025913 Bacteria 4141
131 Ga0207695_10282077 3300025913 Bacteria 1555
132 Ga0207671_10649765 3300025914 Bacteria 840
133 Ga0207660_10066658 3300025917 Bacteria 2605
134 Ga0207660_10068105 3300025917 Bacteria 2580
135 Ga0207681_10016700 3300025923 Bacteria 4598
136 Ga0207681_10201299 3300025923 Bacteria 1529
137 Ga0207694_10005274 3300025924 Bacteria 9958
138 Ga0207694_10054115 3300025924 Bacteria 3113
139 Ga0207694_10083184 3300025924 Bacteria 2516
140 Ga0207694_10326641 3300025924 Unclassified 1267
141 Ga0207650_10000016 3300025925 Bacteria 361958
142 Ga0207650_10061323 3300025925 Bacteria 2808
143 Ga0207650_10199229 3300025925 Bacteria 1603
144 Ga0207650_10545940 3300025925 Bacteria 971
145 Ga0207644_10011661 3300025931 Bacteria 5821
146 Ga0207644_10125477 3300025931 Bacteria 1959
147 Ga0207690_10000196 3300025932 Bacteria 47111
148 Ga0207704_10001415 3300025938 Bacteria 10726
149 Ga0207711_10032691 3300025941 Bacteria 4399
150 Ga0207711_10153418 3300025941 Bacteria 2080
151 Ga0207679_10121354 3300025945 Bacteria 2081
152 Ga0207667_10502190 3300025949 Bacteria 1230
153 Ga0207712_10000767 3300025961 Bacteria 24118
154 Ga0207712_10179562 3300025961 Bacteria 1661
155 Ga0207668_10001517 3300025972 Bacteria 13565
156 Ga0207668_10003471 3300025972 Bacteria 9248
157 Ga0207668_10025386 3300025972 Bacteria 3834
158 Ga0207640_10006138 3300025981 Bacteria 6574
159 Ga0207640_10206553 3300025981 Bacteria 1493
160 Ga0207658_10000295 3300025986 Bacteria 52135
161 Ga0207658_10010515 3300025986 Bacteria 6287
162 Ga0207658_10015462 3300025986 Bacteria 5235
163 Ga0207658_11245639 3300025986 Bacteria 680
164 Ga0207703_10124854 3300026035 Bacteria 2214
165 Ga0207703_10424296 3300026035 Bacteria 1238
166 Ga0207639_10096590 3300026041 Bacteria 2377
167 Ga0207639_10118467 3300026041 Bacteria 2171
168 Ga0207641_10000612 3300026088 Bacteria 39133
169 Ga0207641_10009716 3300026088 Bacteria 7924
170 Ga0207641_10113593 3300026088 Bacteria 2405
171 Ga0207676_10002034 3300026095 Bacteria 14697
172 Ga0207676_10127204 3300026095 Bacteria 2160
173 Ga0207676_10282590 3300026095 Bacteria 1507
174 Ga0207675_100328581 3300026118 Bacteria 1494
175 Ga0207675_100329502 3300026118 Bacteria 1492
176 Ga0207675_100502336 3300026118 Bacteria 1207
177 Ga0207698_11164603 3300026142 Bacteria 785
178 Ga0209981_1002487 3300027378 Bacteria 2350
179 Ga0209983_1037479 3300027665 Bacteria 1044
180 Ga0209813_10073416 3300027866 Bacteria 1117
181 Ga0268266_10003072 3300028379 Bacteria 17061
182 Ga0268266_10071262 3300028379 Bacteria 3012
183 Ga0268265_10020122 3300028380 Bacteria 4653
184 Ga0268265_10032729 3300028380 Bacteria 3771
185 Ga0268265_11205897 3300028380 Unclassified 754
186 Ga0268264_10000002 3300028381 Bacteria 1153045
187 Ga0268264_10000207 3300028381 Bacteria 120086
188 Ga0268264_10031935 3300028381 Bacteria 4319
189 Ga0307517_10002333 3300028786 Bacteria 30608
190 Ga0307517_10321394 3300028786 Bacteria 856
191 Ga0265327_10003325 3300031251 Bacteria 15546
192 Ga0307513_10000127 3300031456 Bacteria 107100
193 Ga0307513_10000899 3300031456 Bacteria 42953
194 Ga0307513_10000983 3300031456 Bacteria 41242
195 Ga0307513_10140173 3300031456 Bacteria 2346
196 Ga0307508_10247849 3300031616 Bacteria 1378
197 Ga0307516_10000001 3300031730 Bacteria 510338
198 Ga0307413_10044372 3300031824 Bacteria 2627
199 Ga0307413_10063223 3300031824 Bacteria 2294
200 Ga0307411_10030372 3300032005 Bacteria 3312
201 Ga0307510_10006409 3300033180 Bacteria 14030
202 Ga0307510_10059596 3300033180 Bacteria 3939
203 Ga0373946_0005900 3300035171 Bacteria 4436
204 Ga0373931_0327221 3300035691 Bacteria 954
205 Ga0373927_0001110 3300035695 Bacteria 20442
206 Ga0373925_0000489 3300037068 Bacteria 39827
207 Ga0395899_0000003 3300037312 Bacteria 1232684
208 Ga0395900_0173883 3300037418 Bacteria 2191
209 Ga0395900_0244381 3300037418 Bacteria 1799
210 Ga0395898_0154532 3300037466 Bacteria 2195
211 Ga0395905_0125231 3300037471 Bacteria 2416
212 Ga0395905_0401585 3300037471 Bacteria 1265
213 Ga0395905_0538175 3300037471 Bacteria 1069
214 Ga0436364_1402286 3300037853 Bacteria 2401
