F416925
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 346 | 211 | 332 | 221 |
Family's Representative Sequence
| Representative Sequence | 3300049581|Ga0501047_0152833|Ga0501047_0152833_378_1109 |
| Length | 243 |
| Sequence | LPEGRLIRLLKISSRLPPRAAFVYDGPMNDATGAEADWASEAEQRVLDEALRLIPLKGWSQPMVLEAGRAAGLSAGETGLLLPHGPADLAALLSRRHDAQALAALGSTDPTSLKIRDRIARAVEARLDAACADEASVRRWTGFLALPPNMALGGRLLWESADVLWRWAGDVATDENHYSKRAILSAILATALAIRLTSGRTAALKHVSARIDNVMAFEKWKAGVKAPDVLRDIALALGKIRYR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 2 | 2585428106 | Caulobacter sp. OV484 | Isolate | Rhizosphere |
| 3 | 2643221614 | Phenylobacterium sp. Root77 | Isolate | Unclassified |
| 4 | 2643221640 | Caulobacter sp. Root342 | Isolate | Unclassified |
| 5 | 2643221642 | Caulobacter sp. Root343 | Isolate | Unclassified |
| 6 | 2643221661 | Phenylobacterium sp. Root1277 | Isolate | Unclassified |
| 7 | 2643221666 | Phenylobacterium sp. Root1290 | Isolate | Unclassified |
| 8 | 2643221691 | Caulobacter sp. Root487D2Y | Isolate | Unclassified |
| 9 | 2791355048 | Caulobacter flavus CGMCC1 15093 | Isolate | Rhizosphere |
| 10 | 2843744320 | Caulobacter flavus RHGG3 | Isolate | Unclassified |
| 11 | 2851153111 | Caulobacter radicis 736 | Isolate | Unclassified |
| 12 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 13 | 2884960567 | Caulobacter sp. 602-1 | Isolate | Rhizosphere |
| 14 | 2928531327 | Caulobacter sp. 1776 | Isolate | Rhizosphere |
| 15 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 17 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 18 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 19 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 20 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 22 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 36 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 38 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 40 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 41 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 42 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 43 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 44 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 45 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 46 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 47 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 48 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 49 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 50 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 51 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 52 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 53 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 54 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 71 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 72 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 73 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 74 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 75 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 79 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 112 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 113 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 114 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 115 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 116 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 117 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 118 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 119 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 120 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 121 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 122 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 123 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 124 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 125 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 126 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 127 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 128 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 129 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 130 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 131 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 132 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 158 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 159 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 160 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 161 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 162 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 163 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 164 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 165 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 166 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 167 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 168 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 169 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 170 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 171 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 173 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 174 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 175 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 176 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 177 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 178 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 179 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 180 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 181 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 182 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 183 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 184 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 185 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 186 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 187 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 188 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 189 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 190 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 191 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 192 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 193 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 194 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 195 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 196 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 197 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 198 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 199 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 200 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 201 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 202 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 203 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 204 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 205 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 206 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 207 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 208 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 209 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 210 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 211 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.95 |
| Metatranscriptomes | 0 |
| Isolates | 4.05 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 20.52 |
| Nodule | 0 |
| Rhizoplane | 3.76 |
| Rhizosphere | 67.34 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.38 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0055524_1047998 | 3300003775 | Bacteria | 1000 |
| 2 | Ga0055536_1009567 | 3300003781 | Bacteria | 3986 |
| 3 | Ga0055528_1005584 | 3300003790 | Bacteria | 5821 |
| 4 | Ga0055528_1005883 | 3300003790 | Bacteria | 5632 |
| 5 | Ga0055530_10007656 | 3300003791 | Bacteria | 4500 |
| 6 | Ga0055540_1033032 | 3300003792 | Bacteria | 1176 |
| 7 | Ga0055531_10003368 | 3300003794 | Bacteria | 10220 |
| 8 | Ga0055531_10005526 | 3300003794 | Bacteria | 7381 |
| 9 | Ga0055531_10010235 | 3300003794 | Bacteria | 4689 |
| 10 | Ga0065165_1000622 | 3300005262 | Bacteria | 51482 |
| 11 | Ga0065165_1013611 | 3300005262 | Bacteria | 3221 |
| 12 | Ga0070658_10139086 | 3300005327 | Bacteria | 2027 |
| 13 | Ga0070658_10196539 | 3300005327 | Bacteria | 1701 |
| 14 | Ga0070670_100065381 | 3300005331 | Bacteria | 3121 |
| 15 | Ga0070670_100093445 | 3300005331 | Bacteria | 2587 |
| 16 | Ga0070670_100098650 | 3300005331 | Bacteria | 2514 |
| 17 | Ga0070666_10125745 | 3300005335 | Bacteria | 1780 |
| 18 | Ga0070680_100299433 | 3300005336 | Bacteria | 1364 |
| 19 | Ga0070660_100222121 | 3300005339 | Bacteria | 1536 |
| 20 | Ga0070691_10026852 | 3300005341 | Bacteria | 2685 |
| 21 | Ga0070668_100000042 | 3300005347 | Bacteria | 78694 |
| 22 | Ga0070668_100007991 | 3300005347 | Bacteria | 7858 |
| 23 | Ga0070668_100012234 | 3300005347 | Bacteria | 6394 |
| 24 | Ga0070668_100051502 | 3300005347 | Bacteria | 3172 |
| 25 | Ga0070668_100083711 | 3300005347 | Bacteria | 2504 |
| 26 | Ga0070669_100001732 | 3300005353 | Bacteria | 15750 |
| 27 | Ga0070671_100034751 | 3300005355 | Bacteria | 4174 |
| 28 | Ga0070671_100053623 | 3300005355 | Bacteria | 3352 |
| 29 | Ga0070671_100336077 | 3300005355 | Bacteria | 1288 |
| 30 | Ga0070659_100035674 | 3300005366 | Bacteria | 3873 |
| 31 | Ga0070667_100000508 | 3300005367 | Bacteria | 39312 |
| 32 | Ga0070667_100018211 | 3300005367 | Bacteria | 5823 |
| 33 | Ga0070667_100398765 | 3300005367 | Bacteria | 1252 |
| 34 | Ga0070667_100576898 | 3300005367 | Bacteria | 1035 |
| 35 | Ga0070678_100211375 | 3300005456 | Bacteria | 1607 |
| 36 | Ga0070681_10019109 | 3300005458 | Bacteria | 6858 |
| 37 | Ga0068853_100052429 | 3300005539 | Bacteria | 3514 |
| 38 | Ga0068853_100124086 | 3300005539 | Bacteria | 2306 |
| 39 | Ga0068853_100128819 | 3300005539 | Bacteria | 2263 |
| 40 | Ga0070665_100002287 | 3300005548 | Bacteria | 21311 |
| 41 | Ga0070665_100047592 | 3300005548 | Bacteria | 4304 |
| 42 | Ga0070665_100104982 | 3300005548 | Bacteria | 2827 |
| 43 | Ga0068855_100692171 | 3300005563 | Bacteria | 1092 |
| 44 | Ga0070664_100120177 | 3300005564 | Bacteria | 2300 |
| 45 | Ga0068854_100070726 | 3300005578 | Bacteria | 2551 |
| 46 | Ga0068854_100521483 | 3300005578 | Bacteria | 1004 |
| 47 | Ga0068856_100125293 | 3300005614 | Bacteria | 2572 |
| 48 | Ga0068856_100534086 | 3300005614 | Bacteria | 1194 |
| 49 | Ga0068852_101184790 | 3300005616 | Bacteria | 785 |
| 50 | Ga0068859_100002919 | 3300005617 | Bacteria | 17364 |
| 51 | Ga0068859_100004040 | 3300005617 | Bacteria | 14959 |
| 52 | Ga0068859_100125552 | 3300005617 | Bacteria | 2635 |
| 53 | Ga0068864_100000135 | 3300005618 | Bacteria | 71759 |
| 54 | Ga0068864_100191986 | 3300005618 | Bacteria | 1873 |
| 55 | Ga0068861_100302200 | 3300005719 | Bacteria | 1387 |
| 56 | Ga0068863_100012986 | 3300005841 | Bacteria | 8032 |
| 57 | Ga0068863_100028469 | 3300005841 | Bacteria | 5335 |
| 58 | Ga0068863_100080562 | 3300005841 | Bacteria | 3084 |
| 59 | Ga0068863_100211778 | 3300005841 | Bacteria | 1866 |
| 60 | Ga0068858_100163937 | 3300005842 | Bacteria | 2094 |
| 61 | Ga0068860_100000133 | 3300005843 | Bacteria | 120382 |
| 62 | Ga0068860_100000327 | 3300005843 | Bacteria | 64590 |
| 63 | Ga0068860_100005399 | 3300005843 | Bacteria | 12968 |
| 64 | Ga0068862_100000619 | 3300005844 | Bacteria | 36984 |
| 65 | Ga0068862_100121215 | 3300005844 | Bacteria | 2305 |
| 66 | Ga0068862_100803775 | 3300005844 | Unclassified | 918 |
| 67 | Ga0075363_100012342 | 3300006048 | Bacteria | 4116 |
| 68 | Ga0075364_10002894 | 3300006051 | Bacteria | 9679 |
| 69 | Ga0075367_10050533 | 3300006178 | Bacteria | 2455 |
| 70 | Ga0075366_10012408 | 3300006195 | Bacteria | 4833 |
| 71 | Ga0075366_10132173 | 3300006195 | Bacteria | 1506 |
| 72 | Ga0068865_100003426 | 3300006881 | Bacteria | 9489 |
| 73 | Ga0097620_100002919 | 3300006931 | Bacteria | 17364 |
| 74 | Ga0097620_100004040 | 3300006931 | Bacteria | 14959 |
| 75 | Ga0097620_100125555 | 3300006931 | Bacteria | 2635 |
| 76 | Ga0105240_10029544 | 3300009093 | Bacteria | 7139 |
| 77 | Ga0105240_10298959 | 3300009093 | Bacteria | 1842 |
| 78 | Ga0105240_10624337 | 3300009093 | Bacteria | 1184 |
| 79 | Ga0105240_10649027 | 3300009093 | Bacteria | 1157 |
| 80 | Ga0105240_10831575 | 3300009093 | Bacteria | 998 |
| 81 | Ga0105245_10197647 | 3300009098 | Bacteria | 1930 |
| 82 | Ga0105241_10140741 | 3300009174 | Bacteria | 1964 |
| 83 | Ga0105242_11251970 | 3300009176 | Bacteria | 763 |
| 84 | Ga0105248_10003203 | 3300009177 | Bacteria | 18150 |
| 85 | Ga0105248_10406857 | 3300009177 | Bacteria | 1532 |
| 86 | Ga0105237_10147317 | 3300009545 | Bacteria | 2349 |
| 87 | Ga0105238_10012550 | 3300009551 | Bacteria | 8551 |
| 88 | Ga0105238_10026662 | 3300009551 | Bacteria | 5891 |
| 89 | Ga0105238_10066127 | 3300009551 | Bacteria | 3617 |
| 90 | Ga0105238_10340904 | 3300009551 | Bacteria | 1487 |
| 91 | Ga0105238_10432035 | 3300009551 | Unclassified | 1312 |
| 92 | Ga0105249_10001002 | 3300009553 | Bacteria | 25047 |
| 93 | Ga0105249_10119720 | 3300009553 | Bacteria | 2501 |
| 94 | Ga0105249_10850001 | 3300009553 | Bacteria | 978 |
| 95 | Ga0105239_10356105 | 3300010375 | Bacteria | 1652 |
| 96 | Ga0157369_10649338 | 3300013105 | Bacteria | 1088 |
| 97 | Ga0157369_11375386 | 3300013105 | Bacteria | 719 |
| 98 | Ga0163162_10058517 | 3300013306 | Bacteria | 3883 |
| 99 | Ga0157375_10037572 | 3300013308 | Bacteria | 4641 |
| 100 | Ga0163163_10005645 | 3300014325 | Bacteria | 10844 |
| 101 | Ga0163163_10147343 | 3300014325 | Bacteria | 2398 |
| 102 | Ga0163163_10752123 | 3300014325 | Bacteria | 1038 |
| 103 | Ga0157379_10002866 | 3300014968 | Bacteria | 14544 |
| 104 | Ga0157379_10174128 | 3300014968 | Bacteria | 1943 |
| 105 | Ga0157379_10217714 | 3300014968 | Bacteria | 1730 |
| 106 | Ga0157376_10658068 | 3300014969 | Bacteria | 1049 |
| 107 | Ga0157376_11365457 | 3300014969 | Bacteria | 740 |
| 108 | Ga0213872_10002032 | 3300021361 | Bacteria | 12295 |
| 109 | Ga0213876_10238172 | 3300021384 | Unclassified | 967 |
| 110 | Ga0209026_1009372 | 3300025250 | Bacteria | 1929 |
| 111 | Ga0209565_1001766 | 3300025263 | Bacteria | 8804 |
| 112 | Ga0209673_1000788 | 3300025273 | Bacteria | 42315 |
| 113 | Ga0209676_1000163 | 3300025292 | Bacteria | 157845 |
| 114 | Ga0209676_1000188 | 3300025292 | Bacteria | 141232 |
| 115 | Ga0209758_1007549 | 3300025297 | Bacteria | 7355 |
| 116 | Ga0209050_1000073 | 3300025298 | Bacteria | 292046 |
| 117 | Ga0209050_1001523 | 3300025298 | Bacteria | 24437 |
| 118 | Ga0209050_1002911 | 3300025298 | Bacteria | 13441 |
| 119 | Ga0209256_1006331 | 3300025299 | Bacteria | 6320 |
| 120 | Ga0209051_1003688 | 3300025303 | Bacteria | 9895 |
| 121 | Ga0209257_1000099 | 3300025304 | Bacteria | 255304 |
| 122 | Ga0209257_1001816 | 3300025304 | Bacteria | 23363 |
| 123 | Ga0209257_1004182 | 3300025304 | Bacteria | 11450 |
| 124 | Ga0207680_10129949 | 3300025903 | Bacteria | 1659 |
| 125 | Ga0207680_10372537 | 3300025903 | Bacteria | 1005 |
| 126 | Ga0207705_10118761 | 3300025909 | Bacteria | 1960 |
| 127 | Ga0207705_10235873 | 3300025909 | Bacteria | 1392 |
| 128 | Ga0207695_10000321 | 3300025913 | Bacteria | 116087 |
| 129 | Ga0207695_10001284 | 3300025913 | Bacteria | 42684 |
| 130 | Ga0207695_10055216 | 3300025913 | Bacteria | 4141 |
| 131 | Ga0207695_10282077 | 3300025913 | Bacteria | 1555 |
| 132 | Ga0207671_10649765 | 3300025914 | Bacteria | 840 |
| 133 | Ga0207660_10066658 | 3300025917 | Bacteria | 2605 |
| 134 | Ga0207660_10068105 | 3300025917 | Bacteria | 2580 |
| 135 | Ga0207681_10016700 | 3300025923 | Bacteria | 4598 |
| 136 | Ga0207681_10201299 | 3300025923 | Bacteria | 1529 |
| 137 | Ga0207694_10005274 | 3300025924 | Bacteria | 9958 |
| 138 | Ga0207694_10054115 | 3300025924 | Bacteria | 3113 |
| 139 | Ga0207694_10083184 | 3300025924 | Bacteria | 2516 |
| 140 | Ga0207694_10326641 | 3300025924 | Unclassified | 1267 |
| 141 | Ga0207650_10000016 | 3300025925 | Bacteria | 361958 |
| 142 | Ga0207650_10061323 | 3300025925 | Bacteria | 2808 |
| 143 | Ga0207650_10199229 | 3300025925 | Bacteria | 1603 |
| 144 | Ga0207650_10545940 | 3300025925 | Bacteria | 971 |
| 145 | Ga0207644_10011661 | 3300025931 | Bacteria | 5821 |
| 146 | Ga0207644_10125477 | 3300025931 | Bacteria | 1959 |
| 147 | Ga0207690_10000196 | 3300025932 | Bacteria | 47111 |
| 148 | Ga0207704_10001415 | 3300025938 | Bacteria | 10726 |
| 149 | Ga0207711_10032691 | 3300025941 | Bacteria | 4399 |
| 150 | Ga0207711_10153418 | 3300025941 | Bacteria | 2080 |
| 151 | Ga0207679_10121354 | 3300025945 | Bacteria | 2081 |
| 152 | Ga0207667_10502190 | 3300025949 | Bacteria | 1230 |
| 153 | Ga0207712_10000767 | 3300025961 | Bacteria | 24118 |
| 154 | Ga0207712_10179562 | 3300025961 | Bacteria | 1661 |
| 155 | Ga0207668_10001517 | 3300025972 | Bacteria | 13565 |
| 156 | Ga0207668_10003471 | 3300025972 | Bacteria | 9248 |
| 157 | Ga0207668_10025386 | 3300025972 | Bacteria | 3834 |
| 158 | Ga0207640_10006138 | 3300025981 | Bacteria | 6574 |
| 159 | Ga0207640_10206553 | 3300025981 | Bacteria | 1493 |
| 160 | Ga0207658_10000295 | 3300025986 | Bacteria | 52135 |
| 161 | Ga0207658_10010515 | 3300025986 | Bacteria | 6287 |
| 162 | Ga0207658_10015462 | 3300025986 | Bacteria | 5235 |
| 163 | Ga0207658_11245639 | 3300025986 | Bacteria | 680 |
| 164 | Ga0207703_10124854 | 3300026035 | Bacteria | 2214 |
| 165 | Ga0207703_10424296 | 3300026035 | Bacteria | 1238 |
| 166 | Ga0207639_10096590 | 3300026041 | Bacteria | 2377 |
| 167 | Ga0207639_10118467 | 3300026041 | Bacteria | 2171 |
| 168 | Ga0207641_10000612 | 3300026088 | Bacteria | 39133 |
| 169 | Ga0207641_10009716 | 3300026088 | Bacteria | 7924 |
| 170 | Ga0207641_10113593 | 3300026088 | Bacteria | 2405 |
| 171 | Ga0207676_10002034 | 3300026095 | Bacteria | 14697 |
| 172 | Ga0207676_10127204 | 3300026095 | Bacteria | 2160 |
| 173 | Ga0207676_10282590 | 3300026095 | Bacteria | 1507 |
| 174 | Ga0207675_100328581 | 3300026118 | Bacteria | 1494 |
| 175 | Ga0207675_100329502 | 3300026118 | Bacteria | 1492 |
| 176 | Ga0207675_100502336 | 3300026118 | Bacteria | 1207 |
| 177 | Ga0207698_11164603 | 3300026142 | Bacteria | 785 |
| 178 | Ga0209981_1002487 | 3300027378 | Bacteria | 2350 |
| 179 | Ga0209983_1037479 | 3300027665 | Bacteria | 1044 |
| 180 | Ga0209813_10073416 | 3300027866 | Bacteria | 1117 |
| 181 | Ga0268266_10003072 | 3300028379 | Bacteria | 17061 |
| 182 | Ga0268266_10071262 | 3300028379 | Bacteria | 3012 |
| 183 | Ga0268265_10020122 | 3300028380 | Bacteria | 4653 |
| 184 | Ga0268265_10032729 | 3300028380 | Bacteria | 3771 |
| 185 | Ga0268265_11205897 | 3300028380 | Unclassified | 754 |
| 186 | Ga0268264_10000002 | 3300028381 | Bacteria | 1153045 |
| 187 | Ga0268264_10000207 | 3300028381 | Bacteria | 120086 |
| 188 | Ga0268264_10031935 | 3300028381 | Bacteria | 4319 |
| 189 | Ga0307517_10002333 | 3300028786 | Bacteria | 30608 |
| 190 | Ga0307517_10321394 | 3300028786 | Bacteria | 856 |
| 191 | Ga0265327_10003325 | 3300031251 | Bacteria | 15546 |
| 192 | Ga0307513_10000127 | 3300031456 | Bacteria | 107100 |
| 193 | Ga0307513_10000899 | 3300031456 | Bacteria | 42953 |
| 194 | Ga0307513_10000983 | 3300031456 | Bacteria | 41242 |
| 195 | Ga0307513_10140173 | 3300031456 | Bacteria | 2346 |
| 196 | Ga0307508_10247849 | 3300031616 | Bacteria | 1378 |
| 197 | Ga0307516_10000001 | 3300031730 | Bacteria | 510338 |
| 198 | Ga0307413_10044372 | 3300031824 | Bacteria | 2627 |
| 199 | Ga0307413_10063223 | 3300031824 | Bacteria | 2294 |
| 200 | Ga0307411_10030372 | 3300032005 | Bacteria | 3312 |
| 201 | Ga0307510_10006409 | 3300033180 | Bacteria | 14030 |
| 202 | Ga0307510_10059596 | 3300033180 | Bacteria | 3939 |
| 203 | Ga0373946_0005900 | 3300035171 | Bacteria | 4436 |
| 204 | Ga0373931_0327221 | 3300035691 | Bacteria | 954 |
| 205 | Ga0373927_0001110 | 3300035695 | Bacteria | 20442 |
| 206 | Ga0373925_0000489 | 3300037068 | Bacteria | 39827 |
| 207 | Ga0395899_0000003 | 3300037312 | Bacteria | 1232684 |
| 208 | Ga0395900_0173883 | 3300037418 | Bacteria | 2191 |
| 209 | Ga0395900_0244381 | 3300037418 | Bacteria | 1799 |
| 210 | Ga0395898_0154532 | 3300037466 | Bacteria | 2195 |
| 211 | Ga0395905_0125231 | 3300037471 | Bacteria | 2416 |
| 212 | Ga0395905_0401585 | 3300037471 | Bacteria | 1265 |
| 213 | Ga0395905_0538175 | 3300037471 | Bacteria | 1069 |
| 214 | Ga0436364_1402286 | 3300037853 | Bacteria | 2401 |
| 215 | Ga0436365_1146874 | 3300039437 | Bacteria | 6815 |
| 216 | Ga0436365_1808918 | 3300039437 | Bacteria | 1418 |
| 217 | Ga0436361_0270208 | 3300039447 | Bacteria | 1284 |
| 218 | Ga0436361_0836259 | 3300039447 | Bacteria | 879 |
| 219 | Ga0436361_1143308 | 3300039447 | Bacteria | 2389 |
| 220 | Ga0466969_0070359 | 3300044656 | Bacteria | 1683 |
| 221 | Ga0453684_0457767 | 3300044712 | Bacteria | 1419 |
| 222 | Ga0495590_0042284 | 3300046457 | Bacteria | 1588 |
| 223 | Ga0495629_0028909 | 3300046459 | Bacteria | 3935 |
| 224 | Ga0495638_0000443 | 3300046460 | Bacteria | 49906 |
| 225 | Ga0495638_0001159 | 3300046460 | Bacteria | 25410 |
| 226 | Ga0495638_0335437 | 3300046460 | Bacteria | 803 |
| 227 | Ga0495650_0059683 | 3300046471 | Bacteria | 1535 |
| 228 | Ga0495594_0099807 | 3300046499 | Bacteria | 1633 |
| 229 | Ga0495583_0043515 | 3300046506 | Bacteria | 2090 |
| 230 | Ga0495610_0008577 | 3300046512 | Bacteria | 6593 |
| 231 | Ga0495610_0043653 | 3300046512 | Bacteria | 2232 |
| 232 | Ga0495620_0009876 | 3300046515 | Bacteria | 5055 |
| 233 | Ga0495637_0146740 | 3300046520 | Bacteria | 892 |
| 234 | Ga0495643_0024988 | 3300046522 | Bacteria | 3384 |
| 235 | Ga0495654_0000051 | 3300046530 | Bacteria | 145932 |
| 236 | Ga0495654_0107631 | 3300046530 | Bacteria | 1275 |
| 237 | Ga0495621_0018414 | 3300046539 | Bacteria | 2267 |
| 238 | Ga0495597_0001511 | 3300046542 | Bacteria | 16580 |
| 239 | Ga0495597_0128964 | 3300046542 | Bacteria | 1050 |
| 240 | Ga0495622_0165055 | 3300046557 | Bacteria | 997 |
| 241 | Ga0495668_0014600 | 3300046616 | Bacteria | 4600 |
| 242 | Ga0495668_0029230 | 3300046616 | Bacteria | 3114 |
| 243 | Ga0495668_0042514 | 3300046616 | Bacteria | 2530 |
| 244 | Ga0495668_0092678 | 3300046616 | Bacteria | 1655 |
| 245 | Ga0495668_0248495 | 3300046616 | Bacteria | 974 |
| 246 | Ga0495668_0290003 | 3300046616 | Bacteria | 897 |
| 247 | Ga0495611_0059932 | 3300046648 | Bacteria | 1728 |
| 248 | Ga0495625_0028435 | 3300046660 | Bacteria | 4192 |
| 249 | Ga0495625_0045312 | 3300046660 | Bacteria | 3180 |
| 250 | Ga0495669_0000002 | 3300046684 | Bacteria | 282777 |
| 251 | Ga0495669_0001666 | 3300046684 | Bacteria | 9110 |
| 252 | Ga0495669_0061677 | 3300046684 | Bacteria | 1697 |
| 253 | Ga0495669_0163625 | 3300046684 | Bacteria | 1056 |
| 254 | Ga0495624_0182011 | 3300046690 | Bacteria | 1280 |
| 255 | Ga0495581_0036008 | 3300047315 | Bacteria | 2863 |
| 256 | Ga0495677_0014626 | 3300047445 | Bacteria | 2855 |
| 257 | Ga0495677_0020070 | 3300047445 | Bacteria | 2422 |
| 258 | Ga0495673_0002251 | 3300047469 | Bacteria | 13848 |
| 259 | Ga0495686_0006377 | 3300047472 | Bacteria | 9048 |
| 260 | Ga0495686_0008921 | 3300047472 | Bacteria | 7288 |
| 261 | Ga0495602_0261399 | 3300048088 | Bacteria | 1284 |
| 262 | Ga0495615_0006676 | 3300048090 | Bacteria | 2152 |
| 263 | Ga0496101_0036361 | 3300048904 | Bacteria | 3488 |
| 264 | Ga0496102_0028562 | 3300048905 | Bacteria | 4983 |
| 265 | Ga0496102_0195110 | 3300048905 | Bacteria | 1908 |
| 266 | Ga0496103_0154962 | 3300048906 | Bacteria | 1468 |
| 267 | Ga0496104_0062720 | 3300048907 | Bacteria | 3525 |
| 268 | Ga0496106_0235833 | 3300048909 | Bacteria | 1461 |
| 269 | Ga0496107_0036473 | 3300048910 | Bacteria | 3527 |
| 270 | Ga0496108_0045960 | 3300048911 | Bacteria | 3647 |
| 271 | Ga0496109_0028143 | 3300048912 | Bacteria | 5025 |
| 272 | Ga0496113_0025223 | 3300048916 | Bacteria | 4235 |
| 273 | Ga0496115_0001630 | 3300048918 | Bacteria | 16158 |
| 274 | Ga0496115_0004005 | 3300048918 | Bacteria | 10633 |
| 275 | Ga0496115_0028461 | 3300048918 | Bacteria | 4380 |
| 276 | Ga0496119_0006503 | 3300048922 | Bacteria | 10792 |
| 277 | Ga0496120_0155921 | 3300048923 | Bacteria | 1143 |
| 278 | Ga0496121_0000035 | 3300048924 | Bacteria | 374316 |
| 279 | Ga0496121_0451700 | 3300048924 | Bacteria | 828 |
| 280 | Ga0496125_0184336 | 3300048928 | Bacteria | 1386 |
| 281 | Ga0495678_001468 | 3300049459 | Bacteria | 18471 |
| 282 | Ga0501033_0329009 | 3300049570 | Bacteria | 1072 |
| 283 | Ga0501037_0029285 | 3300049573 | Bacteria | 4068 |
| 284 | Ga0501043_0398854 | 3300049579 | Bacteria | 1040 |
| 285 | Ga0501047_0152833 | 3300049581 | Bacteria | 2183 |
| 286 | Ga0501047_0412469 | 3300049581 | Bacteria | 1183 |
| 287 | Ga0501266_070026 | 3300049763 | Bacteria | 577 |
| 288 | Ga0501035_0168035 | 3300049822 | Bacteria | 1896 |
| 289 | Ga0501035_0394014 | 3300049822 | Bacteria | 1153 |
| 290 | Ga0501044_0015676 | 3300049823 | Bacteria | 8162 |
| 291 | Ga0501044_0505073 | 3300049823 | Bacteria | 1110 |
| 292 | nmdc:mga03n38_13034_c1 | 3300050490 | Bacteria | 3146 |
| 293 | nmdc:mga00v17_1568_c1 | 3300050491 | Bacteria | 11927 |
| 294 | nmdc:mga0k408_10166_c1 | 3300050493 | Bacteria | 5087 |
| 295 | nmdc:mga06z11_11903_c1 | 3300050494 | Bacteria | 3767 |
| 296 | nmdc:mga04h51_92005_c1 | 3300050495 | Bacteria | 1093 |
| 297 | nmdc:mga07m45_134004_c1 | 3300050496 | Bacteria | 1434 |
| 298 | nmdc:mga07m45_6049_c1 | 3300050496 | Bacteria | 6092 |
| 299 | Ga0500578_0002060 | 3300053086 | Bacteria | 17968 |
| 300 | Ga0500643_008210 | 3300053087 | Bacteria | 4127 |
| 301 | Ga0500644_0006900 | 3300053088 | Bacteria | 2930 |
| 302 | Ga0500644_0204822 | 3300053088 | Bacteria | 817 |
| 303 | Ga0500646_0049521 | 3300053090 | Bacteria | 1208 |
| 304 | Ga0500651_0014561 | 3300053093 | Bacteria | 4813 |
| 305 | Ga0500566_0011904 | 3300053094 | Bacteria | 5123 |
| 306 | Ga0500641_0013153 | 3300053096 | Bacteria | 3038 |
| 307 | Ga0500554_008238 | 3300053102 | Bacteria | 2440 |
| 308 | Ga0500555_008739 | 3300053103 | Bacteria | 2891 |
| 309 | Ga0500555_059354 | 3300053103 | Bacteria | 1032 |
| 310 | Ga0500562_001866 | 3300053108 | Bacteria | 5289 |
| 311 | Ga0500562_053301 | 3300053108 | Bacteria | 1083 |
| 312 | Ga0500569_009192 | 3300053109 | Bacteria | 2288 |
| 313 | Ga0500572_058843 | 3300053111 | Bacteria | 1164 |
| 314 | Ga0500594_0005777 | 3300053118 | Bacteria | 2751 |
| 315 | Ga0500595_003495 | 3300053119 | Bacteria | 7310 |
| 316 | Ga0500607_097362 | 3300053121 | Bacteria | 1468 |
| 317 | Ga0500608_000027 | 3300053122 | Bacteria | 66998 |
| 318 | Ga0500608_000730 | 3300053122 | Bacteria | 11996 |
| 319 | Ga0500614_011761 | 3300053123 | Bacteria | 1901 |
| 320 | Ga0500614_030620 | 3300053123 | Bacteria | 1313 |
| 321 | Ga0500559_0002870 | 3300053136 | Bacteria | 8705 |
| 322 | Ga0500564_000124 | 3300053138 | Bacteria | 19584 |
| 323 | Ga0500577_0226439 | 3300053142 | Bacteria | 810 |
| 324 | Ga0500620_091803 | 3300053155 | Bacteria | 1059 |
| 325 | Ga0500622_0012336 | 3300053156 | Bacteria | 4627 |
| 326 | Ga0500622_0024014 | 3300053156 | Bacteria | 3226 |
| 327 | Ga0500622_0132873 | 3300053156 | Bacteria | 1194 |
| 328 | Ga0500627_0020859 | 3300053158 | Bacteria | 2634 |
| 329 | Ga0500637_0183879 | 3300053178 | Bacteria | 1196 |
| 330 | Ga0500625_034108 | 3300053729 | Bacteria | 2413 |
| 331 | Ga0500645_000275 | 3300053730 | Bacteria | 36860 |
| 332 | Ga0500596_001155 | 3300053735 | Bacteria | 5309 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005367 | Ga0070667_100576898 | Ga0070667_1005768982 | 179 |
| 2 | 3300049763 | Ga0501266_070026 | Ga0501266_070026_10_549 | 179 |
| 3 | 3300026118 | Ga0207675_100329502 | Ga0207675_1003295023 | 197 |
| 4 | 3300031251 | Ga0265327_10003325 | Ga0265327_1000332512 | 197 |
| 5 | 3300005341 | Ga0070691_10026852 | Ga0070691_100268523 | 199 |
| 6 | 3300046460 | Ga0495638_0335437 | Ga0495638_0335437_136_735 | 199 |
| 7 | 3300053087 | Ga0500643_008210 | Ga0500643_008210_1770_2444 | 199 |
| 8 | 3300039447 | Ga0436361_0836259 | Ga0436361_0836259_39_746 | 200 |
| 9 | 3300005539 | Ga0068853_100124086 | Ga0068853_1001240862 | 202 |
| 10 | 3300005614 | Ga0068856_100534086 | Ga0068856_1005340862 | 202 |
| 11 | 3300009093 | Ga0105240_10298959 | Ga0105240_102989593 | 202 |
| 12 | 3300009093 | Ga0105240_10649027 | Ga0105240_106490271 | 202 |
| 13 | 3300009545 | Ga0105237_10147317 | Ga0105237_101473172 | 202 |
| 14 | 3300009551 | Ga0105238_10012550 | Ga0105238_1001255011 | 202 |
| 15 | 3300013105 | Ga0157369_10649338 | Ga0157369_106493381 | 202 |
| 16 | 3300025914 | Ga0207671_10649765 | Ga0207671_106497651 | 202 |
| 17 | 3300025924 | Ga0207694_10083184 | Ga0207694_100831843 | 202 |
| 18 | 3300005578 | Ga0068854_100070726 | Ga0068854_1000707262 | 204 |
| 19 | 3300025981 | Ga0207640_10006138 | Ga0207640_100061383 | 204 |
| 20 | iso_pu_bacteria | 2643221614 | 2644087851 | 206 |
| 21 | iso_pu_bacteria | 2643221661 | 2644345455 | 206 |
| 22 | iso_pu_bacteria | 2643221666 | 2644367207 | 206 |
| 23 | 3300009177 | Ga0105248_10003203 | Ga0105248_1000320311 | 207 |
| 24 | 3300009553 | Ga0105249_10119720 | Ga0105249_101197203 | 207 |
| 25 | 3300014325 | Ga0163163_10005645 | Ga0163163_1000564511 | 207 |
| 26 | 3300014968 | Ga0157379_10002866 | Ga0157379_1000286612 | 207 |
| 27 | 3300005616 | Ga0068852_101184790 | Ga0068852_1011847902 | 209 |
| 28 | 3300026142 | Ga0207698_11164603 | Ga0207698_111646032 | 209 |
| 29 | 3300005331 | Ga0070670_100065381 | Ga0070670_1000653814 | 210 |
| 30 | 3300005347 | Ga0070668_100007991 | Ga0070668_10000799110 | 210 |
| 31 | 3300005347 | Ga0070668_100051502 | Ga0070668_1000515023 | 210 |
| 32 | 3300005347 | Ga0070668_100083711 | Ga0070668_1000837112 | 210 |
| 33 | 3300005355 | Ga0070671_100336077 | Ga0070671_1003360772 | 210 |
| 34 | 3300005617 | Ga0068859_100004040 | Ga0068859_1000040406 | 210 |
| 35 | 3300005617 | Ga0068859_100125552 | Ga0068859_1001255523 | 210 |
| 36 | 3300005618 | Ga0068864_100191986 | Ga0068864_1001919862 | 210 |
| 37 | 3300005841 | Ga0068863_100080562 | Ga0068863_1000805623 | 210 |
| 38 | 3300005843 | Ga0068860_100000327 | Ga0068860_10000032753 | 210 |
| 39 | 3300005843 | Ga0068860_100005399 | Ga0068860_1000053994 | 210 |
| 40 | 3300005844 | Ga0068862_100121215 | Ga0068862_1001212153 | 210 |
| 41 | 3300006931 | Ga0097620_100004040 | Ga0097620_1000040406 | 210 |
| 42 | 3300006931 | Ga0097620_100125555 | Ga0097620_1001255553 | 210 |
| 43 | 3300009553 | Ga0105249_10850001 | Ga0105249_108500012 | 210 |
| 44 | 3300025923 | Ga0207681_10201299 | Ga0207681_102012992 | 210 |
| 45 | 3300025925 | Ga0207650_10545940 | Ga0207650_105459403 | 210 |
| 46 | 3300025931 | Ga0207644_10125477 | Ga0207644_101254772 | 210 |
| 47 | 3300025972 | Ga0207668_10003471 | Ga0207668_100034711 | 210 |
| 48 | 3300025972 | Ga0207668_10025386 | Ga0207668_100253863 | 210 |
| 49 | 3300025986 | Ga0207658_10015462 | Ga0207658_100154627 | 210 |
| 50 | 3300025986 | Ga0207658_11245639 | Ga0207658_112456391 | 210 |
| 51 | 3300026088 | Ga0207641_10113593 | Ga0207641_101135932 | 210 |
| 52 | 3300026095 | Ga0207676_10282590 | Ga0207676_102825901 | 210 |
| 53 | 3300026118 | Ga0207675_100502336 | Ga0207675_1005023361 | 210 |
| 54 | 3300028380 | Ga0268265_10032729 | Ga0268265_100327293 | 210 |
| 55 | 3300028381 | Ga0268264_10000002 | Ga0268264_1000000229 | 210 |
| 56 | 3300028381 | Ga0268264_10031935 | Ga0268264_100319354 | 210 |
| 57 | 3300031824 | Ga0307413_10044372 | Ga0307413_100443723 | 210 |
| 58 | 3300053108 | Ga0500562_001866 | Ga0500562_001866_255_893 | 210 |
| 59 | 3300009174 | Ga0105241_10140741 | Ga0105241_101407413 | 211 |
| 60 | 3300009551 | Ga0105238_10026662 | Ga0105238_100266627 | 211 |
| 61 | 3300031456 | Ga0307513_10140173 | Ga0307513_101401731 | 211 |
| 62 | 3300033180 | Ga0307510_10059596 | Ga0307510_100595963 | 211 |
| 63 | 3300049822 | Ga0501035_0394014 | Ga0501035_0394014_289_933 | 211 |
| 64 | 3300005367 | Ga0070667_100398765 | Ga0070667_1003987652 | 212 |
| 65 | 3300009093 | Ga0105240_10624337 | Ga0105240_106243372 | 212 |
| 66 | 3300025903 | Ga0207680_10372537 | Ga0207680_103725372 | 212 |
| 67 | 3300025913 | Ga0207695_10055216 | Ga0207695_100552164 | 212 |
| 68 | 3300028786 | Ga0307517_10321394 | Ga0307517_103213942 | 212 |
| 69 | 3300031456 | Ga0307513_10000127 | Ga0307513_1000012799 | 212 |
| 70 | 3300037471 | Ga0395905_0538175 | Ga0395905_0538175_269_913 | 212 |
| 71 | 3300046684 | Ga0495669_0000002 | Ga0495669_0000002_159514_160152 | 212 |
| 72 | 3300047445 | Ga0495677_0014626 | Ga0495677_0014626_2195_2833 | 212 |
| 73 | iso_pu_bacteria | 2582581279 | 2585149083 | 212 |
| 74 | 3300005335 | Ga0070666_10125745 | Ga0070666_101257452 | 213 |
| 75 | 3300005347 | Ga0070668_100000042 | Ga0070668_10000004242 | 213 |
| 76 | 3300005367 | Ga0070667_100000508 | Ga0070667_10000050845 | 213 |
| 77 | 3300005548 | Ga0070665_100002287 | Ga0070665_10000228717 | 213 |
| 78 | 3300005618 | Ga0068864_100000135 | Ga0068864_10000013516 | 213 |
| 79 | 3300005841 | Ga0068863_100012986 | Ga0068863_10001298610 | 213 |
| 80 | 3300005842 | Ga0068858_100163937 | Ga0068858_1001639372 | 213 |
| 81 | 3300005843 | Ga0068860_100000133 | Ga0068860_10000013377 | 213 |
| 82 | 3300005844 | Ga0068862_100000619 | Ga0068862_10000061940 | 213 |
| 83 | 3300009553 | Ga0105249_10001002 | Ga0105249_1000100221 | 213 |
| 84 | 3300013306 | Ga0163162_10058517 | Ga0163162_100585173 | 213 |
| 85 | 3300014325 | Ga0163163_10752123 | Ga0163163_107521231 | 213 |
| 86 | 3300014968 | Ga0157379_10217714 | Ga0157379_102177142 | 213 |
| 87 | 3300014969 | Ga0157376_11365457 | Ga0157376_113654571 | 213 |
| 88 | 3300025903 | Ga0207680_10129949 | Ga0207680_101299492 | 213 |
| 89 | 3300025925 | Ga0207650_10000016 | Ga0207650_10000016174 | 213 |
| 90 | 3300025961 | Ga0207712_10000767 | Ga0207712_1000076711 | 213 |
| 91 | 3300025972 | Ga0207668_10001517 | Ga0207668_100015176 | 213 |
| 92 | 3300025986 | Ga0207658_10000295 | Ga0207658_100002953 | 213 |
| 93 | 3300026035 | Ga0207703_10124854 | Ga0207703_101248542 | 213 |
| 94 | 3300026088 | Ga0207641_10000612 | Ga0207641_100006121 | 213 |
| 95 | 3300026095 | Ga0207676_10002034 | Ga0207676_100020342 | 213 |
| 96 | 3300028379 | Ga0268266_10003072 | Ga0268266_1000307217 | 213 |
| 97 | 3300028380 | Ga0268265_10020122 | Ga0268265_100201223 | 213 |
| 98 | 3300028381 | Ga0268264_10000207 | Ga0268264_1000020794 | 213 |
| 99 | 3300031824 | Ga0307413_10063223 | Ga0307413_100632234 | 213 |
| 100 | 3300032005 | Ga0307411_10030372 | Ga0307411_100303722 | 213 |
| 101 | 3300037312 | Ga0395899_0000003 | Ga0395899_0000003_1055383_1056072 | 213 |
| 102 | 3300044656 | Ga0466969_0070359 | Ga0466969_0070359_983_1663 | 213 |
| 103 | 3300048905 | Ga0496102_0028562 | Ga0496102_0028562_308_1045 | 213 |
| 104 | 3300048928 | Ga0496125_0184336 | Ga0496125_0184336_506_1147 | 213 |
| 105 | 3300053096 | Ga0500641_0013153 | Ga0500641_0013153_2212_2859 | 213 |
| 106 | 3300005262 | Ga0065165_1013611 | Ga0065165_10136112 | 214 |
| 107 | 3300005331 | Ga0070670_100093445 | Ga0070670_1000934452 | 214 |
| 108 | 3300005339 | Ga0070660_100222121 | Ga0070660_1002221212 | 214 |
| 109 | 3300005347 | Ga0070668_100012234 | Ga0070668_1000122345 | 214 |
| 110 | 3300005353 | Ga0070669_100001732 | Ga0070669_10000173212 | 214 |
| 111 | 3300005355 | Ga0070671_100034751 | Ga0070671_1000347512 | 214 |
| 112 | 3300005367 | Ga0070667_100018211 | Ga0070667_1000182115 | 214 |
| 113 | 3300005548 | Ga0070665_100047592 | Ga0070665_1000475923 | 214 |
| 114 | 3300005563 | Ga0068855_100692171 | Ga0068855_1006921712 | 214 |
| 115 | 3300005578 | Ga0068854_100521483 | Ga0068854_1005214831 | 214 |
| 116 | 3300005617 | Ga0068859_100002919 | Ga0068859_10000291912 | 214 |
| 117 | 3300005719 | Ga0068861_100302200 | Ga0068861_1003022002 | 214 |
| 118 | 3300005841 | Ga0068863_100028469 | Ga0068863_1000284694 | 214 |
| 119 | 3300006048 | Ga0075363_100012342 | Ga0075363_1000123424 | 214 |
| 120 | 3300006051 | Ga0075364_10002894 | Ga0075364_100028948 | 214 |
| 121 | 3300006178 | Ga0075367_10050533 | Ga0075367_100505332 | 214 |
| 122 | 3300006195 | Ga0075366_10132173 | Ga0075366_101321732 | 214 |
| 123 | 3300006881 | Ga0068865_100003426 | Ga0068865_10000342612 | 214 |
| 124 | 3300006931 | Ga0097620_100002919 | Ga0097620_10000291912 | 214 |
| 125 | 3300009093 | Ga0105240_10831575 | Ga0105240_108315751 | 214 |
| 126 | 3300009551 | Ga0105238_10340904 | Ga0105238_103409042 | 214 |
| 127 | 3300010375 | Ga0105239_10356105 | Ga0105239_103561054 | 214 |
| 128 | 3300013105 | Ga0157369_11375386 | Ga0157369_113753861 | 214 |
| 129 | 3300014969 | Ga0157376_10658068 | Ga0157376_106580683 | 214 |
| 130 | 3300021384 | Ga0213876_10238172 | Ga0213876_102381721 | 214 |
| 131 | 3300025250 | Ga0209026_1009372 | Ga0209026_10093721 | 214 |
| 132 | 3300025298 | Ga0209050_1000073 | Ga0209050_1000073211 | 214 |
| 133 | 3300025304 | Ga0209257_1000099 | Ga0209257_100009984 | 214 |
| 134 | 3300025923 | Ga0207681_10016700 | Ga0207681_100167003 | 214 |
| 135 | 3300025925 | Ga0207650_10061323 | Ga0207650_100613231 | 214 |
| 136 | 3300025931 | Ga0207644_10011661 | Ga0207644_100116614 | 214 |
| 137 | 3300025938 | Ga0207704_10001415 | Ga0207704_100014152 | 214 |
| 138 | 3300025941 | Ga0207711_10032691 | Ga0207711_100326914 | 214 |
| 139 | 3300025961 | Ga0207712_10179562 | Ga0207712_101795622 | 214 |
| 140 | 3300025986 | Ga0207658_10010515 | Ga0207658_100105153 | 214 |
| 141 | 3300026035 | Ga0207703_10424296 | Ga0207703_104242962 | 214 |
| 142 | 3300026088 | Ga0207641_10009716 | Ga0207641_100097166 | 214 |
| 143 | 3300026118 | Ga0207675_100328581 | Ga0207675_1003285812 | 214 |
| 144 | 3300027866 | Ga0209813_10073416 | Ga0209813_100734162 | 214 |
| 145 | 3300028379 | Ga0268266_10071262 | Ga0268266_100712623 | 214 |
| 146 | 3300031616 | Ga0307508_10247849 | Ga0307508_102478491 | 214 |
| 147 | 3300039437 | Ga0436365_1808918 | Ga0436365_1808918_115_801 | 214 |
| 148 | 3300044712 | Ga0453684_0457767 | Ga0453684_0457767_527_1177 | 214 |
| 149 | 3300046459 | Ga0495629_0028909 | Ga0495629_0028909_1095_1757 | 214 |
| 150 | 3300046499 | Ga0495594_0099807 | Ga0495594_0099807_357_1040 | 214 |
| 151 | 3300046506 | Ga0495583_0043515 | Ga0495583_0043515_70_732 | 214 |
| 152 | 3300046512 | Ga0495610_0043653 | Ga0495610_0043653_1048_1710 | 214 |
| 153 | 3300046515 | Ga0495620_0009876 | Ga0495620_0009876_3240_3902 | 214 |
| 154 | 3300046522 | Ga0495643_0024988 | Ga0495643_0024988_860_1522 | 214 |
| 155 | 3300046542 | Ga0495597_0001511 | Ga0495597_0001511_12339_13001 | 214 |
| 156 | 3300046557 | Ga0495622_0165055 | Ga0495622_0165055_320_982 | 214 |
| 157 | 3300046660 | Ga0495625_0045312 | Ga0495625_0045312_1769_2431 | 214 |
| 158 | 3300046684 | Ga0495669_0001666 | Ga0495669_0001666_2762_3409 | 214 |
| 159 | 3300046684 | Ga0495669_0163625 | Ga0495669_0163625_300_983 | 214 |
| 160 | 3300046690 | Ga0495624_0182011 | Ga0495624_0182011_327_989 | 214 |
| 161 | 3300047315 | Ga0495581_0036008 | Ga0495581_0036008_722_1405 | 214 |
| 162 | 3300047445 | Ga0495677_0020070 | Ga0495677_0020070_1100_1747 | 214 |
| 163 | 3300048088 | Ga0495602_0261399 | Ga0495602_0261399_278_940 | 214 |
| 164 | 3300049570 | Ga0501033_0329009 | Ga0501033_0329009_172_846 | 214 |
| 165 | 3300049573 | Ga0501037_0029285 | Ga0501037_0029285_1954_2628 | 214 |
| 166 | 3300049579 | Ga0501043_0398854 | Ga0501043_0398854_45_719 | 214 |
| 167 | 3300049581 | Ga0501047_0412469 | Ga0501047_0412469_349_1041 | 214 |
| 168 | 3300049822 | Ga0501035_0168035 | Ga0501035_0168035_48_722 | 214 |
| 169 | 3300049823 | Ga0501044_0015676 | Ga0501044_0015676_1934_2608 | 214 |
| 170 | 3300049823 | Ga0501044_0505073 | Ga0501044_0505073_448_1098 | 214 |
| 171 | 3300050490 | nmdc:mga03n38_13034_c1 | nmdc:mga03n38_13034_c1_2333_3007 | 214 |
| 172 | 3300050491 | nmdc:mga00v17_1568_c1 | nmdc:mga00v17_1568_c1_4446_5144 | 214 |
| 173 | 3300050494 | nmdc:mga06z11_11903_c1 | nmdc:mga06z11_11903_c1_2887_3585 | 214 |
| 174 | 3300050495 | nmdc:mga04h51_92005_c1 | nmdc:mga04h51_92005_c1_72_770 | 214 |
| 175 | 3300050496 | nmdc:mga07m45_6049_c1 | nmdc:mga07m45_6049_c1_104_778 | 214 |
| 176 | 3300053090 | Ga0500646_0049521 | Ga0500646_0049521_322_999 | 214 |
| 177 | 3300053093 | Ga0500651_0014561 | Ga0500651_0014561_1081_1743 | 214 |
| 178 | 3300053094 | Ga0500566_0011904 | Ga0500566_0011904_301_963 | 214 |
| 179 | 3300053102 | Ga0500554_008238 | Ga0500554_008238_1318_1986 | 214 |
| 180 | 3300053103 | Ga0500555_008739 | Ga0500555_008739_1136_1813 | 214 |
| 181 | 3300053109 | Ga0500569_009192 | Ga0500569_009192_1298_1960 | 214 |
| 182 | 3300053111 | Ga0500572_058843 | Ga0500572_058843_209_871 | 214 |
| 183 | 3300053119 | Ga0500595_003495 | Ga0500595_003495_6540_7202 | 214 |
| 184 | 3300053121 | Ga0500607_097362 | Ga0500607_097362_751_1413 | 214 |
| 185 | 3300053122 | Ga0500608_000730 | Ga0500608_000730_5847_6509 | 214 |
| 186 | 3300053123 | Ga0500614_011761 | Ga0500614_011761_307_975 | 214 |
| 187 | 3300053123 | Ga0500614_030620 | Ga0500614_030620_259_921 | 214 |
| 188 | 3300053142 | Ga0500577_0226439 | Ga0500577_0226439_56_718 | 214 |
| 189 | 3300053155 | Ga0500620_091803 | Ga0500620_091803_103_765 | 214 |
| 190 | 3300053178 | Ga0500637_0183879 | Ga0500637_0183879_159_821 | 214 |
| 191 | 3300053729 | Ga0500625_034108 | Ga0500625_034108_1388_2050 | 214 |
| 192 | 3300053735 | Ga0500596_001155 | Ga0500596_001155_4247_4909 | 214 |
| 193 | 3300005262 | Ga0065165_1000622 | Ga0065165_10006225 | 215 |
| 194 | 3300005336 | Ga0070680_100299433 | Ga0070680_1002994332 | 215 |
| 195 | 3300005366 | Ga0070659_100035674 | Ga0070659_1000356742 | 215 |
| 196 | 3300005458 | Ga0070681_10019109 | Ga0070681_100191093 | 215 |
| 197 | 3300005539 | Ga0068853_100128819 | Ga0068853_1001288191 | 215 |
| 198 | 3300009093 | Ga0105240_10029544 | Ga0105240_100295446 | 215 |
| 199 | 3300009551 | Ga0105238_10066127 | Ga0105238_100661273 | 215 |
| 200 | 3300009551 | Ga0105238_10432035 | Ga0105238_104320352 | 215 |
| 201 | 3300021361 | Ga0213872_10002032 | Ga0213872_1000203213 | 215 |
| 202 | 3300025304 | Ga0209257_1004182 | Ga0209257_10041823 | 215 |
| 203 | 3300025909 | Ga0207705_10118761 | Ga0207705_101187611 | 215 |
| 204 | 3300025913 | Ga0207695_10000321 | Ga0207695_1000032173 | 215 |
| 205 | 3300025913 | Ga0207695_10001284 | Ga0207695_1000128414 | 215 |
| 206 | 3300025917 | Ga0207660_10066658 | Ga0207660_100666583 | 215 |
| 207 | 3300025924 | Ga0207694_10054115 | Ga0207694_100541152 | 215 |
| 208 | 3300025924 | Ga0207694_10326641 | Ga0207694_103266412 | 215 |
| 209 | 3300025932 | Ga0207690_10000196 | Ga0207690_1000019613 | 215 |
| 210 | 3300026041 | Ga0207639_10096590 | Ga0207639_100965901 | 215 |
| 211 | 3300039447 | Ga0436361_0270208 | Ga0436361_0270208_327_1064 | 215 |
| 212 | 3300039447 | Ga0436361_1143308 | Ga0436361_1143308_1320_2054 | 215 |
| 213 | 3300046471 | Ga0495650_0059683 | Ga0495650_0059683_315_977 | 215 |
| 214 | 3300046616 | Ga0495668_0248495 | Ga0495668_0248495_19_687 | 215 |
| 215 | 3300048918 | Ga0496115_0028461 | Ga0496115_0028461_1227_1901 | 215 |
| 216 | 3300053730 | Ga0500645_000275 | Ga0500645_000275_31584_32243 | 215 |
| 217 | iso_pu_bacteria | 2791355048 | 2792461657 | 215 |
| 218 | iso_pu_bacteria | 2843744320 | 2843746116 | 215 |
| 219 | iso_pu_bacteria | 2851153111 | 2851153414 | 215 |
| 220 | 3300009098 | Ga0105245_10197647 | Ga0105245_101976473 | 216 |
| 221 | 3300009176 | Ga0105242_11251970 | Ga0105242_112519701 | 216 |
| 222 | 3300053103 | Ga0500555_059354 | Ga0500555_059354_58_714 | 216 |
| 223 | 3300053156 | Ga0500622_0012336 | Ga0500622_0012336_3939_4589 | 216 |
| 224 | iso_pu_bacteria | 2585428106 | 2587915451 | 216 |
| 225 | iso_pu_bacteria | 2643221640 | 2644224008 | 216 |
| 226 | iso_pu_bacteria | 2643221642 | 2644232994 | 216 |
| 227 | iso_pu_bacteria | 2857504554 | 2857507948 | 216 |
| 228 | iso_pu_bacteria | 2884960567 | 2884965797 | 216 |
| 229 | iso_pu_bacteria | 2928531327 | 2928534899 | 216 |
| 230 | 3300025917 | Ga0207660_10068105 | Ga0207660_100681053 | 217 |
| 231 | 3300033180 | Ga0307510_10006409 | Ga0307510_1000640912 | 217 |
| 232 | 3300003794 | Ga0055531_10010235 | Ga0055531_100102355 | 218 |
| 233 | 3300005331 | Ga0070670_100098650 | Ga0070670_1000986501 | 218 |
| 234 | 3300005355 | Ga0070671_100053623 | Ga0070671_1000536232 | 218 |
| 235 | 3300005456 | Ga0070678_100211375 | Ga0070678_1002113752 | 218 |
| 236 | 3300005539 | Ga0068853_100052429 | Ga0068853_1000524292 | 218 |
| 237 | 3300005564 | Ga0070664_100120177 | Ga0070664_1001201773 | 218 |
| 238 | 3300005841 | Ga0068863_100211778 | Ga0068863_1002117782 | 218 |
| 239 | 3300009177 | Ga0105248_10406857 | Ga0105248_104068571 | 218 |
| 240 | 3300013308 | Ga0157375_10037572 | Ga0157375_100375725 | 218 |
| 241 | 3300014968 | Ga0157379_10174128 | Ga0157379_101741281 | 218 |
| 242 | 3300025913 | Ga0207695_10282077 | Ga0207695_102820773 | 218 |
| 243 | 3300025924 | Ga0207694_10005274 | Ga0207694_100052746 | 218 |
| 244 | 3300025925 | Ga0207650_10199229 | Ga0207650_101992292 | 218 |
| 245 | 3300025941 | Ga0207711_10153418 | Ga0207711_101534182 | 218 |
| 246 | 3300025945 | Ga0207679_10121354 | Ga0207679_101213542 | 218 |
| 247 | 3300026041 | Ga0207639_10118467 | Ga0207639_101184672 | 218 |
| 248 | 3300028786 | Ga0307517_10002333 | Ga0307517_1000233324 | 218 |
| 249 | 3300031456 | Ga0307513_10000899 | Ga0307513_1000089921 | 218 |
| 250 | 3300037853 | Ga0436364_1402286 | Ga0436364_1402286_485_1198 | 218 |
| 251 | 3300046457 | Ga0495590_0042284 | Ga0495590_0042284_390_1046 | 218 |
| 252 | 3300046460 | Ga0495638_0000443 | Ga0495638_0000443_49089_49745 | 218 |
| 253 | 3300046460 | Ga0495638_0001159 | Ga0495638_0001159_7663_8319 | 218 |
| 254 | 3300046512 | Ga0495610_0008577 | Ga0495610_0008577_339_995 | 218 |
| 255 | 3300046520 | Ga0495637_0146740 | Ga0495637_0146740_27_683 | 218 |
| 256 | 3300046530 | Ga0495654_0000051 | Ga0495654_0000051_32976_33635 | 218 |
| 257 | 3300046530 | Ga0495654_0107631 | Ga0495654_0107631_533_1189 | 218 |
| 258 | 3300046616 | Ga0495668_0014600 | Ga0495668_0014600_1333_1989 | 218 |
| 259 | 3300046616 | Ga0495668_0290003 | Ga0495668_0290003_165_836 | 218 |
| 260 | 3300047472 | Ga0495686_0006377 | Ga0495686_0006377_8165_8821 | 218 |
| 261 | 3300047472 | Ga0495686_0008921 | Ga0495686_0008921_2031_2690 | 218 |
| 262 | 3300048904 | Ga0496101_0036361 | Ga0496101_0036361_1451_2125 | 218 |
| 263 | 3300048905 | Ga0496102_0195110 | Ga0496102_0195110_38_712 | 218 |
| 264 | 3300048906 | Ga0496103_0154962 | Ga0496103_0154962_593_1267 | 218 |
| 265 | 3300048907 | Ga0496104_0062720 | Ga0496104_0062720_1347_2021 | 218 |
| 266 | 3300048909 | Ga0496106_0235833 | Ga0496106_0235833_493_1167 | 218 |
| 267 | 3300048910 | Ga0496107_0036473 | Ga0496107_0036473_670_1344 | 218 |
| 268 | 3300048911 | Ga0496108_0045960 | Ga0496108_0045960_1651_2325 | 218 |
| 269 | 3300048912 | Ga0496109_0028143 | Ga0496109_0028143_2304_2978 | 218 |
| 270 | 3300048916 | Ga0496113_0025223 | Ga0496113_0025223_3157_3831 | 218 |
| 271 | 3300048918 | Ga0496115_0004005 | Ga0496115_0004005_3606_4265 | 218 |
| 272 | 3300049459 | Ga0495678_001468 | Ga0495678_001468_452_1108 | 218 |
| 273 | 3300053086 | Ga0500578_0002060 | Ga0500578_0002060_17097_17753 | 218 |
| 274 | 3300053088 | Ga0500644_0204822 | Ga0500644_0204822_92_748 | 218 |
| 275 | 3300053108 | Ga0500562_053301 | Ga0500562_053301_359_1015 | 218 |
| 276 | 3300053118 | Ga0500594_0005777 | Ga0500594_0005777_1724_2380 | 218 |
| 277 | 3300053158 | Ga0500627_0020859 | Ga0500627_0020859_50_709 | 218 |
| 278 | iso_pu_bacteria | 2643221691 | 2644510183 | 218 |
| 279 | 3300005327 | Ga0070658_10139086 | Ga0070658_101390863 | 219 |
| 280 | 3300005548 | Ga0070665_100104982 | Ga0070665_1001049823 | 219 |
| 281 | 3300025909 | Ga0207705_10235873 | Ga0207705_102358732 | 219 |
| 282 | 3300027378 | Ga0209981_1002487 | Ga0209981_10024873 | 219 |
| 283 | 3300027665 | Ga0209983_1037479 | Ga0209983_10374792 | 219 |
| 284 | 3300031730 | Ga0307516_10000001 | Ga0307516_10000001467 | 219 |
| 285 | 3300035171 | Ga0373946_0005900 | Ga0373946_0005900_911_1591 | 219 |
| 286 | 3300035691 | Ga0373931_0327221 | Ga0373931_0327221_156_824 | 219 |
| 287 | 3300035695 | Ga0373927_0001110 | Ga0373927_0001110_15942_16622 | 219 |
| 288 | 3300037068 | Ga0373925_0000489 | Ga0373925_0000489_6174_6854 | 219 |
| 289 | 3300046616 | Ga0495668_0092678 | Ga0495668_0092678_852_1529 | 219 |
| 290 | 3300046648 | Ga0495611_0059932 | Ga0495611_0059932_539_1216 | 219 |
| 291 | 3300003781 | Ga0055536_1009567 | Ga0055536_10095675 | 220 |
| 292 | 3300003791 | Ga0055530_10007656 | Ga0055530_100076561 | 220 |
| 293 | 3300003792 | Ga0055540_1033032 | Ga0055540_10330321 | 220 |
| 294 | 3300003794 | Ga0055531_10003368 | Ga0055531_100033685 | 220 |
| 295 | 3300005614 | Ga0068856_100125293 | Ga0068856_1001252933 | 220 |
| 296 | 3300006195 | Ga0075366_10012408 | Ga0075366_100124085 | 220 |
| 297 | 3300014325 | Ga0163163_10147343 | Ga0163163_101473433 | 220 |
| 298 | 3300025292 | Ga0209676_1000163 | Ga0209676_100016363 | 220 |
| 299 | 3300025292 | Ga0209676_1000188 | Ga0209676_100018892 | 220 |
| 300 | 3300025298 | Ga0209050_1001523 | Ga0209050_10015232 | 220 |
| 301 | 3300025298 | Ga0209050_1002911 | Ga0209050_100291118 | 220 |
| 302 | 3300025303 | Ga0209051_1003688 | Ga0209051_100368814 | 220 |
| 303 | 3300025304 | Ga0209257_1001816 | Ga0209257_100181625 | 220 |
| 304 | 3300025981 | Ga0207640_10206553 | Ga0207640_102065532 | 220 |
| 305 | 3300026095 | Ga0207676_10127204 | Ga0207676_101272043 | 220 |
| 306 | 3300031456 | Ga0307513_10000983 | Ga0307513_1000098315 | 220 |
| 307 | 3300046542 | Ga0495597_0128964 | Ga0495597_0128964_344_1021 | 220 |
| 308 | 3300046616 | Ga0495668_0029230 | Ga0495668_0029230_2342_3019 | 220 |
| 309 | 3300046616 | Ga0495668_0042514 | Ga0495668_0042514_1751_2449 | 220 |
| 310 | 3300046684 | Ga0495669_0061677 | Ga0495669_0061677_608_1306 | 220 |
| 311 | 3300048918 | Ga0496115_0001630 | Ga0496115_0001630_15382_16071 | 220 |
| 312 | 3300048922 | Ga0496119_0006503 | Ga0496119_0006503_8735_9418 | 220 |
| 313 | 3300048923 | Ga0496120_0155921 | Ga0496120_0155921_189_872 | 220 |
| 314 | 3300048924 | Ga0496121_0000035 | Ga0496121_0000035_222658_223341 | 220 |
| 315 | 3300048924 | Ga0496121_0451700 | Ga0496121_0451700_113_802 | 220 |
| 316 | 3300050493 | nmdc:mga0k408_10166_c1 | nmdc:mga0k408_10166_c1_1214_1891 | 220 |
| 317 | 3300053122 | Ga0500608_000027 | Ga0500608_000027_30356_31036 | 220 |
| 318 | 3300053136 | Ga0500559_0002870 | Ga0500559_0002870_518_1198 | 220 |
| 319 | 3300053156 | Ga0500622_0024014 | Ga0500622_0024014_100_780 | 220 |
| 320 | 3300053156 | Ga0500622_0132873 | Ga0500622_0132873_470_1147 | 220 |
| 321 | 3300003794 | Ga0055531_10005526 | Ga0055531_100055263 | 221 |
| 322 | 3300005327 | Ga0070658_10196539 | Ga0070658_101965392 | 221 |
| 323 | 3300005844 | Ga0068862_100803775 | Ga0068862_1008037752 | 221 |
| 324 | 3300025949 | Ga0207667_10502190 | Ga0207667_105021902 | 221 |
| 325 | 3300028380 | Ga0268265_11205897 | Ga0268265_112058971 | 221 |
| 326 | 3300037418 | Ga0395900_0173883 | Ga0395900_0173883_1305_2000 | 221 |
| 327 | 3300037418 | Ga0395900_0244381 | Ga0395900_0244381_865_1581 | 221 |
| 328 | 3300037466 | Ga0395898_0154532 | Ga0395898_0154532_1411_2106 | 221 |
| 329 | 3300037471 | Ga0395905_0125231 | Ga0395905_0125231_1418_2134 | 221 |
| 330 | 3300037471 | Ga0395905_0401585 | Ga0395905_0401585_135_830 | 221 |
| 331 | 3300046539 | Ga0495621_0018414 | Ga0495621_0018414_814_1494 | 221 |
| 332 | 3300047469 | Ga0495673_0002251 | Ga0495673_0002251_12950_13630 | 221 |
| 333 | 3300048090 | Ga0495615_0006676 | Ga0495615_0006676_200_880 | 221 |
| 334 | 3300050496 | nmdc:mga07m45_134004_c1 | nmdc:mga07m45_134004_c1_373_1041 | 221 |
| 335 | 3300053088 | Ga0500644_0006900 | Ga0500644_0006900_219_899 | 221 |
| 336 | 3300053138 | Ga0500564_000124 | Ga0500564_000124_4345_5025 | 221 |
| 337 | 3300046660 | Ga0495625_0028435 | Ga0495625_0028435_3420_4088 | 222 |
| 338 | 3300039437 | Ga0436365_1146874 | Ga0436365_1146874_5259_5939 | 225 |
| 339 | 3300049581 | Ga0501047_0152833 | Ga0501047_0152833_378_1109 | 227 |
| 340 | 3300003775 | Ga0055524_1047998 | Ga0055524_10479981 | 235 |
| 341 | 3300003790 | Ga0055528_1005584 | Ga0055528_10055847 | 235 |
| 342 | 3300003790 | Ga0055528_1005883 | Ga0055528_10058831 | 235 |
| 343 | 3300025263 | Ga0209565_1001766 | Ga0209565_10017669 | 235 |
| 344 | 3300025273 | Ga0209673_1000788 | Ga0209673_100078813 | 235 |
| 345 | 3300025297 | Ga0209758_1007549 | Ga0209758_100754911 | 235 |
| 346 | 3300025299 | Ga0209256_1006331 | Ga0209256_10063311 | 235 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6awl-assembly1.cif.gz_B | crystal structure of human coq9 | 0.7618 | 30 | 203 |
| 5cxg-assembly2.cif.gz_D | crystal structure of mycobacterium tuberculosis kstr in complex with peg | 0.7443 | 30 | 200 |
| 7sss-assembly1.cif.gz_D | structure of the nadh-bound human coq7:coq9 complex by single-particle electron cryo-microscopy | 0.7362 | 30 | 204 |
| 3ni7-assembly1.cif.gz_A | crystal structure of the tetr transcriptional regulator from nitrosomonas europaea atcc 19718 | 0.7343 | 30 | 208 |
| 3c07-assembly1.cif.gz_B | crystal structure of a tetr family transcriptional regulator from streptomyces coelicolor a3(2) | 0.7337 | 29 | 225 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O13850_45_223_1.10.357.10 | Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;Tetracycline Repressor, domain 2 | 0.8099 | 33 | 204 | 1.10.357.10 |
| af_Q8MKN0_104_290_1.10.357.10 | Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;Tetracycline Repressor, domain 2 | 0.803 | 28 | 204 | 1.10.357.10 |
| af_A0A1D8PU08_72_259_1.10.357.10 | Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;Tetracycline Repressor, domain 2 | 0.8019 | 37 | 203 | 1.10.357.10 |
| af_A0A2R8QKY8_107_294_1.10.357.10 | Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;Tetracycline Repressor, domain 2 | 0.7904 | 30 | 202 | 1.10.357.10 |
| af_I1LY75_91_272_1.10.357.10 | Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;Tetracycline Repressor, domain 2 | 0.7786 | 28 | 202 | 1.10.357.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q3TX93-F1-model_v4 | COQ9 family protein | 0.9652 | 26 | 181 |
GO:0006744
GO:0008289 |
| AF-A0A3B9L149-F1-model_v4 | COQ9 family protein | 0.9503 | 29 | 177 |
GO:0006744
GO:0008289 |
| AF-A0A2S6RNK9-F1-model_v4 | COQ9 C-terminal domain-containing protein | 0.943 | 28 | 201 |
GO:0006744
GO:0008289 |
| AF-A0A6B3UME6-F1-model_v4 | COQ9 family protein | 0.9388 | 22 | 233 |
GO:0006744
GO:0008289 |
| AF-A0A258K957-F1-model_v4 | RpsU-divergently transcribed protein | 0.9387 | 14 | 215 |
GO:0006744
GO:0008289 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar