F416896
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 346 | 216 | 344 | 191 |
Family's Representative Sequence
| Representative Sequence | 3300047320|Ga0495672_0352786|Ga0495672_0352786_11_643 |
| Length | 210 |
| Sequence | MTTTTASDRPFTPLSRLLHWTMAALILAMLFIGIGMVASLSHYHTLISIHRPLGILVLALVAIRLVNRFINPPPPLPDGMPGWQRFAALGSHVVLYALMFALPIVGWAMLSAARYPIVLYGPLQLPPIAPQDPELFAMLRSTHTVLALLLFATFLAHFGAAMMHALIFRDGVFPSMTSSKFGNINEADVSDPGSGSAIAGRTRDADRPAL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 2 | 2883354860 | Hypericibacter adhaerens R5959 | Isolate | Rhizosphere |
| 3 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 4 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 5 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 6 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 7 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 8 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 46 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 47 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 48 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 49 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 50 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 51 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 52 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 53 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 54 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 55 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 57 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 58 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 63 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 64 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 65 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 66 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 67 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 68 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 70 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 71 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 72 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 81 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 84 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 95 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 96 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 98 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 99 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 142 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 143 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 144 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 145 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 146 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 147 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 148 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 149 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 150 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 151 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 152 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 153 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 154 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 155 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 156 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 157 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 185 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 186 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 187 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 188 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 189 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 190 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 191 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 192 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 193 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 194 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 195 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 196 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 197 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 198 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 199 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 200 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 201 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 202 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 203 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 204 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 205 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 206 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 207 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 208 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 209 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 210 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 211 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 212 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 213 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 215 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 216 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.84 |
| Metatranscriptomes | 0.58 |
| Isolates | 0.58 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.07 |
| Nodule | 0 |
| Rhizoplane | 11.85 |
| Rhizosphere | 80.35 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.73 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25152J39213_1000162 | 3300002773 | Bacteria | 45604 |
| 2 | rootH2_10049251 | 3300003320 | Bacteria | 22428 |
| 3 | Ga0055526_1035625 | 3300003771 | Unclassified | 1336 |
| 4 | Ga0055524_1005831 | 3300003775 | Bacteria | 5436 |
| 5 | Ga0055528_1000295 | 3300003790 | Bacteria | 42305 |
| 6 | Ga0065707_10047250 | 3300005295 | Bacteria | 1055 |
| 7 | Ga0070683_100278376 | 3300005329 | Bacteria | 1591 |
| 8 | Ga0070670_100062744 | 3300005331 | Bacteria | 3190 |
| 9 | Ga0070677_10333223 | 3300005333 | Bacteria | 781 |
| 10 | Ga0070682_100626999 | 3300005337 | Bacteria | 853 |
| 11 | Ga0068868_100011880 | 3300005338 | Bacteria | 6349 |
| 12 | Ga0070691_10041850 | 3300005341 | Bacteria | 2167 |
| 13 | Ga0070661_100399279 | 3300005344 | Bacteria | 1087 |
| 14 | Ga0070669_100156752 | 3300005353 | Bacteria | 1766 |
| 15 | Ga0070675_100030007 | 3300005354 | Bacteria | 4387 |
| 16 | Ga0070674_100898129 | 3300005356 | Bacteria | 771 |
| 17 | Ga0070673_100060127 | 3300005364 | Bacteria | 3010 |
| 18 | Ga0070688_100192513 | 3300005365 | Bacteria | 1422 |
| 19 | Ga0070659_100093687 | 3300005366 | Bacteria | 2410 |
| 20 | Ga0070667_100676818 | 3300005367 | Bacteria | 954 |