215 Ga0436365_1146874 3300039437 Bacteria 6815
216 Ga0436365_1808918 3300039437 Bacteria 1418
217 Ga0436361_0270208 3300039447 Bacteria 1284
218 Ga0436361_0836259 3300039447 Bacteria 879
219 Ga0436361_1143308 3300039447 Bacteria 2389
220 Ga0466969_0070359 3300044656 Bacteria 1683
221 Ga0453684_0457767 3300044712 Bacteria 1419
222 Ga0495590_0042284 3300046457 Bacteria 1588
223 Ga0495629_0028909 3300046459 Bacteria 3935
224 Ga0495638_0000443 3300046460 Bacteria 49906
225 Ga0495638_0001159 3300046460 Bacteria 25410
226 Ga0495638_0335437 3300046460 Bacteria 803
227 Ga0495650_0059683 3300046471 Bacteria 1535
228 Ga0495594_0099807 3300046499 Bacteria 1633
229 Ga0495583_0043515 3300046506 Bacteria 2090
230 Ga0495610_0008577 3300046512 Bacteria 6593
231 Ga0495610_0043653 3300046512 Bacteria 2232
232 Ga0495620_0009876 3300046515 Bacteria 5055
233 Ga0495637_0146740 3300046520 Bacteria 892
234 Ga0495643_0024988 3300046522 Bacteria 3384
235 Ga0495654_0000051 3300046530 Bacteria 145932
236 Ga0495654_0107631 3300046530 Bacteria 1275
237 Ga0495621_0018414 3300046539 Bacteria 2267
238 Ga0495597_0001511 3300046542 Bacteria 16580
239 Ga0495597_0128964 3300046542 Bacteria 1050
240 Ga0495622_0165055 3300046557 Bacteria 997
241 Ga0495668_0014600 3300046616 Bacteria 4600
242 Ga0495668_0029230 3300046616 Bacteria 3114
243 Ga0495668_0042514 3300046616 Bacteria 2530
244 Ga0495668_0092678 3300046616 Bacteria 1655
245 Ga0495668_0248495 3300046616 Bacteria 974
246 Ga0495668_0290003 3300046616 Bacteria 897
247 Ga0495611_0059932 3300046648 Bacteria 1728
248 Ga0495625_0028435 3300046660 Bacteria 4192
249 Ga0495625_0045312 3300046660 Bacteria 3180
250 Ga0495669_0000002 3300046684 Bacteria 282777
251 Ga0495669_0001666 3300046684 Bacteria 9110
252 Ga0495669_0061677 3300046684 Bacteria 1697
253 Ga0495669_0163625 3300046684 Bacteria 1056
254 Ga0495624_0182011 3300046690 Bacteria 1280
255 Ga0495581_0036008 3300047315 Bacteria 2863
256 Ga0495677_0014626 3300047445 Bacteria 2855
257 Ga0495677_0020070 3300047445 Bacteria 2422
258 Ga0495673_0002251 3300047469 Bacteria 13848
259 Ga0495686_0006377 3300047472 Bacteria 9048
260 Ga0495686_0008921 3300047472 Bacteria 7288
261 Ga0495602_0261399 3300048088 Bacteria 1284
262 Ga0495615_0006676 3300048090 Bacteria 2152
263 Ga0496101_0036361 3300048904 Bacteria 3488
264 Ga0496102_0028562 3300048905 Bacteria 4983
265 Ga0496102_0195110 3300048905 Bacteria 1908
266 Ga0496103_0154962 3300048906 Bacteria 1468
267 Ga0496104_0062720 3300048907 Bacteria 3525
268 Ga0496106_0235833 3300048909 Bacteria 1461
269 Ga0496107_0036473 3300048910 Bacteria 3527
270 Ga0496108_0045960 3300048911 Bacteria 3647
271 Ga0496109_0028143 3300048912 Bacteria 5025
272 Ga0496113_0025223 3300048916 Bacteria 4235
273 Ga0496115_0001630 3300048918 Bacteria 16158
274 Ga0496115_0004005 3300048918 Bacteria 10633
275 Ga0496115_0028461 3300048918 Bacteria 4380
276 Ga0496119_0006503 3300048922 Bacteria 10792
277 Ga0496120_0155921 3300048923 Bacteria 1143
278 Ga0496121_0000035 3300048924 Bacteria 374316
279 Ga0496121_0451700 3300048924 Bacteria 828
280 Ga0496125_0184336 3300048928 Bacteria 1386
281 Ga0495678_001468 3300049459 Bacteria 18471
282 Ga0501033_0329009 3300049570 Bacteria 1072
283 Ga0501037_0029285 3300049573 Bacteria 4068
284 Ga0501043_0398854 3300049579 Bacteria 1040
285 Ga0501047_0152833 3300049581 Bacteria 2183
286 Ga0501047_0412469 3300049581 Bacteria 1183
287 Ga0501266_070026 3300049763 Bacteria 577
288 Ga0501035_0168035 3300049822 Bacteria 1896
289 Ga0501035_0394014 3300049822 Bacteria 1153
290 Ga0501044_0015676 3300049823 Bacteria 8162
291 Ga0501044_0505073 3300049823 Bacteria 1110
292 nmdc:mga03n38_13034_c1 3300050490 Bacteria 3146
293 nmdc:mga00v17_1568_c1 3300050491 Bacteria 11927
294 nmdc:mga0k408_10166_c1 3300050493 Bacteria 5087
295 nmdc:mga06z11_11903_c1 3300050494 Bacteria 3767
296 nmdc:mga04h51_92005_c1 3300050495 Bacteria 1093
297 nmdc:mga07m45_134004_c1 3300050496 Bacteria 1434
298 nmdc:mga07m45_6049_c1 3300050496 Bacteria 6092
299 Ga0500578_0002060 3300053086 Bacteria 17968
300 Ga0500643_008210 3300053087 Bacteria 4127
301 Ga0500644_0006900 3300053088 Bacteria 2930
302 Ga0500644_0204822 3300053088 Bacteria 817
303 Ga0500646_0049521 3300053090 Bacteria 1208
304 Ga0500651_0014561 3300053093 Bacteria 4813
305 Ga0500566_0011904 3300053094 Bacteria 5123
306 Ga0500641_0013153 3300053096 Bacteria 3038
307 Ga0500554_008238 3300053102 Bacteria 2440
308 Ga0500555_008739 3300053103 Bacteria 2891
309 Ga0500555_059354 3300053103 Bacteria 1032
310 Ga0500562_001866 3300053108 Bacteria 5289
311 Ga0500562_053301 3300053108 Bacteria 1083
312 Ga0500569_009192 3300053109 Bacteria 2288
313 Ga0500572_058843 3300053111 Bacteria 1164
314 Ga0500594_0005777 3300053118 Bacteria 2751
315 Ga0500595_003495 3300053119 Bacteria 7310
316 Ga0500607_097362 3300053121 Bacteria 1468
317 Ga0500608_000027 3300053122 Bacteria 66998
318 Ga0500608_000730 3300053122 Bacteria 11996
319 Ga0500614_011761 3300053123 Bacteria 1901
320 Ga0500614_030620 3300053123 Bacteria 1313
321 Ga0500559_0002870 3300053136 Bacteria 8705
322 Ga0500564_000124 3300053138 Bacteria 19584
323 Ga0500577_0226439 3300053142 Bacteria 810
324 Ga0500620_091803 3300053155 Bacteria 1059
325 Ga0500622_0012336 3300053156 Bacteria 4627
326 Ga0500622_0024014 3300053156 Bacteria 3226
327 Ga0500622_0132873 3300053156 Bacteria 1194
328 Ga0500627_0020859 3300053158 Bacteria 2634
329 Ga0500637_0183879 3300053178 Bacteria 1196
330 Ga0500625_034108 3300053729 Bacteria 2413
331 Ga0500645_000275 3300053730 Bacteria 36860
332 Ga0500596_001155 3300053735 Bacteria 5309

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005367 Ga0070667_100576898 Ga0070667_1005768982 179
2 3300049763 Ga0501266_070026 Ga0501266_070026_10_549 179
3 3300026118 Ga0207675_100329502 Ga0207675_1003295023 197
4 3300031251 Ga0265327_10003325 Ga0265327_1000332512 197
5 3300005341 Ga0070691_10026852 Ga0070691_100268523 199
6 3300046460 Ga0495638_0335437 Ga0495638_0335437_136_735 199
7 3300053087 Ga0500643_008210 Ga0500643_008210_1770_2444 199
8 3300039447 Ga0436361_0836259 Ga0436361_0836259_39_746 200
9 3300005539 Ga0068853_100124086 Ga0068853_1001240862 202
10 3300005614 Ga0068856_100534086 Ga0068856_1005340862 202
11 3300009093 Ga0105240_10298959 Ga0105240_102989593 202
12 3300009093 Ga0105240_10649027 Ga0105240_106490271 202
13 3300009545 Ga0105237_10147317 Ga0105237_101473172 202
14 3300009551 Ga0105238_10012550 Ga0105238_1001255011 202
15 3300013105 Ga0157369_10649338 Ga0157369_106493381 202
16 3300025914 Ga0207671_10649765 Ga0207671_106497651 202
17 3300025924 Ga0207694_10083184 Ga0207694_100831843 202
18 3300005578 Ga0068854_100070726 Ga0068854_1000707262 204
19 3300025981 Ga0207640_10006138 Ga0207640_100061383 204
20 iso_pu_bacteria 2643221614 2644087851 206
21 iso_pu_bacteria 2643221661 2644345455 206
22 iso_pu_bacteria 2643221666 2644367207 206
23 3300009177 Ga0105248_10003203 Ga0105248_1000320311 207
24 3300009553 Ga0105249_10119720 Ga0105249_101197203 207
25 3300014325 Ga0163163_10005645 Ga0163163_1000564511 207
26 3300014968 Ga0157379_10002866 Ga0157379_1000286612 207
27 3300005616 Ga0068852_101184790 Ga0068852_1011847902 209
28 3300026142 Ga0207698_11164603 Ga0207698_111646032 209
29 3300005331 Ga0070670_100065381 Ga0070670_1000653814 210
30 3300005347 Ga0070668_100007991 Ga0070668_10000799110 210
31 3300005347 Ga0070668_100051502 Ga0070668_1000515023 210
32 3300005347 Ga0070668_100083711 Ga0070668_1000837112 210
33 3300005355 Ga0070671_100336077 Ga0070671_1003360772 210
34 3300005617 Ga0068859_100004040 Ga0068859_1000040406 210
35 3300005617 Ga0068859_100125552 Ga0068859_1001255523 210
36 3300005618 Ga0068864_100191986 Ga0068864_1001919862 210
37 3300005841 Ga0068863_100080562 Ga0068863_1000805623 210
38 3300005843 Ga0068860_100000327 Ga0068860_10000032753 210
39 3300005843 Ga0068860_100005399 Ga0068860_1000053994 210
40 3300005844 Ga0068862_100121215 Ga0068862_1001212153 210
41 3300006931 Ga0097620_100004040 Ga0097620_1000040406 210
42 3300006931 Ga0097620_100125555 Ga0097620_1001255553 210
43 3300009553 Ga0105249_10850001 Ga0105249_108500012 210
44 3300025923 Ga0207681_10201299 Ga0207681_102012992 210
45 3300025925 Ga0207650_10545940 Ga0207650_105459403 210
46 3300025931 Ga0207644_10125477 Ga0207644_101254772 210
47 3300025972 Ga0207668_10003471 Ga0207668_100034711 210
48 3300025972 Ga0207668_10025386 Ga0207668_100253863 210
49 3300025986 Ga0207658_10015462 Ga0207658_100154627 210
50 3300025986 Ga0207658_11245639 Ga0207658_112456391 210
51 3300026088 Ga0207641_10113593 Ga0207641_101135932 210
52 3300026095 Ga0207676_10282590 Ga0207676_102825901 210
53 3300026118 Ga0207675_100502336 Ga0207675_1005023361 210
54 3300028380 Ga0268265_10032729 Ga0268265_100327293 210
55 3300028381 Ga0268264_10000002 Ga0268264_1000000229 210
56 3300028381 Ga0268264_10031935 Ga0268264_100319354 210
57 3300031824 Ga0307413_10044372 Ga0307413_100443723 210
58 3300053108 Ga0500562_001866 Ga0500562_001866_255_893 210
59 3300009174 Ga0105241_10140741 Ga0105241_101407413 211
60 3300009551 Ga0105238_10026662 Ga0105238_100266627 211
61 3300031456 Ga0307513_10140173 Ga0307513_101401731 211
62 3300033180 Ga0307510_10059596 Ga0307510_100595963 211
63 3300049822 Ga0501035_0394014 Ga0501035_0394014_289_933 211
64 3300005367 Ga0070667_100398765 Ga0070667_1003987652 212
65 3300009093 Ga0105240_10624337 Ga0105240_106243372 212
66 3300025903 Ga0207680_10372537 Ga0207680_103725372 212
67 3300025913 Ga0207695_10055216 Ga0207695_100552164 212
68 3300028786 Ga0307517_10321394 Ga0307517_103213942 212
69 3300031456 Ga0307513_10000127 Ga0307513_1000012799 212
70 3300037471 Ga0395905_0538175 Ga0395905_0538175_269_913 212
71 3300046684 Ga0495669_0000002 Ga0495669_0000002_159514_160152 212
72 3300047445 Ga0495677_0014626 Ga0495677_0014626_2195_2833 212
73 iso_pu_bacteria 2582581279 2585149083 212
74 3300005335 Ga0070666_10125745 Ga0070666_101257452 213
75 3300005347 Ga0070668_100000042 Ga0070668_10000004242 213
76 3300005367 Ga0070667_100000508 Ga0070667_10000050845 213
77 3300005548 Ga0070665_100002287 Ga0070665_10000228717 213
78 3300005618 Ga0068864_100000135 Ga0068864_10000013516 213
79 3300005841 Ga0068863_100012986 Ga0068863_10001298610 213
80 3300005842 Ga0068858_100163937 Ga0068858_1001639372 213
81 3300005843 Ga0068860_100000133 Ga0068860_10000013377 213
82 3300005844 Ga0068862_100000619 Ga0068862_10000061940 213
83 3300009553 Ga0105249_10001002 Ga0105249_1000100221 213
84 3300013306 Ga0163162_10058517 Ga0163162_100585173 213
85 3300014325 Ga0163163_10752123 Ga0163163_107521231 213
86 3300014968 Ga0157379_10217714 Ga0157379_102177142 213
87 3300014969 Ga0157376_11365457 Ga0157376_113654571 213
88 3300025903 Ga0207680_10129949 Ga0207680_101299492 213
89 3300025925 Ga0207650_10000016 Ga0207650_10000016174 213
90 3300025961 Ga0207712_10000767 Ga0207712_1000076711 213
91 3300025972 Ga0207668_10001517 Ga0207668_100015176 213
92 3300025986 Ga0207658_10000295 Ga0207658_100002953 213
93 3300026035 Ga0207703_10124854 Ga0207703_101248542 213
94 3300026088 Ga0207641_10000612 Ga0207641_100006121 213
95 3300026095 Ga0207676_10002034 Ga0207676_100020342 213
96 3300028379 Ga0268266_10003072 Ga0268266_1000307217 213
97 3300028380 Ga0268265_10020122 Ga0268265_100201223 213
98 3300028381 Ga0268264_10000207 Ga0268264_1000020794 213
99 3300031824 Ga0307413_10063223 Ga0307413_100632234 213
100 3300032005 Ga0307411_10030372 Ga0307411_100303722 213
101 3300037312 Ga0395899_0000003 Ga0395899_0000003_1055383_1056072 213
102 3300044656 Ga0466969_0070359 Ga0466969_0070359_983_1663 213
103 3300048905 Ga0496102_0028562 Ga0496102_0028562_308_1045 213
104 3300048928 Ga0496125_0184336 Ga0496125_0184336_506_1147 213
105 3300053096 Ga0500641_0013153 Ga0500641_0013153_2212_2859 213
106 3300005262 Ga0065165_1013611 Ga0065165_10136112 214
107 3300005331 Ga0070670_100093445 Ga0070670_1000934452 214
108 3300005339 Ga0070660_100222121 Ga0070660_1002221212 214
109 3300005347 Ga0070668_100012234 Ga0070668_1000122345 214
110 3300005353 Ga0070669_100001732 Ga0070669_10000173212 214
111 3300005355 Ga0070671_100034751 Ga0070671_1000347512 214
112 3300005367 Ga0070667_100018211 Ga0070667_1000182115 214
113 3300005548 Ga0070665_100047592 Ga0070665_1000475923 214
114 3300005563 Ga0068855_100692171 Ga0068855_1006921712 214
115 3300005578 Ga0068854_100521483 Ga0068854_1005214831 214
116 3300005617 Ga0068859_100002919 Ga0068859_10000291912 214
117 3300005719 Ga0068861_100302200 Ga0068861_1003022002 214
118 3300005841 Ga0068863_100028469 Ga0068863_1000284694 214
119 3300006048 Ga0075363_100012342 Ga0075363_1000123424 214
120 3300006051 Ga0075364_10002894 Ga0075364_100028948 214
121 3300006178 Ga0075367_10050533 Ga0075367_100505332 214
122 3300006195 Ga0075366_10132173 Ga0075366_101321732 214
123 3300006881 Ga0068865_100003426 Ga0068865_10000342612 214
124 3300006931 Ga0097620_100002919 Ga0097620_10000291912 214
125 3300009093 Ga0105240_10831575 Ga0105240_108315751 214
126 3300009551 Ga0105238_10340904 Ga0105238_103409042 214
127 3300010375 Ga0105239_10356105 Ga0105239_103561054 214
128 3300013105 Ga0157369_11375386 Ga0157369_113753861 214
129 3300014969 Ga0157376_10658068 Ga0157376_106580683 214
130 3300021384 Ga0213876_10238172 Ga0213876_102381721 214
131 3300025250 Ga0209026_1009372 Ga0209026_10093721 214
132 3300025298 Ga0209050_1000073 Ga0209050_1000073211 214
133 3300025304 Ga0209257_1000099 Ga0209257_100009984 214
134 3300025923 Ga0207681_10016700 Ga0207681_100167003 214
135 3300025925 Ga0207650_10061323 Ga0207650_100613231 214
136 3300025931 Ga0207644_10011661 Ga0207644_100116614 214
137 3300025938 Ga0207704_10001415 Ga0207704_100014152 214
138 3300025941 Ga0207711_10032691 Ga0207711_100326914 214
139 3300025961 Ga0207712_10179562 Ga0207712_101795622 214
140 3300025986 Ga0207658_10010515 Ga0207658_100105153 214
141 3300026035 Ga0207703_10424296 Ga0207703_104242962 214
142 3300026088 Ga0207641_10009716 Ga0207641_100097166 214
143 3300026118 Ga0207675_100328581 Ga0207675_1003285812 214
144 3300027866 Ga0209813_10073416 Ga0209813_100734162 214
145 3300028379 Ga0268266_10071262 Ga0268266_100712623 214
146 3300031616 Ga0307508_10247849 Ga0307508_102478491 214
147 3300039437 Ga0436365_1808918 Ga0436365_1808918_115_801 214
148 3300044712 Ga0453684_0457767 Ga0453684_0457767_527_1177 214
149 3300046459 Ga0495629_0028909 Ga0495629_0028909_1095_1757 214
150 3300046499 Ga0495594_0099807 Ga0495594_0099807_357_1040 214
151 3300046506 Ga0495583_0043515 Ga0495583_0043515_70_732 214
152 3300046512 Ga0495610_0043653 Ga0495610_0043653_1048_1710 214
153 3300046515 Ga0495620_0009876 Ga0495620_0009876_3240_3902 214
154 3300046522 Ga0495643_0024988 Ga0495643_0024988_860_1522 214
155 3300046542 Ga0495597_0001511 Ga0495597_0001511_12339_13001 214
156 3300046557 Ga0495622_0165055 Ga0495622_0165055_320_982 214
157 3300046660 Ga0495625_0045312 Ga0495625_0045312_1769_2431 214
158 3300046684 Ga0495669_0001666 Ga0495669_0001666_2762_3409 214
159 3300046684 Ga0495669_0163625 Ga0495669_0163625_300_983 214
160 3300046690 Ga0495624_0182011 Ga0495624_0182011_327_989 214
161 3300047315 Ga0495581_0036008 Ga0495581_0036008_722_1405 214
162 3300047445 Ga0495677_0020070 Ga0495677_0020070_1100_1747 214
163 3300048088 Ga0495602_0261399 Ga0495602_0261399_278_940 214
164 3300049570 Ga0501033_0329009 Ga0501033_0329009_172_846 214
165 3300049573 Ga0501037_0029285 Ga0501037_0029285_1954_2628 214
166 3300049579 Ga0501043_0398854 Ga0501043_0398854_45_719 214
167 3300049581 Ga0501047_0412469 Ga0501047_0412469_349_1041 214
168 3300049822 Ga0501035_0168035 Ga0501035_0168035_48_722 214
169 3300049823 Ga0501044_0015676 Ga0501044_0015676_1934_2608 214
170 3300049823 Ga0501044_0505073 Ga0501044_0505073_448_1098 214
171 3300050490 nmdc:mga03n38_13034_c1 nmdc:mga03n38_13034_c1_2333_3007 214
172 3300050491 nmdc:mga00v17_1568_c1 nmdc:mga00v17_1568_c1_4446_5144 214
173 3300050494 nmdc:mga06z11_11903_c1 nmdc:mga06z11_11903_c1_2887_3585 214
174 3300050495 nmdc:mga04h51_92005_c1 nmdc:mga04h51_92005_c1_72_770 214
175 3300050496 nmdc:mga07m45_6049_c1 nmdc:mga07m45_6049_c1_104_778 214
176 3300053090 Ga0500646_0049521 Ga0500646_0049521_322_999 214
177 3300053093 Ga0500651_0014561 Ga0500651_0014561_1081_1743 214
178 3300053094 Ga0500566_0011904 Ga0500566_0011904_301_963 214
179 3300053102 Ga0500554_008238 Ga0500554_008238_1318_1986 214
180 3300053103 Ga0500555_008739 Ga0500555_008739_1136_1813 214
181 3300053109 Ga0500569_009192 Ga0500569_009192_1298_1960 214
182 3300053111 Ga0500572_058843 Ga0500572_058843_209_871 214
183 3300053119 Ga0500595_003495 Ga0500595_003495_6540_7202 214
184 3300053121 Ga0500607_097362 Ga0500607_097362_751_1413 214
185 3300053122 Ga0500608_000730 Ga0500608_000730_5847_6509 214
186 3300053123 Ga0500614_011761 Ga0500614_011761_307_975 214
187 3300053123 Ga0500614_030620 Ga0500614_030620_259_921 214
188 3300053142 Ga0500577_0226439 Ga0500577_0226439_56_718 214
189 3300053155 Ga0500620_091803 Ga0500620_091803_103_765 214
190 3300053178 Ga0500637_0183879 Ga0500637_0183879_159_821 214
191 3300053729 Ga0500625_034108 Ga0500625_034108_1388_2050 214
192 3300053735 Ga0500596_001155 Ga0500596_001155_4247_4909 214
193 3300005262 Ga0065165_1000622 Ga0065165_10006225 215
194 3300005336 Ga0070680_100299433 Ga0070680_1002994332 215
195 3300005366 Ga0070659_100035674 Ga0070659_1000356742 215
196 3300005458 Ga0070681_10019109 Ga0070681_100191093 215
197 3300005539 Ga0068853_100128819 Ga0068853_1001288191 215
198 3300009093 Ga0105240_10029544 Ga0105240_100295446 215
199 3300009551 Ga0105238_10066127 Ga0105238_100661273 215
200 3300009551 Ga0105238_10432035 Ga0105238_104320352 215
201 3300021361 Ga0213872_10002032 Ga0213872_1000203213 215
202 3300025304 Ga0209257_1004182 Ga0209257_10041823 215
203 3300025909 Ga0207705_10118761 Ga0207705_101187611 215
204 3300025913 Ga0207695_10000321 Ga0207695_1000032173 215
205 3300025913 Ga0207695_10001284 Ga0207695_1000128414 215
206 3300025917 Ga0207660_10066658 Ga0207660_100666583 215
207 3300025924 Ga0207694_10054115 Ga0207694_100541152 215
208 3300025924 Ga0207694_10326641 Ga0207694_103266412 215
209 3300025932 Ga0207690_10000196 Ga0207690_1000019613 215
210 3300026041 Ga0207639_10096590 Ga0207639_100965901 215
211 3300039447 Ga0436361_0270208 Ga0436361_0270208_327_1064 215
212 3300039447 Ga0436361_1143308 Ga0436361_1143308_1320_2054 215
213 3300046471 Ga0495650_0059683 Ga0495650_0059683_315_977 215
214 3300046616 Ga0495668_0248495 Ga0495668_0248495_19_687 215
215 3300048918 Ga0496115_0028461 Ga0496115_0028461_1227_1901 215
216 3300053730 Ga0500645_000275 Ga0500645_000275_31584_32243 215
217 iso_pu_bacteria 2791355048 2792461657 215
218 iso_pu_bacteria 2843744320 2843746116 215
219 iso_pu_bacteria 2851153111 2851153414 215
220 3300009098 Ga0105245_10197647 Ga0105245_101976473 216
221 3300009176 Ga0105242_11251970 Ga0105242_112519701 216
222 3300053103 Ga0500555_059354 Ga0500555_059354_58_714 216
223 3300053156 Ga0500622_0012336 Ga0500622_0012336_3939_4589 216
224 iso_pu_bacteria 2585428106 2587915451 216
225 iso_pu_bacteria 2643221640 2644224008 216
226 iso_pu_bacteria 2643221642 2644232994 216
227 iso_pu_bacteria 2857504554 2857507948 216
228 iso_pu_bacteria 2884960567 2884965797 216
229 iso_pu_bacteria 2928531327 2928534899 216
230 3300025917 Ga0207660_10068105 Ga0207660_100681053 217
231 3300033180 Ga0307510_10006409 Ga0307510_1000640912 217
232 3300003794 Ga0055531_10010235 Ga0055531_100102355 218
233 3300005331 Ga0070670_100098650 Ga0070670_1000986501 218
234 3300005355 Ga0070671_100053623 Ga0070671_1000536232 218
235 3300005456 Ga0070678_100211375 Ga0070678_1002113752 218
236 3300005539 Ga0068853_100052429 Ga0068853_1000524292 218
237 3300005564 Ga0070664_100120177 Ga0070664_1001201773 218
238 3300005841 Ga0068863_100211778 Ga0068863_1002117782 218
239 3300009177 Ga0105248_10406857 Ga0105248_104068571 218
240 3300013308 Ga0157375_10037572 Ga0157375_100375725 218
241 3300014968 Ga0157379_10174128 Ga0157379_101741281 218
242 3300025913 Ga0207695_10282077 Ga0207695_102820773 218
243 3300025924 Ga0207694_10005274 Ga0207694_100052746 218
244 3300025925 Ga0207650_10199229 Ga0207650_101992292 218
245 3300025941 Ga0207711_10153418 Ga0207711_101534182 218
246 3300025945 Ga0207679_10121354 Ga0207679_101213542 218
247 3300026041 Ga0207639_10118467 Ga0207639_101184672 218
248 3300028786 Ga0307517_10002333 Ga0307517_1000233324 218
249 3300031456 Ga0307513_10000899 Ga0307513_1000089921 218
250 3300037853 Ga0436364_1402286 Ga0436364_1402286_485_1198 218
251 3300046457 Ga0495590_0042284 Ga0495590_0042284_390_1046 218
252 3300046460 Ga0495638_0000443 Ga0495638_0000443_49089_49745 218
253 3300046460 Ga0495638_0001159 Ga0495638_0001159_7663_8319 218
254 3300046512 Ga0495610_0008577 Ga0495610_0008577_339_995 218
255 3300046520 Ga0495637_0146740 Ga0495637_0146740_27_683 218
256 3300046530 Ga0495654_0000051 Ga0495654_0000051_32976_33635 218
257 3300046530 Ga0495654_0107631 Ga0495654_0107631_533_1189 218
258 3300046616 Ga0495668_0014600 Ga0495668_0014600_1333_1989 218
259 3300046616 Ga0495668_0290003 Ga0495668_0290003_165_836 218
260 3300047472 Ga0495686_0006377 Ga0495686_0006377_8165_8821 218
261 3300047472 Ga0495686_0008921 Ga0495686_0008921_2031_2690 218
262 3300048904 Ga0496101_0036361 Ga0496101_0036361_1451_2125 218
263 3300048905 Ga0496102_0195110 Ga0496102_0195110_38_712 218
264 3300048906 Ga0496103_0154962 Ga0496103_0154962_593_1267 218
265 3300048907 Ga0496104_0062720 Ga0496104_0062720_1347_2021 218
266 3300048909 Ga0496106_0235833 Ga0496106_0235833_493_1167 218
267 3300048910 Ga0496107_0036473 Ga0496107_0036473_670_1344 218
268 3300048911 Ga0496108_0045960 Ga0496108_0045960_1651_2325 218
269 3300048912 Ga0496109_0028143 Ga0496109_0028143_2304_2978 218
270 3300048916 Ga0496113_0025223 Ga0496113_0025223_3157_3831 218
271 3300048918 Ga0496115_0004005 Ga0496115_0004005_3606_4265 218
272 3300049459 Ga0495678_001468 Ga0495678_001468_452_1108 218
273 3300053086 Ga0500578_0002060 Ga0500578_0002060_17097_17753 218
274 3300053088 Ga0500644_0204822 Ga0500644_0204822_92_748 218
275 3300053108 Ga0500562_053301 Ga0500562_053301_359_1015 218
276 3300053118 Ga0500594_0005777 Ga0500594_0005777_1724_2380 218
277 3300053158 Ga0500627_0020859 Ga0500627_0020859_50_709 218
278 iso_pu_bacteria 2643221691 2644510183 218
279 3300005327 Ga0070658_10139086 Ga0070658_101390863 219
280 3300005548 Ga0070665_100104982 Ga0070665_1001049823 219
281 3300025909 Ga0207705_10235873 Ga0207705_102358732 219
282 3300027378 Ga0209981_1002487 Ga0209981_10024873 219
283 3300027665 Ga0209983_1037479 Ga0209983_10374792 219
284 3300031730 Ga0307516_10000001 Ga0307516_10000001467 219
285 3300035171 Ga0373946_0005900 Ga0373946_0005900_911_1591 219
286 3300035691 Ga0373931_0327221 Ga0373931_0327221_156_824 219
287 3300035695 Ga0373927_0001110 Ga0373927_0001110_15942_16622 219
288 3300037068 Ga0373925_0000489 Ga0373925_0000489_6174_6854 219
289 3300046616 Ga0495668_0092678 Ga0495668_0092678_852_1529 219
290 3300046648 Ga0495611_0059932 Ga0495611_0059932_539_1216 219
291 3300003781 Ga0055536_1009567 Ga0055536_10095675 220
292 3300003791 Ga0055530_10007656 Ga0055530_100076561 220
293 3300003792 Ga0055540_1033032 Ga0055540_10330321 220
294 3300003794 Ga0055531_10003368 Ga0055531_100033685 220
295 3300005614 Ga0068856_100125293 Ga0068856_1001252933 220
296 3300006195 Ga0075366_10012408 Ga0075366_100124085 220
297 3300014325 Ga0163163_10147343 Ga0163163_101473433 220
298 3300025292 Ga0209676_1000163 Ga0209676_100016363 220
299 3300025292 Ga0209676_1000188 Ga0209676_100018892 220
300 3300025298 Ga0209050_1001523 Ga0209050_10015232 220
301 3300025298 Ga0209050_1002911 Ga0209050_100291118 220
302 3300025303 Ga0209051_1003688 Ga0209051_100368814 220
303 3300025304 Ga0209257_1001816 Ga0209257_100181625 220
304 3300025981 Ga0207640_10206553 Ga0207640_102065532 220
305 3300026095 Ga0207676_10127204 Ga0207676_101272043 220
306 3300031456 Ga0307513_10000983 Ga0307513_1000098315 220
307 3300046542 Ga0495597_0128964 Ga0495597_0128964_344_1021 220
308 3300046616 Ga0495668_0029230 Ga0495668_0029230_2342_3019 220
309 3300046616 Ga0495668_0042514 Ga0495668_0042514_1751_2449 220
310 3300046684 Ga0495669_0061677 Ga0495669_0061677_608_1306 220
311 3300048918 Ga0496115_0001630 Ga0496115_0001630_15382_16071 220
312 3300048922 Ga0496119_0006503 Ga0496119_0006503_8735_9418 220
313 3300048923 Ga0496120_0155921 Ga0496120_0155921_189_872 220
314 3300048924 Ga0496121_0000035 Ga0496121_0000035_222658_223341 220
315 3300048924 Ga0496121_0451700 Ga0496121_0451700_113_802 220
316 3300050493 nmdc:mga0k408_10166_c1 nmdc:mga0k408_10166_c1_1214_1891 220
317 3300053122 Ga0500608_000027 Ga0500608_000027_30356_31036 220
318 3300053136 Ga0500559_0002870 Ga0500559_0002870_518_1198 220
319 3300053156 Ga0500622_0024014 Ga0500622_0024014_100_780 220
320 3300053156 Ga0500622_0132873 Ga0500622_0132873_470_1147 220
321 3300003794 Ga0055531_10005526 Ga0055531_100055263 221
322 3300005327 Ga0070658_10196539 Ga0070658_101965392 221
323 3300005844 Ga0068862_100803775 Ga0068862_1008037752 221
324 3300025949 Ga0207667_10502190 Ga0207667_105021902 221
325 3300028380 Ga0268265_11205897 Ga0268265_112058971 221
326 3300037418 Ga0395900_0173883 Ga0395900_0173883_1305_2000 221
327 3300037418 Ga0395900_0244381 Ga0395900_0244381_865_1581 221
328 3300037466 Ga0395898_0154532 Ga0395898_0154532_1411_2106 221
329 3300037471 Ga0395905_0125231 Ga0395905_0125231_1418_2134 221
330 3300037471 Ga0395905_0401585 Ga0395905_0401585_135_830 221
331 3300046539 Ga0495621_0018414 Ga0495621_0018414_814_1494 221
332 3300047469 Ga0495673_0002251 Ga0495673_0002251_12950_13630 221
333 3300048090 Ga0495615_0006676 Ga0495615_0006676_200_880 221
334 3300050496 nmdc:mga07m45_134004_c1 nmdc:mga07m45_134004_c1_373_1041 221
335 3300053088 Ga0500644_0006900 Ga0500644_0006900_219_899 221
336 3300053138 Ga0500564_000124 Ga0500564_000124_4345_5025 221
337 3300046660 Ga0495625_0028435 Ga0495625_0028435_3420_4088 222
338 3300039437 Ga0436365_1146874 Ga0436365_1146874_5259_5939 225
339 3300049581 Ga0501047_0152833 Ga0501047_0152833_378_1109 227
340 3300003775 Ga0055524_1047998 Ga0055524_10479981 235
341 3300003790 Ga0055528_1005584 Ga0055528_10055847 235
342 3300003790 Ga0055528_1005883 Ga0055528_10058831 235
343 3300025263 Ga0209565_1001766 Ga0209565_10017669 235
344 3300025273 Ga0209673_1000788 Ga0209673_100078813 235
345 3300025297 Ga0209758_1007549 Ga0209758_100754911 235
346 3300025299 Ga0209256_1006331 Ga0209256_10063311 235

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08511

COQ9

COQ9

150

218

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6awl-assembly1.cif.gz_B crystal structure of human coq9 0.7618 30 203
5cxg-assembly2.cif.gz_D crystal structure of mycobacterium tuberculosis kstr in complex with peg 0.7443 30 200
7sss-assembly1.cif.gz_D structure of the nadh-bound human coq7:coq9 complex by single-particle electron cryo-microscopy 0.7362 30 204
3ni7-assembly1.cif.gz_A crystal structure of the tetr transcriptional regulator from nitrosomonas europaea atcc 19718 0.7343 30 208
3c07-assembly1.cif.gz_B crystal structure of a tetr family transcriptional regulator from streptomyces coelicolor a3(2) 0.7337 29 225
ID Description Score Start End Superfamily
af_O13850_45_223_1.10.357.10 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;Tetracycline Repressor, domain 2 0.8099 33 204 1.10.357.10
af_Q8MKN0_104_290_1.10.357.10 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;Tetracycline Repressor, domain 2 0.803 28 204 1.10.357.10
af_A0A1D8PU08_72_259_1.10.357.10 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;Tetracycline Repressor, domain 2 0.8019 37 203 1.10.357.10
af_A0A2R8QKY8_107_294_1.10.357.10 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;Tetracycline Repressor, domain 2 0.7904 30 202 1.10.357.10
af_I1LY75_91_272_1.10.357.10 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;Tetracycline Repressor, domain 2 0.7786 28 202 1.10.357.10
ID Description Score Start End GO Terms
AF-A0A4Q3TX93-F1-model_v4 COQ9 family protein 0.9652 26 181 GO:0006744
GO:0008289
AF-A0A3B9L149-F1-model_v4 COQ9 family protein 0.9503 29 177 GO:0006744
GO:0008289
AF-A0A2S6RNK9-F1-model_v4 COQ9 C-terminal domain-containing protein 0.943 28 201 GO:0006744
GO:0008289
AF-A0A6B3UME6-F1-model_v4 COQ9 family protein 0.9388 22 233 GO:0006744
GO:0008289
AF-A0A258K957-F1-model_v4 RpsU-divergently transcribed protein 0.9387 14 215 GO:0006744
GO:0008289

Feature Viewer

pLDDT pTM Quality
86.27 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map