| 21 | Ga0070667_100909030 | 3300005367 | Bacteria | 820 |
| 22 | Ga0070703_10143993 | 3300005406 | Bacteria | 888 |
| 23 | Ga0070709_10041083 | 3300005434 | Bacteria | 2847 |
| 24 | Ga0070709_10372532 | 3300005434 | Unclassified | 1060 |
| 25 | Ga0070714_100046833 | 3300005435 | Bacteria | 3670 |
| 26 | Ga0070714_100050469 | 3300005435 | Bacteria | 3544 |
| 27 | Ga0070714_100586284 | 3300005435 | Bacteria | 1070 |
| 28 | Ga0070713_100051621 | 3300005436 | Bacteria | 3401 |
| 29 | Ga0070713_100058227 | 3300005436 | Bacteria | 3222 |
| 30 | Ga0070713_100100766 | 3300005436 | Bacteria | 2501 |
| 31 | Ga0070713_100748839 | 3300005436 | Bacteria | 935 |
| 32 | Ga0070710_10022235 | 3300005437 | Bacteria | 3313 |
| 33 | Ga0070710_10483141 | 3300005437 | Bacteria | 845 |
| 34 | Ga0070711_100052092 | 3300005439 | Bacteria | 2815 |
| 35 | Ga0070711_100097438 | 3300005439 | Bacteria | 2133 |
| 36 | Ga0070705_100005821 | 3300005440 | Bacteria | 6026 |
| 37 | Ga0070705_100165431 | 3300005440 | Bacteria | 1483 |
| 38 | Ga0070705_100446682 | 3300005440 | Unclassified | 969 |
| 39 | Ga0070694_100030156 | 3300005444 | Plasmid | 3546 |
| 40 | Ga0070694_100211132 | 3300005444 | Bacteria | 1452 |
| 41 | Ga0070663_100007487 | 3300005455 | Bacteria | 6647 |
| 42 | Ga0070663_100264080 | 3300005455 | Bacteria | 1366 |
| 43 | Ga0070678_100301568 | 3300005456 | Bacteria | 1361 |
| 44 | Ga0070685_10079109 | 3300005466 | Bacteria | 1967 |
| 45 | Ga0070706_100024155 | 3300005467 | Bacteria | 5595 |
| 46 | Ga0070706_100058381 | 3300005467 | Bacteria | 3561 |
| 47 | Ga0070706_100276890 | 3300005467 | Bacteria | 1566 |
| 48 | Ga0070706_100289049 | 3300005467 | Unclassified | 1530 |
| 49 | Ga0070707_100064915 | 3300005468 | Unclassified | 3506 |
| 50 | Ga0070707_100168795 | 3300005468 | Bacteria | 2132 |
| 51 | Ga0070698_100038863 | 3300005471 | Bacteria | 4903 |
| 52 | Ga0070698_100167957 | 3300005471 | Bacteria | 2135 |
| 53 | Ga0070698_100288384 | 3300005471 | Bacteria | 1572 |
| 54 | Ga0070699_100032421 | 3300005518 | Bacteria | 4511 |
| 55 | Ga0070699_100128071 | 3300005518 | Unclassified | 2237 |
| 56 | Ga0070699_100772984 | 3300005518 | Bacteria | 879 |
| 57 | Ga0070697_100464553 | 3300005536 | Unclassified | 1103 |
| 58 | Ga0070697_100494155 | 3300005536 | Bacteria | 1069 |
| 59 | Ga0070697_100560329 | 3300005536 | Bacteria | 1002 |
| 60 | Ga0070686_100162290 | 3300005544 | Bacteria | 1575 |
| 61 | Ga0070695_100139882 | 3300005545 | Bacteria | 1677 |
| 62 | Ga0070696_100046693 | 3300005546 | Bacteria | 3004 |
| 63 | Ga0070696_100356943 | 3300005546 | Bacteria | 1133 |
| 64 | Ga0070665_100246144 | 3300005548 | Bacteria | 1788 |
| 65 | Ga0070665_101166111 | 3300005548 | Bacteria | 781 |
| 66 | Ga0070664_100112495 | 3300005564 | Bacteria | 2378 |
| 67 | Ga0070702_100046861 | 3300005615 | Bacteria | 2452 |
| 68 | Ga0068852_100699455 | 3300005616 | Bacteria | 1024 |
| 69 | Ga0068859_101050170 | 3300005617 | Bacteria | 895 |
| 70 | Ga0068859_101535173 | 3300005617 | Bacteria | 735 |
| 71 | Ga0068864_100018789 | 3300005618 | Bacteria | 5777 |
| 72 | Ga0068866_10217050 | 3300005718 | Bacteria | 1152 |
| 73 | Ga0068861_100030736 | 3300005719 | Bacteria | 3938 |
| 74 | Ga0068861_100255169 | 3300005719 | Bacteria | 1498 |
| 75 | Ga0068861_100705870 | 3300005719 | Bacteria | 938 |
| 76 | Ga0068851_10214274 | 3300005834 | Bacteria | 1080 |
| 77 | Ga0068870_10003235 | 3300005840 | Bacteria | 6876 |
| 78 | Ga0068858_100042105 | 3300005842 | Bacteria | 4235 |
| 79 | Ga0068858_100277824 | 3300005842 | Bacteria | 1594 |
| 80 | Ga0081455_10056498 | 3300005937 | Unclassified | 3332 |
| 81 | Ga0081540_1000017 | 3300005983 | Bacteria | 164991 |
| 82 | Ga0081540_1000976 | 3300005983 | Bacteria | 25808 |
| 83 | Ga0070717_10006684 | 3300006028 | Bacteria | 8505 |
| 84 | Ga0070717_10032259 | 3300006028 | Bacteria | 4220 |
| 85 | Ga0070717_10127529 | 3300006028 | Bacteria | 2185 |
| 86 | Ga0070717_10288010 | 3300006028 | Bacteria | 1458 |
| 87 | Ga0075365_10045522 | 3300006038 | Bacteria | 2879 |
| 88 | Ga0075365_10110528 | 3300006038 | Bacteria | 1888 |
| 89 | Ga0075368_10029505 | 3300006042 | Bacteria | 2121 |
| 90 | Ga0070715_10239125 | 3300006163 | Bacteria | 943 |
| 91 | Ga0070716_100457486 | 3300006173 | Unclassified | 932 |
| 92 | Ga0070716_100555499 | 3300006173 | Bacteria | 857 |
| 93 | Ga0070716_100622723 | 3300006173 | Bacteria | 815 |
| 94 | Ga0070716_100806638 | 3300006173 | Bacteria | 727 |
| 95 | Ga0070712_100038183 | 3300006175 | Bacteria | 3280 |
| 96 | Ga0070712_100057890 | 3300006175 | Bacteria | 2724 |
| 97 | Ga0070712_100096559 | 3300006175 | Bacteria | 2176 |
| 98 | Ga0070712_100123678 | 3300006175 | Bacteria | 1951 |
| 99 | Ga0070712_100705708 | 3300006175 | Unclassified | 860 |
| 100 | Ga0070712_100942670 | 3300006175 | Bacteria | 745 |
| 101 | Ga0097621_100812793 | 3300006237 | Bacteria | 867 |
| 102 | Ga0068871_100899053 | 3300006358 | Bacteria | 821 |
| 103 | Ga0075428_100051903 | 3300006844 | Bacteria | 4497 |
| 104 | Ga0075428_100301382 | 3300006844 | Bacteria | 1723 |
| 105 | Ga0075433_10220099 | 3300006852 | Unclassified | 1686 |
| 106 | Ga0075433_10851915 | 3300006852 | Unclassified | 796 |
| 107 | Ga0075434_100040633 | 3300006871 | Bacteria | 4606 |
| 108 | Ga0075434_100369175 | 3300006871 | Unclassified | 1456 |
| 109 | Ga0075429_100375093 | 3300006880 | Bacteria | 1245 |
| 110 | Ga0068865_100340322 | 3300006881 | Bacteria | 1212 |
| 111 | Ga0097620_101050104 | 3300006931 | Bacteria | 895 |
| 112 | Ga0097620_101535320 | 3300006931 | Bacteria | 735 |
| 113 | Ga0075435_100014671 | 3300007076 | Bacteria | 5870 |
| 114 | Ga0099794_10009086 | 3300007265 | Bacteria | 4156 |
| 115 | Ga0099794_10020246 | 3300007265 | Bacteria | 3009 |
| 116 | Ga0099795_10044755 | 3300007788 | Bacteria | 1589 |
| 117 | Ga0099795_10074371 | 3300007788 | Unclassified | 1288 |
| 118 | Ga0099795_10113228 | 3300007788 | Bacteria | 1077 |
| 119 | Ga0099795_10207035 | 3300007788 | Bacteria | 830 |
| 120 | Ga0099795_10214437 | 3300007788 | Bacteria | 817 |
| 121 | Ga0111539_10473588 | 3300009094 | Bacteria | 1458 |
| 122 | Ga0111539_10935233 | 3300009094 | Unclassified | 1008 |
| 123 | Ga0105245_10218988 | 3300009098 | Bacteria | 1836 |
| 124 | Ga0114129_10042156 | 3300009147 | Bacteria | 6427 |
| 125 | Ga0114129_10057001 | 3300009147 | Bacteria | 5470 |
| 126 | Ga0114129_10161891 | 3300009147 | Bacteria | 3056 |
| 127 | Ga0114129_10319384 | 3300009147 | Unclassified | 2064 |
| 128 | Ga0105242_10355764 | 3300009176 | Unclassified | 1354 |
| 129 | Ga0105242_10535879 | 3300009176 | Bacteria | 1120 |
| 130 | Ga0105248_10047471 | 3300009177 | Bacteria | 4815 |
| 131 | Ga0105248_10544629 | 3300009177 | Bacteria | 1309 |
| 132 | Ga0105237_11049136 | 3300009545 | Bacteria | 822 |
| 133 | Ga0105238_10245403 | 3300009551 | Bacteria | 1768 |
| 134 | Ga0105249_10017651 | 3300009553 | Bacteria | 6337 |
| 135 | Ga0105249_11155608 | 3300009553 | Bacteria | 845 |
| 136 | Ga0099796_10014913 | 3300010159 | Bacteria | 2257 |
| 137 | Ga0099796_10048159 | 3300010159 | Unclassified | 1469 |
| 138 | Ga0099796_10050311 | 3300010159 | Unclassified | 1444 |
| 139 | Ga0099796_10063611 | 3300010159 | Bacteria | 1314 |
| 140 | Ga0099796_10149630 | 3300010159 | Bacteria | 918 |
| 141 | Ga0105239_11033222 | 3300010375 | Bacteria | 945 |
| 142 | Ga0105246_10190534 | 3300011119 | Bacteria | 1587 |
| 143 | Ga0157338_1009725 | 3300012515 | Unclassified | 957 |
| 144 | Ga0157369_11157115 | 3300013105 | Bacteria | 790 |
| 145 | Ga0157374_10085143 | 3300013296 | Bacteria | 3005 |
| 146 | Ga0157378_10031162 | 3300013297 | Bacteria | 4710 |
| 147 | Ga0157378_10169362 | 3300013297 | Bacteria | 2047 |
| 148 | Ga0163162_10023535 | 3300013306 | Bacteria | 6080 |
| 149 | Ga0163162_10395774 | 3300013306 | Unclassified | 1514 |
| 150 | Ga0163162_10849168 | 3300013306 | Bacteria | 1028 |
| 151 | Ga0163162_12139874 | 3300013306 | Bacteria | 642 |
| 152 | Ga0157375_10065877 | 3300013308 | Bacteria | 3613 |
| 153 | Ga0157375_11557256 | 3300013308 | Unclassified | 781 |
| 154 | Ga0163163_10051329 | 3300014325 | Bacteria | 4067 |
| 155 | Ga0157377_10007048 | 3300014745 | Bacteria | 5399 |
| 156 | Ga0157379_10884794 | 3300014968 | Bacteria | 846 |
| 157 | Ga0157376_10529062 | 3300014969 | Bacteria | 1163 |
| 158 | Ga0163161_10049794 | 3300017792 | Bacteria | 3029 |
| 159 | Ga0163161_10227657 | 3300017792 | Bacteria | 1446 |
| 160 | Ga0209129_1000214 | 3300025258 | Bacteria | 67035 |
| 161 | Ga0209673_1000317 | 3300025273 | Bacteria | 88898 |
| 162 | Ga0209025_1026658 | 3300025294 | Bacteria | 2892 |
| 163 | Ga0209564_1001398 | 3300025295 | Bacteria | 25072 |
| 164 | Ga0209256_1000624 | 3300025299 | Bacteria | 48696 |
| 165 | Ga0207656_10011784 | 3300025321 | Bacteria | 3309 |
| 166 | Ga0207653_10122281 | 3300025885 | Bacteria | 938 |
| 167 | Ga0207692_10014353 | 3300025898 | Bacteria | 3459 |
| 168 | Ga0207642_10072315 | 3300025899 | Bacteria | 1645 |
| 169 | Ga0207710_10019340 | 3300025900 | Bacteria | 2906 |
| 170 | Ga0207680_10597467 | 3300025903 | Bacteria | 789 |
| 171 | Ga0207647_10022423 | 3300025904 | Bacteria | 4194 |
| 172 | Ga0207685_10201764 | 3300025905 | Bacteria | 935 |
| 173 | Ga0207699_10006446 | 3300025906 | Bacteria | 5684 |
| 174 | Ga0207699_10167548 | 3300025906 | Bacteria | 1467 |
| 175 | Ga0207699_10470070 | 3300025906 | Unclassified | 904 |
| 176 | Ga0207643_10002749 | 3300025908 | Bacteria | 9525 |
| 177 | Ga0207684_10042515 | 3300025910 | Bacteria | 3852 |
| 178 | Ga0207684_10270245 | 3300025910 | Bacteria | 1467 |
| 179 | Ga0207695_10018105 | 3300025913 | Bacteria | 8153 |
| 180 | Ga0207695_10181341 | 3300025913 | Unclassified | 2026 |
| 181 | Ga0207693_10030625 | 3300025915 | Bacteria | 4251 |
| 182 | Ga0207693_10041041 | 3300025915 | Bacteria | 3644 |
| 183 | Ga0207693_10103174 | 3300025915 | Bacteria | 2236 |
| 184 | Ga0207693_10397815 | 3300025915 | Unclassified | 1077 |
| 185 | Ga0207662_10125594 | 3300025918 | Bacteria | 1613 |
| 186 | Ga0207657_10484506 | 3300025919 | Bacteria | 969 |
| 187 | Ga0207646_10406459 | 3300025922 | Bacteria | 1229 |
| 188 | Ga0207681_10042080 | 3300025923 | Bacteria | 3049 |
| 189 | Ga0207681_10842887 | 3300025923 | Bacteria | 767 |
| 190 | Ga0207650_10046190 | 3300025925 | Bacteria | 3207 |
| 191 | Ga0207659_10011421 | 3300025926 | Bacteria | 5610 |
| 192 | Ga0207700_10065211 | 3300025928 | Bacteria | 2778 |
| 193 | Ga0207700_10272289 | 3300025928 | Bacteria | 1454 |
| 194 | Ga0207700_10455211 | 3300025928 | Bacteria | 1128 |
| 195 | Ga0207664_10056506 | 3300025929 | Bacteria | 3117 |
| 196 | Ga0207664_10340820 | 3300025929 | Bacteria | 1325 |
| 197 | Ga0207664_10472331 | 3300025929 | Bacteria | 1121 |
| 198 | Ga0207644_10197452 | 3300025931 | Bacteria | 1585 |
| 199 | Ga0207706_10074587 | 3300025933 | Bacteria | 2983 |
| 200 | Ga0207706_10338165 | 3300025933 | Bacteria | 1309 |
| 201 | Ga0207686_10313025 | 3300025934 | Bacteria | 1170 |
| 202 | Ga0207686_10380936 | 3300025934 | Unclassified | 1070 |
| 203 | Ga0207669_10376021 | 3300025937 | Bacteria | 1105 |
| 204 | Ga0207704_10220158 | 3300025938 | Bacteria | 1404 |
| 205 | Ga0207665_10098069 | 3300025939 | Bacteria | 2041 |
| 206 | Ga0207665_10173600 | 3300025939 | Unclassified | 1558 |
| 207 | Ga0207665_10598508 | 3300025939 | Bacteria | 861 |
| 208 | Ga0207665_10643460 | 3300025939 | Bacteria | 831 |
| 209 | Ga0207711_10558057 | 3300025941 | Bacteria | 1068 |
| 210 | Ga0207689_10105965 | 3300025942 | Bacteria | 2309 |
| 211 | Ga0207679_10062953 | 3300025945 | Bacteria | 2767 |
| 212 | Ga0207679_10088871 | 3300025945 | Bacteria | 2383 |
| 213 | Ga0207712_10053585 | 3300025961 | Bacteria | 2830 |
| 214 | Ga0207712_10221201 | 3300025961 | Bacteria | 1514 |
| 215 | Ga0207640_10218866 | 3300025981 | Bacteria | 1456 |
| 216 | Ga0207703_10015337 | 3300026035 | Bacteria | 5977 |
| 217 | Ga0207703_10030620 | 3300026035 | Bacteria | 4254 |
| 218 | Ga0207639_10067489 | 3300026041 | Bacteria | 2783 |
| 219 | Ga0207678_10288177 | 3300026067 | Bacteria | 1410 |
| 220 | Ga0207708_10044428 | 3300026075 | Bacteria | 3385 |
| 221 | Ga0207641_10011199 | 3300026088 | Bacteria | 7358 |
| 222 | Ga0207648_10060226 | 3300026089 | Bacteria | 3311 |
| 223 | Ga0207675_100388178 | 3300026118 | Bacteria | 1374 |
| 224 | Ga0207683_10008847 | 3300026121 | Bacteria | 8590 |
| 225 | Ga0268266_10469276 | 3300028379 | Bacteria | 1198 |
| 226 | Ga0268264_10257548 | 3300028381 | Bacteria | 1624 |
| 227 | Ga0265760_10101200 | 3300031090 | Bacteria | 911 |
| 228 | Ga0265760_10220719 | 3300031090 | Bacteria | 646 |
| 229 | Ga0265330_10047201 | 3300031235 | Bacteria | 1896 |
| 230 | Ga0265332_10244235 | 3300031238 | Bacteria | 743 |
| 231 | Ga0265325_10047441 | 3300031241 | Bacteria | 2223 |
| 232 | Ga0307406_10871385 | 3300031901 | Bacteria | 765 |
| 233 | Ga0373926_0181450 | 3300035083 | Bacteria | 807 |
| 234 | Ga0373945_0453255 | 3300035116 | Bacteria | 567 |
| 235 | Ga0373931_0142496 | 3300035691 | Bacteria | 1390 |
| 236 | Ga0373935_0809690 | 3300035692 | Bacteria | 692 |
| 237 | Ga0373947_0006660 | 3300035725 | Bacteria | 6706 |
| 238 | Ga0373937_0098638 | 3300036401 | Bacteria | 2710 |
| 239 | Ga0373925_0118953 | 3300037068 | Bacteria | 2049 |
| 240 | Ga0395900_0080570 | 3300037418 | Bacteria | 3346 |
| 241 | Ga0395898_0240887 | 3300037466 | Bacteria | 1725 |
| 242 | Ga0436361_0343272 | 3300039447 | Bacteria | 1831 |
| 243 | Ga0451793_1583517 | 3300041452 | Bacteria | 1047 |
| 244 | Ga0495603_0119814 | 3300046455 | Bacteria | 1534 |
| 245 | Ga0495590_0060649 | 3300046457 | Bacteria | 1325 |
| 246 | Ga0495629_0558999 | 3300046459 | Bacteria | 767 |
| 247 | Ga0495641_0038865 | 3300046461 | Bacteria | 2222 |
| 248 | Ga0495651_0053210 | 3300046462 | Bacteria | 3118 |
| 249 | Ga0495653_0102333 | 3300046463 | Bacteria | 2073 |
| 250 | Ga0495653_0388243 | 3300046463 | Bacteria | 890 |
| 251 | Ga0495662_0073013 | 3300046476 | Bacteria | 1664 |
| 252 | Ga0495606_0239286 | 3300046507 | Bacteria | 1013 |
| 253 | Ga0495620_0092773 | 3300046515 | Bacteria | 1210 |
| 254 | Ga0495630_0145933 | 3300046517 | Bacteria | 1799 |
| 255 | Ga0495630_0148595 | 3300046517 | Bacteria | 1783 |
| 256 | Ga0495631_0289619 | 3300046518 | Bacteria | 697 |
| 257 | Ga0495652_0524884 | 3300046529 | Bacteria | 818 |
| 258 | Ga0495587_0280506 | 3300046536 | Bacteria | 934 |
| 259 | Ga0495635_0170716 | 3300046663 | Bacteria | 1479 |
| 260 | Ga0495657_0034959 | 3300046675 | Unclassified | 3487 |
| 261 | Ga0495658_0066392 | 3300046683 | Bacteria | 2084 |
| 262 | Ga0495613_0151163 | 3300046689 | Bacteria | 1655 |
| 263 | Ga0495624_0030621 | 3300046690 | Plasmid | 3503 |
| 264 | Ga0495624_0068956 | 3300046690 | Bacteria | 2204 |
| 265 | Ga0495671_0024785 | 3300046692 | Bacteria | 3121 |
| 266 | Ga0495649_0021515 | 3300046694 | Bacteria | 3612 |
| 267 | Ga0495589_0068591 | 3300046794 | Bacteria | 1735 |
| 268 | Ga0495604_0047040 | 3300047317 | Plasmid | 3362 |
| 269 | Ga0495674_0066997 | 3300047319 | Bacteria | 3112 |
| 270 | Ga0495672_0352786 | 3300047320 | Bacteria | 683 |
| 271 | Ga0495676_0417435 | 3300047321 | Bacteria | 888 |
| 272 | Ga0495681_0277276 | 3300047470 | Bacteria | 655 |
| 273 | Ga0495602_0386331 | 3300048088 | Unclassified | 1001 |
| 274 | Ga0496100_0002800 | 3300048903 | Bacteria | 8925 |
| 275 | Ga0496101_0235315 | 3300048904 | Bacteria | 1424 |
| 276 | Ga0496101_0750233 | 3300048904 | Bacteria | 770 |
| 277 | Ga0496102_0013944 | 3300048905 | Bacteria | 6975 |
| 278 | Ga0496102_0028178 | 3300048905 | Bacteria | 5017 |
| 279 | Ga0496102_0336710 | 3300048905 | Bacteria | 1421 |
| 280 | Ga0496103_0003934 | 3300048906 | Bacteria | 9028 |
| 281 | Ga0496104_0000124 | 3300048907 | Bacteria | 71545 |
| 282 | Ga0496104_0014338 | 3300048907 | Bacteria | 7158 |
| 283 | Ga0496104_0024210 | 3300048907 | Bacteria | 5584 |
| 284 | Ga0496105_0001946 | 3300048908 | Bacteria | 14829 |
| 285 | Ga0496105_0007684 | 3300048908 | Bacteria | 8362 |
| 286 | Ga0496105_0021200 | 3300048908 | Bacteria | 5257 |
| 287 | Ga0496106_0003706 | 3300048909 | Bacteria | 11402 |
| 288 | Ga0496107_0041231 | 3300048910 | Bacteria | 3314 |
| 289 | Ga0496107_0299740 | 3300048910 | Bacteria | 1196 |
| 290 | Ga0496108_0013239 | 3300048911 | Bacteria | 6722 |
| 291 | Ga0496108_0049181 | 3300048911 | Bacteria | 3526 |
| 292 | Ga0496108_0184012 | 3300048911 | Bacteria | 1810 |
| 293 | Ga0496109_0006773 | 3300048912 | Bacteria | 9650 |
| 294 | Ga0496109_0014145 | 3300048912 | Bacteria | 6937 |
| 295 | Ga0496109_0020137 | 3300048912 | Bacteria | 5894 |
| 296 | Ga0496110_0000800 | 3300048913 | Bacteria | 22003 |
| 297 | Ga0496110_0006467 | 3300048913 | Bacteria | 9285 |
| 298 | Ga0496110_0015056 | 3300048913 | Bacteria | 6430 |
| 299 | Ga0496111_0061244 | 3300048914 | Bacteria | 2728 |
| 300 | Ga0496111_0391546 | 3300048914 | Bacteria | 1027 |
| 301 | Ga0496112_0001747 | 3300048915 | Bacteria | 17023 |
| 302 | Ga0496112_0015894 | 3300048915 | Bacteria | 7033 |
| 303 | Ga0496112_0181113 | 3300048915 | Unclassified | 2071 |
| 304 | Ga0496112_0195576 | 3300048915 | Bacteria | 1983 |
| 305 | Ga0496113_0000645 | 3300048916 | Bacteria | 17565 |
| 306 | Ga0496113_0002214 | 3300048916 | Bacteria | 11217 |
| 307 | Ga0496113_0005852 | 3300048916 | Bacteria | 7716 |
| 308 | Ga0496114_0050710 | 3300048917 | Bacteria | 3455 |
| 309 | Ga0496114_0780946 | 3300048917 | Bacteria | 833 |
| 310 | Ga0496115_0003546 | 3300048918 | Bacteria | 11224 |
| 311 | Ga0496115_0101394 | 3300048918 | Bacteria | 2360 |
| 312 | Ga0496115_0306254 | 3300048918 | Bacteria | 1301 |
| 313 | Ga0496115_0400533 | 3300048918 | Bacteria | 1114 |
| 314 | Ga0496116_0041908 | 3300048919 | Plasmid | 3136 |
| 315 | Ga0496119_0138868 | 3300048922 | Unclassified | 1315 |
| 316 | Ga0496125_0104130 | 3300048928 | Unclassified | 2079 |
| 317 | Ga0496125_0437215 | 3300048928 | Unclassified | 753 |
| 318 | Ga0501083_0090480 | 3300049744 | Bacteria | 2021 |
| 319 | nmdc:mga03n38_136387_c1 | 3300050490 | Bacteria | 1221 |
| 320 | nmdc:mga0yw44_26356_c1 | 3300050492 | Bacteria | 3320 |
| 321 | nmdc:mga0yw44_67852_c2 | 3300050492 | Bacteria | 1218 |
| 322 | nmdc:mga06z11_68475_c1 | 3300050494 | Bacteria | 1871 |
| 323 | nmdc:mga05p37_158631_c1 | 3300050507 | Bacteria | 2763 |
| 324 | nmdc:mga05p37_281792_c1 | 3300050507 | Bacteria | 1982 |
| 325 | nmdc:mga09592_33777_c1 | 3300050508 | Bacteria | 4273 |
| 326 | nmdc:mga0qj67_377845_c1 | 3300050509 | Unclassified | 1144 |
| 327 | nmdc:mga0n895_1020759_c1 | 3300050512 | Bacteria | 807 |
| 328 | nmdc:mga0n895_37904_c1 | 3300050512 | Bacteria | 4667 |
| 329 | nmdc:mga0n895_44059_c1 | 3300050512 | Bacteria | 4352 |
| 330 | nmdc:mga0n895_483704_c1 | 3300050512 | Bacteria | 1248 |
| 331 | nmdc:mga0rr50_107908_c1 | 3300050513 | Bacteria | 2199 |
| 332 | nmdc:mga0rr50_1547552_c1 | 3300050513 | Unclassified | 560 |
| 333 | nmdc:mga0rr50_28730_c1 | 3300050513 | Bacteria | 3913 |
| 334 | nmdc:mga0a205_1105857_c1 | 3300050515 | Bacteria | 640 |
| 335 | nmdc:mga0a205_716627_c1 | 3300050515 | Unclassified | 850 |
| 336 | nmdc:mga0a205_85671_c1 | 3300050515 | Bacteria | 3043 |
| 337 | Ga0495619_0015654 | 3300053085 | Bacteria | 4801 |
| 338 | Ga0495619_0044057 | 3300053085 | Bacteria | 2927 |
| 339 | Ga0495619_0141325 | 3300053085 | Bacteria | 1658 |
| 340 | Ga0500642_0021181 | 3300053130 | Bacteria | 2570 |
| 341 | Ga0500559_0019848 | 3300053136 | Bacteria | 2840 |
| 342 | Ga0500645_012097 | 3300053730 | Unclassified | 2795 |
| 343 | Ga0500645_018755 | 3300053730 | Bacteria | 2157 |
| 344 | Ga0500645_034208 | 3300053730 | Bacteria | 1518 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035116 | Ga0373945_0453255 | Ga0373945_0453255_46_555 | 153 |
| 2 | 3300006871 | Ga0075434_100040633 | Ga0075434_1000406332 | 155 |
| 3 | 3300007076 | Ga0075435_100014671 | Ga0075435_1000146713 | 155 |
| 4 | 3300050512 | nmdc:mga0n895_37904_c1 | nmdc:mga0n895_37904_c1_3943_4524 | 155 |
| 5 | 3300050513 | nmdc:mga0rr50_28730_c1 | nmdc:mga0rr50_28730_c1_105_686 | 155 |
| 6 | 3300050515 | nmdc:mga0a205_1105857_c1 | nmdc:mga0a205_1105857_c1_31_612 | 155 |
| 7 | 3300009147 | Ga0114129_10161891 | Ga0114129_101618912 | 157 |
| 8 | 3300010159 | Ga0099796_10063611 | Ga0099796_100636111 | 157 |
| 9 | 3300046463 | Ga0495653_0388243 | Ga0495653_0388243_308_871 | 157 |
| 10 | 3300050513 | nmdc:mga0rr50_1547552_c1 | nmdc:mga0rr50_1547552_c1_31_528 | 157 |
| 11 | 3300053730 | Ga0500645_018755 | Ga0500645_018755_429_932 | 157 |
| 12 | 3300006028 | Ga0070717_10288010 | Ga0070717_102880101 | 159 |
| 13 | 3300048904 | Ga0496101_0750233 | Ga0496101_0750233_198_752 | 160 |
| 14 | 3300048911 | Ga0496108_0049181 | Ga0496108_0049181_16_558 | 160 |
| 15 | 3300006173 | Ga0070716_100806638 | Ga0070716_1008066381 | 162 |
| 16 | 3300005719 | Ga0068861_100030736 | Ga0068861_1000307361 | 164 |
| 17 | 3300007788 | Ga0099795_10074371 | Ga0099795_100743711 | 164 |
| 18 | 3300010159 | Ga0099796_10048159 | Ga0099796_100481591 | 164 |
| 19 | 3300010159 | Ga0099796_10050311 | Ga0099796_100503111 | 164 |
| 20 | 3300035083 | Ga0373926_0181450 | Ga0373926_0181450_277_789 | 164 |
| 21 | 3300046462 | Ga0495651_0053210 | Ga0495651_0053210_201_713 | 164 |
| 22 | 3300046463 | Ga0495653_0102333 | Ga0495653_0102333_1312_1824 | 164 |
| 23 | 3300046517 | Ga0495630_0145933 | Ga0495630_0145933_1230_1742 | 164 |
| 24 | 3300046663 | Ga0495635_0170716 | Ga0495635_0170716_784_1296 | 164 |
| 25 | 3300046675 | Ga0495657_0034959 | Ga0495657_0034959_2698_3210 | 164 |
| 26 | 3300046690 | Ga0495624_0030621 | Ga0495624_0030621_2567_3079 | 164 |
| 27 | 3300047317 | Ga0495604_0047040 | Ga0495604_0047040_2721_3233 | 164 |
| 28 | 3300047319 | Ga0495674_0066997 | Ga0495674_0066997_616_1128 | 164 |
| 29 | 3300048088 | Ga0495602_0386331 | Ga0495602_0386331_336_848 | 164 |
| 30 | 3300005548 | Ga0070665_101166111 | Ga0070665_1011661112 | 165 |
| 31 | 3300009147 | Ga0114129_10057001 | Ga0114129_100570013 | 165 |
| 32 | 3300039447 | Ga0436361_0343272 | Ga0436361_0343272_812_1327 | 166 |
| 33 | 3300046518 | Ga0495631_0289619 | Ga0495631_0289619_155_676 | 166 |
| 34 | 3300047470 | Ga0495681_0277276 | Ga0495681_0277276_48_611 | 167 |
| 35 | 3300005983 | Ga0081540_1000017 | Ga0081540_100001713 | 168 |
| 36 | 3300035692 | Ga0373935_0809690 | Ga0373935_0809690_120_665 | 168 |
| 37 | iso_pu_bacteria | 2643221547 | 2643756051 | 169 |
| 38 | iso_pu_bacteria | 2883354860 | 2883355601 | 170 |
| 39 | 3300005333 | Ga0070677_10333223 | Ga0070677_103332231 | 171 |
| 40 | 3300005436 | Ga0070713_100100766 | Ga0070713_1001007662 | 171 |
| 41 | 3300009094 | Ga0111539_10473588 | Ga0111539_104735882 | 171 |
| 42 | 3300014745 | Ga0157377_10007048 | Ga0157377_100070483 | 171 |
| 43 | 3300025928 | Ga0207700_10065211 | Ga0207700_100652113 | 171 |
| 44 | 3300025928 | Ga0207700_10272289 | Ga0207700_102722891 | 171 |
| 45 | 3300037068 | Ga0373925_0118953 | Ga0373925_0118953_460_1050 | 171 |
| 46 | 3300048906 | Ga0496103_0003934 | Ga0496103_0003934_611_1231 | 171 |
| 47 | 3300048911 | Ga0496108_0184012 | Ga0496108_0184012_1037_1657 | 171 |
| 48 | 3300048915 | Ga0496112_0195576 | Ga0496112_0195576_579_1199 | 171 |
| 49 | 3300006237 | Ga0097621_100812793 | Ga0097621_1008127931 | 172 |
| 50 | 3300006852 | Ga0075433_10851915 | Ga0075433_108519151 | 172 |
| 51 | 3300007788 | Ga0099795_10113228 | Ga0099795_101132282 | 172 |
| 52 | 3300010159 | Ga0099796_10014913 | Ga0099796_100149132 | 172 |
| 53 | 3300050512 | nmdc:mga0n895_1020759_c1 | nmdc:mga0n895_1020759_c1_138_656 | 172 |
| 54 | 3300050515 | nmdc:mga0a205_716627_c1 | nmdc:mga0a205_716627_c1_203_721 | 172 |
| 55 | 3300048928 | Ga0496125_0437215 | Ga0496125_0437215_66_620 | 173 |
| 56 | 3300003320 | rootH2_10049251 | rootH2_1004925117 | 174 |
| 57 | 3300005295 | Ga0065707_10047250 | Ga0065707_100472502 | 174 |
| 58 | 3300005434 | Ga0070709_10372532 | Ga0070709_103725321 | 174 |
| 59 | 3300005435 | Ga0070714_100046833 | Ga0070714_1000468335 | 174 |
| 60 | 3300005440 | Ga0070705_100165431 | Ga0070705_1001654311 | 174 |
| 61 | 3300005440 | Ga0070705_100446682 | Ga0070705_1004466822 | 174 |
| 62 | 3300005444 | Ga0070694_100211132 | Ga0070694_1002111322 | 174 |
| 63 | 3300005467 | Ga0070706_100289049 | Ga0070706_1002890492 | 174 |
| 64 | 3300005468 | Ga0070707_100064915 | Ga0070707_1000649152 | 174 |
| 65 | 3300005471 | Ga0070698_100167957 | Ga0070698_1001679572 | 174 |
| 66 | 3300005518 | Ga0070699_100128071 | Ga0070699_1001280713 | 174 |
| 67 | 3300005518 | Ga0070699_100772984 | Ga0070699_1007729841 | 174 |
| 68 | 3300005719 | Ga0068861_100705870 | Ga0068861_1007058702 | 174 |
| 69 | 3300005983 | Ga0081540_1000976 | Ga0081540_10009769 | 174 |
| 70 | 3300006028 | Ga0070717_10006684 | Ga0070717_100066842 | 174 |
| 71 | 3300006173 | Ga0070716_100555499 | Ga0070716_1005554992 | 174 |
| 72 | 3300006175 | Ga0070712_100705708 | Ga0070712_1007057082 | 174 |
| 73 | 3300006844 | Ga0075428_100051903 | Ga0075428_1000519032 | 174 |
| 74 | 3300006852 | Ga0075433_10220099 | Ga0075433_102200992 | 174 |
| 75 | 3300006871 | Ga0075434_100369175 | Ga0075434_1003691753 | 174 |
| 76 | 3300006880 | Ga0075429_100375093 | Ga0075429_1003750931 | 174 |
| 77 | 3300007265 | Ga0099794_10020246 | Ga0099794_100202464 | 174 |
| 78 | 3300007788 | Ga0099795_10207035 | Ga0099795_102070352 | 174 |
| 79 | 3300009094 | Ga0111539_10935233 | Ga0111539_109352331 | 174 |
| 80 | 3300009147 | Ga0114129_10319384 | Ga0114129_103193842 | 174 |
| 81 | 3300009176 | Ga0105242_10355764 | Ga0105242_103557642 | 174 |
| 82 | 3300009553 | Ga0105249_10017651 | Ga0105249_100176513 | 174 |
| 83 | 3300012515 | Ga0157338_1009725 | Ga0157338_10097252 | 174 |
| 84 | 3300013297 | Ga0157378_10031162 | Ga0157378_100311625 | 174 |
| 85 | 3300013306 | Ga0163162_10395774 | Ga0163162_103957741 | 174 |
| 86 | 3300013306 | Ga0163162_12139874 | Ga0163162_121398741 | 174 |
| 87 | 3300013308 | Ga0157375_11557256 | Ga0157375_115572561 | 174 |
| 88 | 3300025905 | Ga0207685_10201764 | Ga0207685_102017642 | 174 |
| 89 | 3300025906 | Ga0207699_10470070 | Ga0207699_104700702 | 174 |
| 90 | 3300025915 | Ga0207693_10103174 | Ga0207693_101031743 | 174 |
| 91 | 3300025922 | Ga0207646_10406459 | Ga0207646_104064592 | 174 |
| 92 | 3300025923 | Ga0207681_10842887 | Ga0207681_108428871 | 174 |
| 93 | 3300025929 | Ga0207664_10472331 | Ga0207664_104723312 | 174 |
| 94 | 3300025933 | Ga0207706_10338165 | Ga0207706_103381652 | 174 |
| 95 | 3300025934 | Ga0207686_10380936 | Ga0207686_103809362 | 174 |
| 96 | 3300025939 | Ga0207665_10173600 | Ga0207665_101736002 | 174 |
| 97 | 3300025939 | Ga0207665_10598508 | Ga0207665_105985082 | 174 |
| 98 | 3300025961 | Ga0207712_10053585 | Ga0207712_100535852 | 174 |
| 99 | 3300026118 | Ga0207675_100388178 | Ga0207675_1003881782 | 174 |
| 100 | 3300031090 | Ga0265760_10101200 | Ga0265760_101012001 | 174 |
| 101 | 3300031090 | Ga0265760_10220719 | Ga0265760_102207191 | 174 |
| 102 | 3300031235 | Ga0265330_10047201 | Ga0265330_100472012 | 174 |
| 103 | 3300031238 | Ga0265332_10244235 | Ga0265332_102442351 | 174 |
| 104 | 3300031241 | Ga0265325_10047441 | Ga0265325_100474411 | 174 |
| 105 | 3300031901 | Ga0307406_10871385 | Ga0307406_108713851 | 174 |
| 106 | 3300035725 | Ga0373947_0006660 | Ga0373947_0006660_2467_2994 | 174 |
| 107 | 3300037418 | Ga0395900_0080570 | Ga0395900_0080570_2488_3015 | 174 |
| 108 | 3300037466 | Ga0395898_0240887 | Ga0395898_0240887_499_1026 | 174 |
| 109 | 3300046507 | Ga0495606_0239286 | Ga0495606_0239286_332_868 | 174 |
| 110 | 3300046536 | Ga0495587_0280506 | Ga0495587_0280506_211_750 | 174 |
| 111 | 3300046692 | Ga0495671_0024785 | Ga0495671_0024785_1926_2462 | 174 |
| 112 | 3300046694 | Ga0495649_0021515 | Ga0495649_0021515_200_736 | 174 |
| 113 | 3300048918 | Ga0496115_0101394 | Ga0496115_0101394_1267_1872 | 174 |
| 114 | 3300049744 | Ga0501083_0090480 | Ga0501083_0090480_56_604 | 174 |
| 115 | 3300050508 | nmdc:mga09592_33777_c1 | nmdc:mga09592_33777_c1_1745_2272 | 174 |
| 116 | 3300050509 | nmdc:mga0qj67_377845_c1 | nmdc:mga0qj67_377845_c1_229_756 | 174 |
| 117 | 3300050512 | nmdc:mga0n895_44059_c1 | nmdc:mga0n895_44059_c1_1946_2473 | 174 |
| 118 | 3300050512 | nmdc:mga0n895_483704_c1 | nmdc:mga0n895_483704_c1_129_686 | 174 |
| 119 | 3300050513 | nmdc:mga0rr50_107908_c1 | nmdc:mga0rr50_107908_c1_1137_1664 | 174 |
| 120 | 3300050515 | nmdc:mga0a205_85671_c1 | nmdc:mga0a205_85671_c1_649_1176 | 174 |
| 121 | 3300053085 | Ga0495619_0141325 | Ga0495619_0141325_1043_1648 | 174 |
| 122 | 3300005467 | Ga0070706_100058381 | Ga0070706_1000583812 | 175 |
| 123 | 3300005468 | Ga0070707_100168795 | Ga0070707_1001687953 | 175 |
| 124 | 3300005471 | Ga0070698_100038863 | Ga0070698_1000388631 | 175 |
| 125 | 3300005536 | Ga0070697_100464553 | Ga0070697_1004645531 | 175 |
| 126 | 3300006175 | Ga0070712_100942670 | Ga0070712_1009426702 | 175 |
| 127 | 3300006881 | Ga0068865_100340322 | Ga0068865_1003403222 | 175 |
| 128 | 3300009177 | Ga0105248_10047471 | Ga0105248_100474712 | 175 |
| 129 | 3300009553 | Ga0105249_11155608 | Ga0105249_111556081 | 175 |
| 130 | 3300013306 | Ga0163162_10023535 | Ga0163162_100235354 | 175 |
| 131 | 3300025910 | Ga0207684_10042515 | Ga0207684_100425152 | 175 |
| 132 | 3300025938 | Ga0207704_10220158 | Ga0207704_102201582 | 175 |
| 133 | 3300036401 | Ga0373937_0098638 | Ga0373937_0098638_1727_2347 | 175 |
| 134 | 3300046689 | Ga0495613_0151163 | Ga0495613_0151163_882_1502 | 175 |
| 135 | 3300053085 | Ga0495619_0044057 | Ga0495619_0044057_964_1584 | 175 |
| 136 | 3300005617 | Ga0068859_101535173 | Ga0068859_1015351731 | 176 |
| 137 | 3300006931 | Ga0097620_101535320 | Ga0097620_1015353201 | 176 |
| 138 | 3300007265 | Ga0099794_10009086 | Ga0099794_100090865 | 176 |
| 139 | 3300048907 | Ga0496104_0000124 | Ga0496104_0000124_30398_30976 | 176 |
| 140 | 3300048908 | Ga0496105_0001946 | Ga0496105_0001946_8895_9473 | 176 |
| 141 | 3300048912 | Ga0496109_0020137 | Ga0496109_0020137_949_1527 | 176 |
| 142 | 3300048913 | Ga0496110_0000800 | Ga0496110_0000800_15284_15862 | 176 |
| 143 | 3300048915 | Ga0496112_0181113 | Ga0496112_0181113_973_1551 | 176 |
| 144 | 3300048916 | Ga0496113_0002214 | Ga0496113_0002214_4345_4923 | 176 |
| 145 | 3300053730 | Ga0500645_034208 | Ga0500645_034208_516_1079 | 176 |
| 146 | 3300005536 | Ga0070697_100560329 | Ga0070697_1005603292 | 177 |
| 147 | 3300006173 | Ga0070716_100457486 | Ga0070716_1004574862 | 177 |
| 148 | 3300009147 | Ga0114129_10042156 | Ga0114129_100421565 | 177 |
| 149 | 3300010375 | Ga0105239_11033222 | Ga0105239_110332222 | 177 |
| 150 | 3300025939 | Ga0207665_10643460 | Ga0207665_106434602 | 177 |
| 151 | 3300025942 | Ga0207689_10105965 | Ga0207689_101059652 | 177 |
| 152 | 3300025945 | Ga0207679_10062953 | Ga0207679_100629533 | 177 |
| 153 | 3300048907 | Ga0496104_0014338 | Ga0496104_0014338_4569_5189 | 177 |
| 154 | 3300048908 | Ga0496105_0021200 | Ga0496105_0021200_253_873 | 177 |
| 155 | 3300048911 | Ga0496108_0013239 | Ga0496108_0013239_787_1407 | 177 |
| 156 | 3300048912 | Ga0496109_0006773 | Ga0496109_0006773_4803_5423 | 177 |
| 157 | 3300048913 | Ga0496110_0006467 | Ga0496110_0006467_4549_5169 | 177 |
| 158 | 3300048914 | Ga0496111_0061244 | Ga0496111_0061244_1326_1946 | 177 |
| 159 | 3300048915 | Ga0496112_0001747 | Ga0496112_0001747_6109_6729 | 177 |
| 160 | 3300048916 | Ga0496113_0000645 | Ga0496113_0000645_3812_4432 | 177 |
| 161 | 3300050492 | nmdc:mga0yw44_26356_c1 | nmdc:mga0yw44_26356_c1_743_1363 | 177 |
| 162 | 3300050494 | nmdc:mga06z11_68475_c1 | nmdc:mga06z11_68475_c1_414_1034 | 177 |
| 163 | 3300050507 | nmdc:mga05p37_281792_c1 | nmdc:mga05p37_281792_c1_374_994 | 177 |
| 164 | 3300005329 | Ga0070683_100278376 | Ga0070683_1002783763 | 178 |
| 165 | 3300005364 | Ga0070673_100060127 | Ga0070673_1000601272 | 178 |
| 166 | 3300005367 | Ga0070667_100676818 | Ga0070667_1006768181 | 178 |
| 167 | 3300005617 | Ga0068859_101050170 | Ga0068859_1010501701 | 178 |
| 168 | 3300006042 | Ga0075368_10029505 | Ga0075368_100295051 | 178 |
| 169 | 3300006844 | Ga0075428_100301382 | Ga0075428_1003013822 | 178 |
| 170 | 3300006931 | Ga0097620_101050104 | Ga0097620_1010501041 | 178 |
| 171 | 3300025903 | Ga0207680_10597467 | Ga0207680_105974671 | 178 |
| 172 | 3300048905 | Ga0496102_0028178 | Ga0496102_0028178_2808_3428 | 178 |
| 173 | 3300048918 | Ga0496115_0400533 | Ga0496115_0400533_17_637 | 178 |
| 174 | 3300050490 | nmdc:mga03n38_136387_c1 | nmdc:mga03n38_136387_c1_306_929 | 178 |
| 175 | 3300005467 | Ga0070706_100024155 | Ga0070706_1000241554 | 179 |
| 176 | 3300005536 | Ga0070697_100494155 | Ga0070697_1004941552 | 179 |
| 177 | 3300006038 | Ga0075365_10045522 | Ga0075365_100455223 | 179 |
| 178 | 3300007788 | Ga0099795_10044755 | Ga0099795_100447553 | 179 |
| 179 | 3300025910 | Ga0207684_10270245 | Ga0207684_102702452 | 179 |
| 180 | 3300005842 | Ga0068858_100042105 | Ga0068858_1000421052 | 180 |
| 181 | 3300025939 | Ga0207665_10098069 | Ga0207665_100980694 | 180 |
| 182 | 3300026035 | Ga0207703_10030620 | Ga0207703_100306205 | 180 |
| 183 | 3300046455 | Ga0495603_0119814 | Ga0495603_0119814_772_1353 | 180 |
| 184 | 3300046459 | Ga0495629_0558999 | Ga0495629_0558999_50_670 | 180 |
| 185 | 3300046461 | Ga0495641_0038865 | Ga0495641_0038865_1583_2164 | 180 |
| 186 | 3300046476 | Ga0495662_0073013 | Ga0495662_0073013_619_1200 | 180 |
| 187 | 3300046517 | Ga0495630_0148595 | Ga0495630_0148595_233_814 | 180 |
| 188 | 3300046683 | Ga0495658_0066392 | Ga0495658_0066392_216_797 | 180 |
| 189 | 3300046690 | Ga0495624_0068956 | Ga0495624_0068956_1466_2047 | 180 |
| 190 | 3300053130 | Ga0500642_0021181 | Ga0500642_0021181_383_961 | 180 |
| 191 | 3300053730 | Ga0500645_012097 | Ga0500645_012097_1534_2112 | 180 |
| 192 | 3300005546 | Ga0070696_100356943 | Ga0070696_1003569431 | 181 |
| 193 | 3300006175 | Ga0070712_100096559 | Ga0070712_1000965592 | 181 |
| 194 | 3300025915 | Ga0207693_10397815 | Ga0207693_103978151 | 181 |
| 195 | 3300005937 | Ga0081455_10056498 | Ga0081455_100564986 | 182 |
| 196 | 3300006175 | Ga0070712_100123678 | Ga0070712_1001236782 | 182 |
| 197 | 3300025913 | Ga0207695_10018105 | Ga0207695_100181052 | 182 |
| 198 | 3300005341 | Ga0070691_10041850 | Ga0070691_100418501 | 183 |
| 199 | 3300005434 | Ga0070709_10041083 | Ga0070709_100410832 | 183 |
| 200 | 3300005435 | Ga0070714_100050469 | Ga0070714_1000504694 | 183 |
| 201 | 3300005435 | Ga0070714_100586284 | Ga0070714_1005862842 | 183 |
| 202 | 3300005436 | Ga0070713_100051621 | Ga0070713_1000516213 | 183 |
| 203 | 3300005436 | Ga0070713_100058227 | Ga0070713_1000582274 | 183 |
| 204 | 3300005437 | Ga0070710_10022235 | Ga0070710_100222353 | 183 |
| 205 | 3300005437 | Ga0070710_10483141 | Ga0070710_104831411 | 183 |
| 206 | 3300005439 | Ga0070711_100052092 | Ga0070711_1000520923 | 183 |
| 207 | 3300005439 | Ga0070711_100097438 | Ga0070711_1000974383 | 183 |
| 208 | 3300005444 | Ga0070694_100030156 | Ga0070694_1000301564 | 183 |
| 209 | 3300005467 | Ga0070706_100276890 | Ga0070706_1002768902 | 183 |
| 210 | 3300005545 | Ga0070695_100139882 | Ga0070695_1001398824 | 183 |
| 211 | 3300006028 | Ga0070717_10127529 | Ga0070717_101275292 | 183 |
| 212 | 3300006163 | Ga0070715_10239125 | Ga0070715_102391252 | 183 |
| 213 | 3300006173 | Ga0070716_100622723 | Ga0070716_1006227231 | 183 |
| 214 | 3300006175 | Ga0070712_100038183 | Ga0070712_1000381832 | 183 |
| 215 | 3300006175 | Ga0070712_100057890 | Ga0070712_1000578903 | 183 |
| 216 | 3300007788 | Ga0099795_10214437 | Ga0099795_102144372 | 183 |
| 217 | 3300010159 | Ga0099796_10149630 | Ga0099796_101496302 | 183 |
| 218 | 3300017792 | Ga0163161_10227657 | Ga0163161_102276572 | 183 |
| 219 | 3300025898 | Ga0207692_10014353 | Ga0207692_100143532 | 183 |
| 220 | 3300025906 | Ga0207699_10006446 | Ga0207699_100064465 | 183 |
| 221 | 3300025906 | Ga0207699_10167548 | Ga0207699_101675482 | 183 |
| 222 | 3300025915 | Ga0207693_10030625 | Ga0207693_100306252 | 183 |
| 223 | 3300025915 | Ga0207693_10041041 | Ga0207693_100410413 | 183 |
| 224 | 3300025928 | Ga0207700_10455211 | Ga0207700_104552112 | 183 |
| 225 | 3300025929 | Ga0207664_10056506 | Ga0207664_100565064 | 183 |
| 226 | 3300025929 | Ga0207664_10340820 | Ga0207664_103408202 | 183 |
| 227 | 3300026075 | Ga0207708_10044428 | Ga0207708_100444282 | 183 |
| 228 | 3300053136 | Ga0500559_0019848 | Ga0500559_0019848_1288_1875 | 183 |
| 229 | 3300005331 | Ga0070670_100062744 | Ga0070670_1000627441 | 184 |
| 230 | 3300005337 | Ga0070682_100626999 | Ga0070682_1006269991 | 184 |
| 231 | 3300005338 | Ga0068868_100011880 | Ga0068868_1000118801 | 184 |
| 232 | 3300005344 | Ga0070661_100399279 | Ga0070661_1003992791 | 184 |
| 233 | 3300005353 | Ga0070669_100156752 | Ga0070669_1001567521 | 184 |
| 234 | 3300005354 | Ga0070675_100030007 | Ga0070675_1000300074 | 184 |
| 235 | 3300005356 | Ga0070674_100898129 | Ga0070674_1008981291 | 184 |
| 236 | 3300005365 | Ga0070688_100192513 | Ga0070688_1001925131 | 184 |
| 237 | 3300005366 | Ga0070659_100093687 | Ga0070659_1000936872 | 184 |
| 238 | 3300005367 | Ga0070667_100909030 | Ga0070667_1009090302 | 184 |
| 239 | 3300005436 | Ga0070713_100748839 | Ga0070713_1007488391 | 184 |
| 240 | 3300005455 | Ga0070663_100007487 | Ga0070663_1000074875 | 184 |
| 241 | 3300005456 | Ga0070678_100301568 | Ga0070678_1003015682 | 184 |
| 242 | 3300005466 | Ga0070685_10079109 | Ga0070685_100791092 | 184 |
| 243 | 3300005471 | Ga0070698_100288384 | Ga0070698_1002883842 | 184 |
| 244 | 3300005544 | Ga0070686_100162290 | Ga0070686_1001622901 | 184 |
| 245 | 3300005548 | Ga0070665_100246144 | Ga0070665_1002461442 | 184 |
| 246 | 3300005564 | Ga0070664_100112495 | Ga0070664_1001124951 | 184 |
| 247 | 3300005615 | Ga0070702_100046861 | Ga0070702_1000468612 | 184 |
| 248 | 3300005616 | Ga0068852_100699455 | Ga0068852_1006994551 | 184 |
| 249 | 3300005618 | Ga0068864_100018789 | Ga0068864_1000187892 | 184 |
| 250 | 3300005718 | Ga0068866_10217050 | Ga0068866_102170501 | 184 |
| 251 | 3300005719 | Ga0068861_100255169 | Ga0068861_1002551692 | 184 |
| 252 | 3300005834 | Ga0068851_10214274 | Ga0068851_102142742 | 184 |
| 253 | 3300005840 | Ga0068870_10003235 | Ga0068870_100032355 | 184 |
| 254 | 3300005842 | Ga0068858_100277824 | Ga0068858_1002778241 | 184 |
| 255 | 3300006028 | Ga0070717_10032259 | Ga0070717_100322594 | 184 |
| 256 | 3300006358 | Ga0068871_100899053 | Ga0068871_1008990532 | 184 |
| 257 | 3300009098 | Ga0105245_10218988 | Ga0105245_102189882 | 184 |
| 258 | 3300009176 | Ga0105242_10535879 | Ga0105242_105358792 | 184 |
| 259 | 3300009177 | Ga0105248_10544629 | Ga0105248_105446291 | 184 |
| 260 | 3300009545 | Ga0105237_11049136 | Ga0105237_110491361 | 184 |
| 261 | 3300009551 | Ga0105238_10245403 | Ga0105238_102454032 | 184 |
| 262 | 3300013105 | Ga0157369_11157115 | Ga0157369_111571151 | 184 |
| 263 | 3300013296 | Ga0157374_10085143 | Ga0157374_100851432 | 184 |
| 264 | 3300013297 | Ga0157378_10169362 | Ga0157378_101693622 | 184 |
| 265 | 3300013306 | Ga0163162_10849168 | Ga0163162_108491682 | 184 |
| 266 | 3300013308 | Ga0157375_10065877 | Ga0157375_100658771 | 184 |
| 267 | 3300014325 | Ga0163163_10051329 | Ga0163163_100513293 | 184 |
| 268 | 3300014968 | Ga0157379_10884794 | Ga0157379_108847942 | 184 |
| 269 | 3300014969 | Ga0157376_10529062 | Ga0157376_105290621 | 184 |
| 270 | 3300017792 | Ga0163161_10049794 | Ga0163161_100497943 | 184 |
| 271 | 3300025321 | Ga0207656_10011784 | Ga0207656_100117844 | 184 |
| 272 | 3300025899 | Ga0207642_10072315 | Ga0207642_100723151 | 184 |
| 273 | 3300025900 | Ga0207710_10019340 | Ga0207710_100193401 | 184 |
| 274 | 3300025904 | Ga0207647_10022423 | Ga0207647_100224232 | 184 |
| 275 | 3300025908 | Ga0207643_10002749 | Ga0207643_100027498 | 184 |
| 276 | 3300025918 | Ga0207662_10125594 | Ga0207662_101255942 | 184 |
| 277 | 3300025919 | Ga0207657_10484506 | Ga0207657_104845061 | 184 |
| 278 | 3300025923 | Ga0207681_10042080 | Ga0207681_100420802 | 184 |
| 279 | 3300025925 | Ga0207650_10046190 | Ga0207650_100461904 | 184 |
| 280 | 3300025926 | Ga0207659_10011421 | Ga0207659_100114212 | 184 |
| 281 | 3300025931 | Ga0207644_10197452 | Ga0207644_101974522 | 184 |
| 282 | 3300025933 | Ga0207706_10074587 | Ga0207706_100745871 | 184 |
| 283 | 3300025934 | Ga0207686_10313025 | Ga0207686_103130252 | 184 |
| 284 | 3300025937 | Ga0207669_10376021 | Ga0207669_103760211 | 184 |
| 285 | 3300025941 | Ga0207711_10558057 | Ga0207711_105580572 | 184 |
| 286 | 3300025945 | Ga0207679_10088871 | Ga0207679_100888713 | 184 |
| 287 | 3300025961 | Ga0207712_10221201 | Ga0207712_102212012 | 184 |
| 288 | 3300025981 | Ga0207640_10218866 | Ga0207640_102188661 | 184 |
| 289 | 3300026035 | Ga0207703_10015337 | Ga0207703_100153373 | 184 |
| 290 | 3300026041 | Ga0207639_10067489 | Ga0207639_100674893 | 184 |
| 291 | 3300026088 | Ga0207641_10011199 | Ga0207641_100111993 | 184 |
| 292 | 3300026089 | Ga0207648_10060226 | Ga0207648_100602263 | 184 |
| 293 | 3300026121 | Ga0207683_10008847 | Ga0207683_100088476 | 184 |
| 294 | 3300028379 | Ga0268266_10469276 | Ga0268266_104692762 | 184 |
| 295 | 3300028381 | Ga0268264_10257548 | Ga0268264_102575482 | 184 |
| 296 | 3300035691 | Ga0373931_0142496 | Ga0373931_0142496_422_1045 | 184 |
| 297 | 3300041452 | Ga0451793_1583517 | Ga0451793_1583517_386_1009 | 184 |
| 298 | 3300046457 | Ga0495590_0060649 | Ga0495590_0060649_122_739 | 184 |
| 299 | 3300046515 | Ga0495620_0092773 | Ga0495620_0092773_77_694 | 184 |
| 300 | 3300046529 | Ga0495652_0524884 | Ga0495652_0524884_177_797 | 184 |
| 301 | 3300046794 | Ga0495589_0068591 | Ga0495589_0068591_433_1056 | 184 |
| 302 | 3300047321 | Ga0495676_0417435 | Ga0495676_0417435_13_636 | 184 |
| 303 | 3300048903 | Ga0496100_0002800 | Ga0496100_0002800_267_887 | 184 |
| 304 | 3300048904 | Ga0496101_0235315 | Ga0496101_0235315_135_755 | 184 |
| 305 | 3300048905 | Ga0496102_0013944 | Ga0496102_0013944_89_709 | 184 |
| 306 | 3300048907 | Ga0496104_0024210 | Ga0496104_0024210_440_1060 | 184 |
| 307 | 3300048908 | Ga0496105_0007684 | Ga0496105_0007684_7236_7856 | 184 |
| 308 | 3300048909 | Ga0496106_0003706 | Ga0496106_0003706_5338_5958 | 184 |
| 309 | 3300048910 | Ga0496107_0041231 | Ga0496107_0041231_2640_3260 | 184 |
| 310 | 3300048910 | Ga0496107_0299740 | Ga0496107_0299740_140_763 | 184 |
| 311 | 3300048912 | Ga0496109_0014145 | Ga0496109_0014145_1901_2521 | 184 |
| 312 | 3300048913 | Ga0496110_0015056 | Ga0496110_0015056_5729_6349 | 184 |
| 313 | 3300048914 | Ga0496111_0391546 | Ga0496111_0391546_362_976 | 184 |
| 314 | 3300048915 | Ga0496112_0015894 | Ga0496112_0015894_4781_5401 | 184 |
| 315 | 3300048916 | Ga0496113_0005852 | Ga0496113_0005852_290_910 | 184 |
| 316 | 3300048917 | Ga0496114_0050710 | Ga0496114_0050710_801_1424 | 184 |
| 317 | 3300048917 | Ga0496114_0780946 | Ga0496114_0780946_129_743 | 184 |
| 318 | 3300048918 | Ga0496115_0003546 | Ga0496115_0003546_4801_5421 | 184 |
| 319 | 3300048918 | Ga0496115_0306254 | Ga0496115_0306254_430_1053 | 184 |
| 320 | 3300053085 | Ga0495619_0015654 | Ga0495619_0015654_2435_3055 | 184 |
| 321 | 3300006038 | Ga0075365_10110528 | Ga0075365_101105282 | 186 |
| 322 | 3300050492 | nmdc:mga0yw44_67852_c2 | nmdc:mga0yw44_67852_c2_347_967 | 186 |
| 323 | 3300002773 | JGI25152J39213_1000162 | JGI25152J39213_100016225 | 187 |
| 324 | 3300003771 | Ga0055526_1035625 | Ga0055526_10356251 | 187 |
| 325 | 3300003775 | Ga0055524_1005831 | Ga0055524_10058314 | 187 |
| 326 | 3300003790 | Ga0055528_1000295 | Ga0055528_10002952 | 187 |
| 327 | 3300005406 | Ga0070703_10143993 | Ga0070703_101439931 | 187 |
| 328 | 3300005440 | Ga0070705_100005821 | Ga0070705_1000058215 | 187 |
| 329 | 3300005455 | Ga0070663_100264080 | Ga0070663_1002640801 | 187 |
| 330 | 3300005518 | Ga0070699_100032421 | Ga0070699_1000324214 | 187 |
| 331 | 3300005546 | Ga0070696_100046693 | Ga0070696_1000466933 | 187 |
| 332 | 3300011119 | Ga0105246_10190534 | Ga0105246_101905342 | 187 |
| 333 | 3300025258 | Ga0209129_1000214 | Ga0209129_100021462 | 187 |
| 334 | 3300025273 | Ga0209673_1000317 | Ga0209673_100031737 | 187 |
| 335 | 3300025294 | Ga0209025_1026658 | Ga0209025_10266581 | 187 |
| 336 | 3300025295 | Ga0209564_1001398 | Ga0209564_100139815 | 187 |
| 337 | 3300025299 | Ga0209256_1000624 | Ga0209256_10006245 | 187 |
| 338 | 3300025885 | Ga0207653_10122281 | Ga0207653_101222812 | 187 |
| 339 | 3300025913 | Ga0207695_10181341 | Ga0207695_101813413 | 187 |
| 340 | 3300026067 | Ga0207678_10288177 | Ga0207678_102881772 | 187 |
| 341 | 3300047320 | Ga0495672_0352786 | Ga0495672_0352786_11_643 | 187 |
| 342 | 3300048905 | Ga0496102_0336710 | Ga0496102_0336710_389_982 | 187 |
| 343 | 3300048919 | Ga0496116_0041908 | Ga0496116_0041908_1091_1654 | 187 |
| 344 | 3300048922 | Ga0496119_0138868 | Ga0496119_0138868_376_939 | 187 |
| 345 | 3300048928 | Ga0496125_0104130 | Ga0496125_0104130_1456_2019 | 187 |
| 346 | 3300050507 | nmdc:mga05p37_158631_c1 | nmdc:mga05p37_158631_c1_1215_1835 | 187 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5oc0-assembly1.cif.gz_A | structure of e. coli superoxide oxidase | 0.842 | 9 | 172 |
| 5oc0-assembly1.cif.gz_A | structure of e. coli superoxide oxidase | 0.794 | 9 | 172 |
| 6g94-assembly1.cif.gz_A | structure of e. coli hydrogenase-1 c19g variant in complex with cytochrome b | 0.6887 | 12 | 158 |
| 4gd3-assembly1.cif.gz_A | structure of e. coli hydrogenase-1 in complex with cytochrome b | 0.686 | 10 | 158 |
| 6g94-assembly1.cif.gz_B | structure of e. coli hydrogenase-1 c19g variant in complex with cytochrome b | 0.6654 | 12 | 156 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P76345_3_174_1.20.950.20 | Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C | 0.8558 | 11 | 172 | 1.20.950.20 |
| af_P0ABE5_4_173_1.20.950.20 | Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C | 0.8376 | 11 | 172 | 1.20.950.20 |
| af_P76345_3_174_1.20.950.20 | Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C | 0.8059 | 11 | 172 | 1.20.950.20 |
| af_P0ABE5_4_173_1.20.950.20 | Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C | 0.7976 | 11 | 172 | 1.20.950.20 |
| 4gd3B00 | Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C | 0.6861 | 10 | 158 | 1.20.950.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q3T4E2-F1-model_v4 | Cytochrome b | 0.9624 | 9 | 137 |
GO:0005886
GO:0009055 GO:0020037 GO:0022904 GO:0046872 |
| AF-A0A0F3K3H8-F1-model_v4 | Cytochrome B561 | 0.9597 | 9 | 139 |
GO:0005886
GO:0009055 GO:0020037 GO:0022904 GO:0046872 |
| AF-A0A1E4PI45-F1-model_v4 | Cytochrome B | 0.9573 | 9 | 158 |
GO:0005886
GO:0009055 GO:0020037 GO:0022904 GO:0046872 |
| AF-A0A2R7T7I0-F1-model_v4 | deleted | 0.957 | 9 | 148 |
|
| AF-A0A640SSK7-F1-model_v4 | Type-b cytochrome | 0.9528 | 9 | 172 |
GO:0005886
GO:0009055 GO:0020037 GO:0022904 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar