F416896

General Info

Members Datasets Scaffolds Average Seq Length
346 216 344 191

Family's Representative Sequence

Representative Sequence 3300047320|Ga0495672_0352786|Ga0495672_0352786_11_643
Length 210
Sequence MTTTTASDRPFTPLSRLLHWTMAALILAMLFIGIGMVASLSHYHTLISIHRPLGILVLALVAIRLVNRFINPPPPLPDGMPGWQRFAALGSHVVLYALMFALPIVGWAMLSAARYPIVLYGPLQLPPIAPQDPELFAMLRSTHTVLALLLFATFLAHFGAAMMHALIFRDGVFPSMTSSKFGNINEADVSDPGSGSAIAGRTRDADRPAL

Samples

Sample ID Description Type Environment
1 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
2 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
6 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
7 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
58 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
71 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
95 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
97 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
142 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
143 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
144 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
145 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
146 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
147 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
148 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
149 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
150 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
151 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
153 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
154 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
155 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
156 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
157 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
158 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
159 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
160 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
161 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
162 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
163 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
164 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
165 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
166 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
167 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
168 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
169 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
170 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
171 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
172 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
173 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
174 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
175 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
176 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
177 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
178 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
179 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
180 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
181 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
182 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
183 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
184 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
185 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
186 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
187 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
188 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
189 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
190 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
191 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
192 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
193 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
194 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
195 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
196 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
197 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
198 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
199 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
200 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
201 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
202 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
203 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
204 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
205 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
206 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
207 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
208 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
209 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
210 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
211 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
212 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
213 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
214 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
215 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
216 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.84
Metatranscriptomes 0.58
Isolates 0.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.07
Nodule 0
Rhizoplane 11.85
Rhizosphere 80.35
Stem 0
Stem Tuber 0
Unclassified 1.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1000162 3300002773 Bacteria 45604
2 rootH2_10049251 3300003320 Bacteria 22428
3 Ga0055526_1035625 3300003771 Unclassified 1336
4 Ga0055524_1005831 3300003775 Bacteria 5436
5 Ga0055528_1000295 3300003790 Bacteria 42305
6 Ga0065707_10047250 3300005295 Bacteria 1055
7 Ga0070683_100278376 3300005329 Bacteria 1591
8 Ga0070670_100062744 3300005331 Bacteria 3190
9 Ga0070677_10333223 3300005333 Bacteria 781
10 Ga0070682_100626999 3300005337 Bacteria 853
11 Ga0068868_100011880 3300005338 Bacteria 6349
12 Ga0070691_10041850 3300005341 Bacteria 2167
13 Ga0070661_100399279 3300005344 Bacteria 1087
14 Ga0070669_100156752 3300005353 Bacteria 1766
15 Ga0070675_100030007 3300005354 Bacteria 4387
16 Ga0070674_100898129 3300005356 Bacteria 771
17 Ga0070673_100060127 3300005364 Bacteria 3010
18 Ga0070688_100192513 3300005365 Bacteria 1422
19 Ga0070659_100093687 3300005366 Bacteria 2410
20 Ga0070667_100676818 3300005367 Bacteria 954
21 Ga0070667_100909030 3300005367 Bacteria 820
22 Ga0070703_10143993 3300005406 Bacteria 888
23 Ga0070709_10041083 3300005434 Bacteria 2847
24 Ga0070709_10372532 3300005434 Unclassified 1060
25 Ga0070714_100046833 3300005435 Bacteria 3670
26 Ga0070714_100050469 3300005435 Bacteria 3544
27 Ga0070714_100586284 3300005435 Bacteria 1070
28 Ga0070713_100051621 3300005436 Bacteria 3401
29 Ga0070713_100058227 3300005436 Bacteria 3222
30 Ga0070713_100100766 3300005436 Bacteria 2501
31 Ga0070713_100748839 3300005436 Bacteria 935
32 Ga0070710_10022235 3300005437 Bacteria 3313
33 Ga0070710_10483141 3300005437 Bacteria 845
34 Ga0070711_100052092 3300005439 Bacteria 2815
35 Ga0070711_100097438 3300005439 Bacteria 2133
36 Ga0070705_100005821 3300005440 Bacteria 6026
37 Ga0070705_100165431 3300005440 Bacteria 1483
38 Ga0070705_100446682 3300005440 Unclassified 969
39 Ga0070694_100030156 3300005444 Plasmid 3546
40 Ga0070694_100211132 3300005444 Bacteria 1452
41 Ga0070663_100007487 3300005455 Bacteria 6647
42 Ga0070663_100264080 3300005455 Bacteria 1366
43 Ga0070678_100301568 3300005456 Bacteria 1361
44 Ga0070685_10079109 3300005466 Bacteria 1967
45 Ga0070706_100024155 3300005467 Bacteria 5595
46 Ga0070706_100058381 3300005467 Bacteria 3561
47 Ga0070706_100276890 3300005467 Bacteria 1566
48 Ga0070706_100289049 3300005467 Unclassified 1530
49 Ga0070707_100064915 3300005468 Unclassified 3506
50 Ga0070707_100168795 3300005468 Bacteria 2132
51 Ga0070698_100038863 3300005471 Bacteria 4903
52 Ga0070698_100167957 3300005471 Bacteria 2135
53 Ga0070698_100288384 3300005471 Bacteria 1572
54 Ga0070699_100032421 3300005518 Bacteria 4511
55 Ga0070699_100128071 3300005518 Unclassified 2237
56 Ga0070699_100772984 3300005518 Bacteria 879
57 Ga0070697_100464553 3300005536 Unclassified 1103
58 Ga0070697_100494155 3300005536 Bacteria 1069
59 Ga0070697_100560329 3300005536 Bacteria 1002
60 Ga0070686_100162290 3300005544 Bacteria 1575
61 Ga0070695_100139882 3300005545 Bacteria 1677
62 Ga0070696_100046693 3300005546 Bacteria 3004
63 Ga0070696_100356943 3300005546 Bacteria 1133
64 Ga0070665_100246144 3300005548 Bacteria 1788
65 Ga0070665_101166111 3300005548 Bacteria 781
66 Ga0070664_100112495 3300005564 Bacteria 2378
67 Ga0070702_100046861 3300005615 Bacteria 2452
68 Ga0068852_100699455 3300005616 Bacteria 1024
69 Ga0068859_101050170 3300005617 Bacteria 895
70 Ga0068859_101535173 3300005617 Bacteria 735
71 Ga0068864_100018789 3300005618 Bacteria 5777
72 Ga0068866_10217050 3300005718 Bacteria 1152
73 Ga0068861_100030736 3300005719 Bacteria 3938
74 Ga0068861_100255169 3300005719 Bacteria 1498
75 Ga0068861_100705870 3300005719 Bacteria 938
76 Ga0068851_10214274 3300005834 Bacteria 1080
77 Ga0068870_10003235 3300005840 Bacteria 6876
78 Ga0068858_100042105 3300005842 Bacteria 4235
79 Ga0068858_100277824 3300005842 Bacteria 1594
80 Ga0081455_10056498 3300005937 Unclassified 3332
81 Ga0081540_1000017 3300005983 Bacteria 164991
82 Ga0081540_1000976 3300005983 Bacteria 25808
83 Ga0070717_10006684 3300006028 Bacteria 8505
84 Ga0070717_10032259 3300006028 Bacteria 4220
85 Ga0070717_10127529 3300006028 Bacteria 2185
86 Ga0070717_10288010 3300006028 Bacteria 1458
87 Ga0075365_10045522 3300006038 Bacteria 2879
88 Ga0075365_10110528 3300006038 Bacteria 1888
89 Ga0075368_10029505 3300006042 Bacteria 2121
90 Ga0070715_10239125 3300006163 Bacteria 943
91 Ga0070716_100457486 3300006173 Unclassified 932
92 Ga0070716_100555499 3300006173 Bacteria 857
93 Ga0070716_100622723 3300006173 Bacteria 815
94 Ga0070716_100806638 3300006173 Bacteria 727
95 Ga0070712_100038183 3300006175 Bacteria 3280
96 Ga0070712_100057890 3300006175 Bacteria 2724
97 Ga0070712_100096559 3300006175 Bacteria 2176
98 Ga0070712_100123678 3300006175 Bacteria 1951
99 Ga0070712_100705708 3300006175 Unclassified 860
100 Ga0070712_100942670 3300006175 Bacteria 745
101 Ga0097621_100812793 3300006237 Bacteria 867
102 Ga0068871_100899053 3300006358 Bacteria 821
103 Ga0075428_100051903 3300006844 Bacteria 4497
104 Ga0075428_100301382 3300006844 Bacteria 1723
105 Ga0075433_10220099 3300006852 Unclassified 1686
106 Ga0075433_10851915 3300006852 Unclassified 796
107 Ga0075434_100040633 3300006871 Bacteria 4606
108 Ga0075434_100369175 3300006871 Unclassified 1456
109 Ga0075429_100375093 3300006880 Bacteria 1245
110 Ga0068865_100340322 3300006881 Bacteria 1212
111 Ga0097620_101050104 3300006931 Bacteria 895
112 Ga0097620_101535320 3300006931 Bacteria 735
113 Ga0075435_100014671 3300007076 Bacteria 5870
114 Ga0099794_10009086 3300007265 Bacteria 4156
115 Ga0099794_10020246 3300007265 Bacteria 3009
116 Ga0099795_10044755 3300007788 Bacteria 1589
117 Ga0099795_10074371 3300007788 Unclassified 1288
118 Ga0099795_10113228 3300007788 Bacteria 1077
119 Ga0099795_10207035 3300007788 Bacteria 830
120 Ga0099795_10214437 3300007788 Bacteria 817
121 Ga0111539_10473588 3300009094 Bacteria 1458
122 Ga0111539_10935233 3300009094 Unclassified 1008
123 Ga0105245_10218988 3300009098 Bacteria 1836
124 Ga0114129_10042156 3300009147 Bacteria 6427
125 Ga0114129_10057001 3300009147 Bacteria 5470
126 Ga0114129_10161891 3300009147 Bacteria 3056
127 Ga0114129_10319384 3300009147 Unclassified 2064
128 Ga0105242_10355764 3300009176 Unclassified 1354
129 Ga0105242_10535879 3300009176 Bacteria 1120
130 Ga0105248_10047471 3300009177 Bacteria 4815
131 Ga0105248_10544629 3300009177 Bacteria 1309
132 Ga0105237_11049136 3300009545 Bacteria 822
133 Ga0105238_10245403 3300009551 Bacteria 1768
134 Ga0105249_10017651 3300009553 Bacteria 6337
135 Ga0105249_11155608 3300009553 Bacteria 845
136 Ga0099796_10014913 3300010159 Bacteria 2257
137 Ga0099796_10048159 3300010159 Unclassified 1469
138 Ga0099796_10050311 3300010159 Unclassified 1444
139 Ga0099796_10063611 3300010159 Bacteria 1314
140 Ga0099796_10149630 3300010159 Bacteria 918
141 Ga0105239_11033222 3300010375 Bacteria 945
142 Ga0105246_10190534 3300011119 Bacteria 1587
143 Ga0157338_1009725 3300012515 Unclassified 957
144 Ga0157369_11157115 3300013105 Bacteria 790
145 Ga0157374_10085143 3300013296 Bacteria 3005
146 Ga0157378_10031162 3300013297 Bacteria 4710
147 Ga0157378_10169362 3300013297 Bacteria 2047
148 Ga0163162_10023535 3300013306 Bacteria 6080
149 Ga0163162_10395774 3300013306 Unclassified 1514
150 Ga0163162_10849168 3300013306 Bacteria 1028
151 Ga0163162_12139874 3300013306 Bacteria 642
152 Ga0157375_10065877 3300013308 Bacteria 3613
153 Ga0157375_11557256 3300013308 Unclassified 781
154 Ga0163163_10051329 3300014325 Bacteria 4067
155 Ga0157377_10007048 3300014745 Bacteria 5399
156 Ga0157379_10884794 3300014968 Bacteria 846
157 Ga0157376_10529062 3300014969 Bacteria 1163
158 Ga0163161_10049794 3300017792 Bacteria 3029
159 Ga0163161_10227657 3300017792 Bacteria 1446
160 Ga0209129_1000214 3300025258 Bacteria 67035
161 Ga0209673_1000317 3300025273 Bacteria 88898
162 Ga0209025_1026658 3300025294 Bacteria 2892
163 Ga0209564_1001398 3300025295 Bacteria 25072
164 Ga0209256_1000624 3300025299 Bacteria 48696
165 Ga0207656_10011784 3300025321 Bacteria 3309
166 Ga0207653_10122281 3300025885 Bacteria 938
167 Ga0207692_10014353 3300025898 Bacteria 3459
168 Ga0207642_10072315 3300025899 Bacteria 1645
169 Ga0207710_10019340 3300025900 Bacteria 2906
170 Ga0207680_10597467 3300025903 Bacteria 789
171 Ga0207647_10022423 3300025904 Bacteria 4194
172 Ga0207685_10201764 3300025905 Bacteria 935
173 Ga0207699_10006446 3300025906 Bacteria 5684
174 Ga0207699_10167548 3300025906 Bacteria 1467
175 Ga0207699_10470070 3300025906 Unclassified 904
176 Ga0207643_10002749 3300025908 Bacteria 9525
177 Ga0207684_10042515 3300025910 Bacteria 3852
178 Ga0207684_10270245 3300025910 Bacteria 1467
179 Ga0207695_10018105 3300025913 Bacteria 8153
180 Ga0207695_10181341 3300025913 Unclassified 2026
181 Ga0207693_10030625 3300025915 Bacteria 4251
182 Ga0207693_10041041 3300025915 Bacteria 3644
183 Ga0207693_10103174 3300025915 Bacteria 2236
184 Ga0207693_10397815 3300025915 Unclassified 1077
185 Ga0207662_10125594 3300025918 Bacteria 1613
186 Ga0207657_10484506 3300025919 Bacteria 969
187 Ga0207646_10406459 3300025922 Bacteria 1229
188 Ga0207681_10042080 3300025923 Bacteria 3049
189 Ga0207681_10842887 3300025923 Bacteria 767
190 Ga0207650_10046190 3300025925 Bacteria 3207
191 Ga0207659_10011421 3300025926 Bacteria 5610
192 Ga0207700_10065211 3300025928 Bacteria 2778
193 Ga0207700_10272289 3300025928 Bacteria 1454
194 Ga0207700_10455211 3300025928 Bacteria 1128
195 Ga0207664_10056506 3300025929 Bacteria 3117
196 Ga0207664_10340820 3300025929 Bacteria 1325
197 Ga0207664_10472331 3300025929 Bacteria 1121
198 Ga0207644_10197452 3300025931 Bacteria 1585
199 Ga0207706_10074587 3300025933 Bacteria 2983
200 Ga0207706_10338165 3300025933 Bacteria 1309
201 Ga0207686_10313025 3300025934 Bacteria 1170
202 Ga0207686_10380936 3300025934 Unclassified 1070
203 Ga0207669_10376021 3300025937 Bacteria 1105
204 Ga0207704_10220158 3300025938 Bacteria 1404
205 Ga0207665_10098069 3300025939 Bacteria 2041
206 Ga0207665_10173600 3300025939 Unclassified 1558
207 Ga0207665_10598508 3300025939 Bacteria 861
208 Ga0207665_10643460 3300025939 Bacteria 831
209 Ga0207711_10558057 3300025941 Bacteria 1068
210 Ga0207689_10105965 3300025942 Bacteria 2309
211 Ga0207679_10062953 3300025945 Bacteria 2767
212 Ga0207679_10088871 3300025945 Bacteria 2383
213 Ga0207712_10053585 3300025961 Bacteria 2830
214 Ga0207712_10221201 3300025961 Bacteria 1514
215 Ga0207640_10218866 3300025981 Bacteria 1456
216 Ga0207703_10015337 3300026035 Bacteria 5977
217 Ga0207703_10030620 3300026035 Bacteria 4254
218 Ga0207639_10067489 3300026041 Bacteria 2783
219 Ga0207678_10288177 3300026067 Bacteria 1410
220 Ga0207708_10044428 3300026075 Bacteria 3385
221 Ga0207641_10011199 3300026088 Bacteria 7358
222 Ga0207648_10060226 3300026089 Bacteria 3311
223 Ga0207675_100388178 3300026118 Bacteria 1374
224 Ga0207683_10008847 3300026121 Bacteria 8590
225 Ga0268266_10469276 3300028379 Bacteria 1198
226 Ga0268264_10257548 3300028381 Bacteria 1624
227 Ga0265760_10101200 3300031090 Bacteria 911
228 Ga0265760_10220719 3300031090 Bacteria 646
229 Ga0265330_10047201 3300031235 Bacteria 1896
230 Ga0265332_10244235 3300031238 Bacteria 743
231 Ga0265325_10047441 3300031241 Bacteria 2223
232 Ga0307406_10871385 3300031901 Bacteria 765
233 Ga0373926_0181450 3300035083 Bacteria 807
234 Ga0373945_0453255 3300035116 Bacteria 567
235 Ga0373931_0142496 3300035691 Bacteria 1390
236 Ga0373935_0809690 3300035692 Bacteria 692
237 Ga0373947_0006660 3300035725 Bacteria 6706
238 Ga0373937_0098638 3300036401 Bacteria 2710
239 Ga0373925_0118953 3300037068 Bacteria 2049
240 Ga0395900_0080570 3300037418 Bacteria 3346
241 Ga0395898_0240887 3300037466 Bacteria 1725
242 Ga0436361_0343272 3300039447 Bacteria 1831
243 Ga0451793_1583517 3300041452 Bacteria 1047
244 Ga0495603_0119814 3300046455 Bacteria 1534
245 Ga0495590_0060649 3300046457 Bacteria 1325
246 Ga0495629_0558999 3300046459 Bacteria 767
247 Ga0495641_0038865 3300046461 Bacteria 2222
248 Ga0495651_0053210 3300046462 Bacteria 3118
249 Ga0495653_0102333 3300046463 Bacteria 2073
250 Ga0495653_0388243 3300046463 Bacteria 890
251 Ga0495662_0073013 3300046476 Bacteria 1664
252 Ga0495606_0239286 3300046507 Bacteria 1013
253 Ga0495620_0092773 3300046515 Bacteria 1210
254 Ga0495630_0145933 3300046517 Bacteria 1799
255 Ga0495630_0148595 3300046517 Bacteria 1783
256 Ga0495631_0289619 3300046518 Bacteria 697
257 Ga0495652_0524884 3300046529 Bacteria 818
258 Ga0495587_0280506 3300046536 Bacteria 934
259 Ga0495635_0170716 3300046663 Bacteria 1479
260 Ga0495657_0034959 3300046675 Unclassified 3487
261 Ga0495658_0066392 3300046683 Bacteria 2084
262 Ga0495613_0151163 3300046689 Bacteria 1655
263 Ga0495624_0030621 3300046690 Plasmid 3503
264 Ga0495624_0068956 3300046690 Bacteria 2204
265 Ga0495671_0024785 3300046692 Bacteria 3121
266 Ga0495649_0021515 3300046694 Bacteria 3612
267 Ga0495589_0068591 3300046794 Bacteria 1735
268 Ga0495604_0047040 3300047317 Plasmid 3362
269 Ga0495674_0066997 3300047319 Bacteria 3112
270 Ga0495672_0352786 3300047320 Bacteria 683
271 Ga0495676_0417435 3300047321 Bacteria 888
272 Ga0495681_0277276 3300047470 Bacteria 655
273 Ga0495602_0386331 3300048088 Unclassified 1001
274 Ga0496100_0002800 3300048903 Bacteria 8925
275 Ga0496101_0235315 3300048904 Bacteria 1424
276 Ga0496101_0750233 3300048904 Bacteria 770
277 Ga0496102_0013944 3300048905 Bacteria 6975
278 Ga0496102_0028178 3300048905 Bacteria 5017
279 Ga0496102_0336710 3300048905 Bacteria 1421
280 Ga0496103_0003934 3300048906 Bacteria 9028
281 Ga0496104_0000124 3300048907 Bacteria 71545
282 Ga0496104_0014338 3300048907 Bacteria 7158
283 Ga0496104_0024210 3300048907 Bacteria 5584
284 Ga0496105_0001946 3300048908 Bacteria 14829
285 Ga0496105_0007684 3300048908 Bacteria 8362
286 Ga0496105_0021200 3300048908 Bacteria 5257
287 Ga0496106_0003706 3300048909 Bacteria 11402
288 Ga0496107_0041231 3300048910 Bacteria 3314
289 Ga0496107_0299740 3300048910 Bacteria 1196
290 Ga0496108_0013239 3300048911 Bacteria 6722
291 Ga0496108_0049181 3300048911 Bacteria 3526
292 Ga0496108_0184012 3300048911 Bacteria 1810
293 Ga0496109_0006773 3300048912 Bacteria 9650
294 Ga0496109_0014145 3300048912 Bacteria 6937
295 Ga0496109_0020137 3300048912 Bacteria 5894
296 Ga0496110_0000800 3300048913 Bacteria 22003
297 Ga0496110_0006467 3300048913 Bacteria 9285
298 Ga0496110_0015056 3300048913 Bacteria 6430
299 Ga0496111_0061244 3300048914 Bacteria 2728
300 Ga0496111_0391546 3300048914 Bacteria 1027
301 Ga0496112_0001747 3300048915 Bacteria 17023
302 Ga0496112_0015894 3300048915 Bacteria 7033
303 Ga0496112_0181113 3300048915 Unclassified 2071
304 Ga0496112_0195576 3300048915 Bacteria 1983
305 Ga0496113_0000645 3300048916 Bacteria 17565
306 Ga0496113_0002214 3300048916 Bacteria 11217
307 Ga0496113_0005852 3300048916 Bacteria 7716
308 Ga0496114_0050710 3300048917 Bacteria 3455
309 Ga0496114_0780946 3300048917 Bacteria 833
310 Ga0496115_0003546 3300048918 Bacteria 11224
311 Ga0496115_0101394 3300048918 Bacteria 2360
312 Ga0496115_0306254 3300048918 Bacteria 1301
313 Ga0496115_0400533 3300048918 Bacteria 1114
314 Ga0496116_0041908 3300048919 Plasmid 3136
315 Ga0496119_0138868 3300048922 Unclassified 1315
316 Ga0496125_0104130 3300048928 Unclassified 2079
317 Ga0496125_0437215 3300048928 Unclassified 753
318 Ga0501083_0090480 3300049744 Bacteria 2021
319 nmdc:mga03n38_136387_c1 3300050490 Bacteria 1221
320 nmdc:mga0yw44_26356_c1 3300050492 Bacteria 3320
321 nmdc:mga0yw44_67852_c2 3300050492 Bacteria 1218
322 nmdc:mga06z11_68475_c1 3300050494 Bacteria 1871
323 nmdc:mga05p37_158631_c1 3300050507 Bacteria 2763
324 nmdc:mga05p37_281792_c1 3300050507 Bacteria 1982
325 nmdc:mga09592_33777_c1 3300050508 Bacteria 4273
326 nmdc:mga0qj67_377845_c1 3300050509 Unclassified 1144
327 nmdc:mga0n895_1020759_c1 3300050512 Bacteria 807
328 nmdc:mga0n895_37904_c1 3300050512 Bacteria 4667
329 nmdc:mga0n895_44059_c1 3300050512 Bacteria 4352
330 nmdc:mga0n895_483704_c1 3300050512 Bacteria 1248
331 nmdc:mga0rr50_107908_c1 3300050513 Bacteria 2199
332 nmdc:mga0rr50_1547552_c1 3300050513 Unclassified 560
333 nmdc:mga0rr50_28730_c1 3300050513 Bacteria 3913
334 nmdc:mga0a205_1105857_c1 3300050515 Bacteria 640
335 nmdc:mga0a205_716627_c1 3300050515 Unclassified 850
336 nmdc:mga0a205_85671_c1 3300050515 Bacteria 3043
337 Ga0495619_0015654 3300053085 Bacteria 4801
338 Ga0495619_0044057 3300053085 Bacteria 2927
339 Ga0495619_0141325 3300053085 Bacteria 1658
340 Ga0500642_0021181 3300053130 Bacteria 2570
341 Ga0500559_0019848 3300053136 Bacteria 2840
342 Ga0500645_012097 3300053730 Unclassified 2795
343 Ga0500645_018755 3300053730 Bacteria 2157
344 Ga0500645_034208 3300053730 Bacteria 1518

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035116 Ga0373945_0453255 Ga0373945_0453255_46_555 153
2 3300006871 Ga0075434_100040633 Ga0075434_1000406332 155
3 3300007076 Ga0075435_100014671 Ga0075435_1000146713 155
4 3300050512 nmdc:mga0n895_37904_c1 nmdc:mga0n895_37904_c1_3943_4524 155
5 3300050513 nmdc:mga0rr50_28730_c1 nmdc:mga0rr50_28730_c1_105_686 155
6 3300050515 nmdc:mga0a205_1105857_c1 nmdc:mga0a205_1105857_c1_31_612 155
7 3300009147 Ga0114129_10161891 Ga0114129_101618912 157
8 3300010159 Ga0099796_10063611 Ga0099796_100636111 157
9 3300046463 Ga0495653_0388243 Ga0495653_0388243_308_871 157
10 3300050513 nmdc:mga0rr50_1547552_c1 nmdc:mga0rr50_1547552_c1_31_528 157
11 3300053730 Ga0500645_018755 Ga0500645_018755_429_932 157
12 3300006028 Ga0070717_10288010 Ga0070717_102880101 159
13 3300048904 Ga0496101_0750233 Ga0496101_0750233_198_752 160
14 3300048911 Ga0496108_0049181 Ga0496108_0049181_16_558 160
15 3300006173 Ga0070716_100806638 Ga0070716_1008066381 162
16 3300005719 Ga0068861_100030736 Ga0068861_1000307361 164
17 3300007788 Ga0099795_10074371 Ga0099795_100743711 164
18 3300010159 Ga0099796_10048159 Ga0099796_100481591 164
19 3300010159 Ga0099796_10050311 Ga0099796_100503111 164
20 3300035083 Ga0373926_0181450 Ga0373926_0181450_277_789 164
21 3300046462 Ga0495651_0053210 Ga0495651_0053210_201_713 164
22 3300046463 Ga0495653_0102333 Ga0495653_0102333_1312_1824 164
23 3300046517 Ga0495630_0145933 Ga0495630_0145933_1230_1742 164
24 3300046663 Ga0495635_0170716 Ga0495635_0170716_784_1296 164
25 3300046675 Ga0495657_0034959 Ga0495657_0034959_2698_3210 164
26 3300046690 Ga0495624_0030621 Ga0495624_0030621_2567_3079 164
27 3300047317 Ga0495604_0047040 Ga0495604_0047040_2721_3233 164
28 3300047319 Ga0495674_0066997 Ga0495674_0066997_616_1128 164
29 3300048088 Ga0495602_0386331 Ga0495602_0386331_336_848 164
30 3300005548 Ga0070665_101166111 Ga0070665_1011661112 165
31 3300009147 Ga0114129_10057001 Ga0114129_100570013 165
32 3300039447 Ga0436361_0343272 Ga0436361_0343272_812_1327 166
33 3300046518 Ga0495631_0289619 Ga0495631_0289619_155_676 166
34 3300047470 Ga0495681_0277276 Ga0495681_0277276_48_611 167
35 3300005983 Ga0081540_1000017 Ga0081540_100001713 168
36 3300035692 Ga0373935_0809690 Ga0373935_0809690_120_665 168
37 iso_pu_bacteria 2643221547 2643756051 169
38 iso_pu_bacteria 2883354860 2883355601 170
39 3300005333 Ga0070677_10333223 Ga0070677_103332231 171
40 3300005436 Ga0070713_100100766 Ga0070713_1001007662 171
41 3300009094 Ga0111539_10473588 Ga0111539_104735882 171
42 3300014745 Ga0157377_10007048 Ga0157377_100070483 171
43 3300025928 Ga0207700_10065211 Ga0207700_100652113 171
44 3300025928 Ga0207700_10272289 Ga0207700_102722891 171
45 3300037068 Ga0373925_0118953 Ga0373925_0118953_460_1050 171
46 3300048906 Ga0496103_0003934 Ga0496103_0003934_611_1231 171
47 3300048911 Ga0496108_0184012 Ga0496108_0184012_1037_1657 171
48 3300048915 Ga0496112_0195576 Ga0496112_0195576_579_1199 171
49 3300006237 Ga0097621_100812793 Ga0097621_1008127931 172
50 3300006852 Ga0075433_10851915 Ga0075433_108519151 172
51 3300007788 Ga0099795_10113228 Ga0099795_101132282 172
52 3300010159 Ga0099796_10014913 Ga0099796_100149132 172
53 3300050512 nmdc:mga0n895_1020759_c1 nmdc:mga0n895_1020759_c1_138_656 172
54 3300050515 nmdc:mga0a205_716627_c1 nmdc:mga0a205_716627_c1_203_721 172
55 3300048928 Ga0496125_0437215 Ga0496125_0437215_66_620 173
56 3300003320 rootH2_10049251 rootH2_1004925117 174
57 3300005295 Ga0065707_10047250 Ga0065707_100472502 174
58 3300005434 Ga0070709_10372532 Ga0070709_103725321 174
59 3300005435 Ga0070714_100046833 Ga0070714_1000468335 174
60 3300005440 Ga0070705_100165431 Ga0070705_1001654311 174
61 3300005440 Ga0070705_100446682 Ga0070705_1004466822 174
62 3300005444 Ga0070694_100211132 Ga0070694_1002111322 174
63 3300005467 Ga0070706_100289049 Ga0070706_1002890492 174
64 3300005468 Ga0070707_100064915 Ga0070707_1000649152 174
65 3300005471 Ga0070698_100167957 Ga0070698_1001679572 174
66 3300005518 Ga0070699_100128071 Ga0070699_1001280713 174
67 3300005518 Ga0070699_100772984 Ga0070699_1007729841 174
68 3300005719 Ga0068861_100705870 Ga0068861_1007058702 174
69 3300005983 Ga0081540_1000976 Ga0081540_10009769 174
70 3300006028 Ga0070717_10006684 Ga0070717_100066842 174
71 3300006173 Ga0070716_100555499 Ga0070716_1005554992 174
72 3300006175 Ga0070712_100705708 Ga0070712_1007057082 174
73 3300006844 Ga0075428_100051903 Ga0075428_1000519032 174
74 3300006852 Ga0075433_10220099 Ga0075433_102200992 174
75 3300006871 Ga0075434_100369175 Ga0075434_1003691753 174
76 3300006880 Ga0075429_100375093 Ga0075429_1003750931 174
77 3300007265 Ga0099794_10020246 Ga0099794_100202464 174
78 3300007788 Ga0099795_10207035 Ga0099795_102070352 174
79 3300009094 Ga0111539_10935233 Ga0111539_109352331 174
80 3300009147 Ga0114129_10319384 Ga0114129_103193842 174
81 3300009176 Ga0105242_10355764 Ga0105242_103557642 174
82 3300009553 Ga0105249_10017651 Ga0105249_100176513 174
83 3300012515 Ga0157338_1009725 Ga0157338_10097252 174
84 3300013297 Ga0157378_10031162 Ga0157378_100311625 174
85 3300013306 Ga0163162_10395774 Ga0163162_103957741 174
86 3300013306 Ga0163162_12139874 Ga0163162_121398741 174
87 3300013308 Ga0157375_11557256 Ga0157375_115572561 174
88 3300025905 Ga0207685_10201764 Ga0207685_102017642 174
89 3300025906 Ga0207699_10470070 Ga0207699_104700702 174
90 3300025915 Ga0207693_10103174 Ga0207693_101031743 174
91 3300025922 Ga0207646_10406459 Ga0207646_104064592 174
92 3300025923 Ga0207681_10842887 Ga0207681_108428871 174
93 3300025929 Ga0207664_10472331 Ga0207664_104723312 174
94 3300025933 Ga0207706_10338165 Ga0207706_103381652 174
95 3300025934 Ga0207686_10380936 Ga0207686_103809362 174
96 3300025939 Ga0207665_10173600 Ga0207665_101736002 174
97 3300025939 Ga0207665_10598508 Ga0207665_105985082 174
98 3300025961 Ga0207712_10053585 Ga0207712_100535852 174
99 3300026118 Ga0207675_100388178 Ga0207675_1003881782 174
100 3300031090 Ga0265760_10101200 Ga0265760_101012001 174
101 3300031090 Ga0265760_10220719 Ga0265760_102207191 174
102 3300031235 Ga0265330_10047201 Ga0265330_100472012 174
103 3300031238 Ga0265332_10244235 Ga0265332_102442351 174
104 3300031241 Ga0265325_10047441 Ga0265325_100474411 174
105 3300031901 Ga0307406_10871385 Ga0307406_108713851 174
106 3300035725 Ga0373947_0006660 Ga0373947_0006660_2467_2994 174
107 3300037418 Ga0395900_0080570 Ga0395900_0080570_2488_3015 174
108 3300037466 Ga0395898_0240887 Ga0395898_0240887_499_1026 174
109 3300046507 Ga0495606_0239286 Ga0495606_0239286_332_868 174
110 3300046536 Ga0495587_0280506 Ga0495587_0280506_211_750 174
111 3300046692 Ga0495671_0024785 Ga0495671_0024785_1926_2462 174
112 3300046694 Ga0495649_0021515 Ga0495649_0021515_200_736 174
113 3300048918 Ga0496115_0101394 Ga0496115_0101394_1267_1872 174
114 3300049744 Ga0501083_0090480 Ga0501083_0090480_56_604 174
115 3300050508 nmdc:mga09592_33777_c1 nmdc:mga09592_33777_c1_1745_2272 174
116 3300050509 nmdc:mga0qj67_377845_c1 nmdc:mga0qj67_377845_c1_229_756 174
117 3300050512 nmdc:mga0n895_44059_c1 nmdc:mga0n895_44059_c1_1946_2473 174
118 3300050512 nmdc:mga0n895_483704_c1 nmdc:mga0n895_483704_c1_129_686 174
119 3300050513 nmdc:mga0rr50_107908_c1 nmdc:mga0rr50_107908_c1_1137_1664 174
120 3300050515 nmdc:mga0a205_85671_c1 nmdc:mga0a205_85671_c1_649_1176 174
121 3300053085 Ga0495619_0141325 Ga0495619_0141325_1043_1648 174
122 3300005467 Ga0070706_100058381 Ga0070706_1000583812 175
123 3300005468 Ga0070707_100168795 Ga0070707_1001687953 175
124 3300005471 Ga0070698_100038863 Ga0070698_1000388631 175
125 3300005536 Ga0070697_100464553 Ga0070697_1004645531 175
126 3300006175 Ga0070712_100942670 Ga0070712_1009426702 175
127 3300006881 Ga0068865_100340322 Ga0068865_1003403222 175
128 3300009177 Ga0105248_10047471 Ga0105248_100474712 175
129 3300009553 Ga0105249_11155608 Ga0105249_111556081 175
130 3300013306 Ga0163162_10023535 Ga0163162_100235354 175
131 3300025910 Ga0207684_10042515 Ga0207684_100425152 175
132 3300025938 Ga0207704_10220158 Ga0207704_102201582 175
133 3300036401 Ga0373937_0098638 Ga0373937_0098638_1727_2347 175
134 3300046689 Ga0495613_0151163 Ga0495613_0151163_882_1502 175
135 3300053085 Ga0495619_0044057 Ga0495619_0044057_964_1584 175
136 3300005617 Ga0068859_101535173 Ga0068859_1015351731 176
137 3300006931 Ga0097620_101535320 Ga0097620_1015353201 176
138 3300007265 Ga0099794_10009086 Ga0099794_100090865 176
139 3300048907 Ga0496104_0000124 Ga0496104_0000124_30398_30976 176
140 3300048908 Ga0496105_0001946 Ga0496105_0001946_8895_9473 176
141 3300048912 Ga0496109_0020137 Ga0496109_0020137_949_1527 176
142 3300048913 Ga0496110_0000800 Ga0496110_0000800_15284_15862 176
143 3300048915 Ga0496112_0181113 Ga0496112_0181113_973_1551 176
144 3300048916 Ga0496113_0002214 Ga0496113_0002214_4345_4923 176
145 3300053730 Ga0500645_034208 Ga0500645_034208_516_1079 176
146 3300005536 Ga0070697_100560329 Ga0070697_1005603292 177
147 3300006173 Ga0070716_100457486 Ga0070716_1004574862 177
148 3300009147 Ga0114129_10042156 Ga0114129_100421565 177
149 3300010375 Ga0105239_11033222 Ga0105239_110332222 177
150 3300025939 Ga0207665_10643460 Ga0207665_106434602 177
151 3300025942 Ga0207689_10105965 Ga0207689_101059652 177
152 3300025945 Ga0207679_10062953 Ga0207679_100629533 177
153 3300048907 Ga0496104_0014338 Ga0496104_0014338_4569_5189 177
154 3300048908 Ga0496105_0021200 Ga0496105_0021200_253_873 177
155 3300048911 Ga0496108_0013239 Ga0496108_0013239_787_1407 177
156 3300048912 Ga0496109_0006773 Ga0496109_0006773_4803_5423 177
157 3300048913 Ga0496110_0006467 Ga0496110_0006467_4549_5169 177
158 3300048914 Ga0496111_0061244 Ga0496111_0061244_1326_1946 177
159 3300048915 Ga0496112_0001747 Ga0496112_0001747_6109_6729 177
160 3300048916 Ga0496113_0000645 Ga0496113_0000645_3812_4432 177
161 3300050492 nmdc:mga0yw44_26356_c1 nmdc:mga0yw44_26356_c1_743_1363 177
162 3300050494 nmdc:mga06z11_68475_c1 nmdc:mga06z11_68475_c1_414_1034 177
163 3300050507 nmdc:mga05p37_281792_c1 nmdc:mga05p37_281792_c1_374_994 177
164 3300005329 Ga0070683_100278376 Ga0070683_1002783763 178
165 3300005364 Ga0070673_100060127 Ga0070673_1000601272 178
166 3300005367 Ga0070667_100676818 Ga0070667_1006768181 178
167 3300005617 Ga0068859_101050170 Ga0068859_1010501701 178
168 3300006042 Ga0075368_10029505 Ga0075368_100295051 178
169 3300006844 Ga0075428_100301382 Ga0075428_1003013822 178
170 3300006931 Ga0097620_101050104 Ga0097620_1010501041 178
171 3300025903 Ga0207680_10597467 Ga0207680_105974671 178
172 3300048905 Ga0496102_0028178 Ga0496102_0028178_2808_3428 178
173 3300048918 Ga0496115_0400533 Ga0496115_0400533_17_637 178
174 3300050490 nmdc:mga03n38_136387_c1 nmdc:mga03n38_136387_c1_306_929 178
175 3300005467 Ga0070706_100024155 Ga0070706_1000241554 179
176 3300005536 Ga0070697_100494155 Ga0070697_1004941552 179
177 3300006038 Ga0075365_10045522 Ga0075365_100455223 179
178 3300007788 Ga0099795_10044755 Ga0099795_100447553 179
179 3300025910 Ga0207684_10270245 Ga0207684_102702452 179
180 3300005842 Ga0068858_100042105 Ga0068858_1000421052 180
181 3300025939 Ga0207665_10098069 Ga0207665_100980694 180
182 3300026035 Ga0207703_10030620 Ga0207703_100306205 180
183 3300046455 Ga0495603_0119814 Ga0495603_0119814_772_1353 180
184 3300046459 Ga0495629_0558999 Ga0495629_0558999_50_670 180
185 3300046461 Ga0495641_0038865 Ga0495641_0038865_1583_2164 180
186 3300046476 Ga0495662_0073013 Ga0495662_0073013_619_1200 180
187 3300046517 Ga0495630_0148595 Ga0495630_0148595_233_814 180
188 3300046683 Ga0495658_0066392 Ga0495658_0066392_216_797 180
189 3300046690 Ga0495624_0068956 Ga0495624_0068956_1466_2047 180
190 3300053130 Ga0500642_0021181 Ga0500642_0021181_383_961 180
191 3300053730 Ga0500645_012097 Ga0500645_012097_1534_2112 180
192 3300005546 Ga0070696_100356943 Ga0070696_1003569431 181
193 3300006175 Ga0070712_100096559 Ga0070712_1000965592 181
194 3300025915 Ga0207693_10397815 Ga0207693_103978151 181
195 3300005937 Ga0081455_10056498 Ga0081455_100564986 182
196 3300006175 Ga0070712_100123678 Ga0070712_1001236782 182
197 3300025913 Ga0207695_10018105 Ga0207695_100181052 182
198 3300005341 Ga0070691_10041850 Ga0070691_100418501 183
199 3300005434 Ga0070709_10041083 Ga0070709_100410832 183
200 3300005435 Ga0070714_100050469 Ga0070714_1000504694 183
201 3300005435 Ga0070714_100586284 Ga0070714_1005862842 183
202 3300005436 Ga0070713_100051621 Ga0070713_1000516213 183
203 3300005436 Ga0070713_100058227 Ga0070713_1000582274 183
204 3300005437 Ga0070710_10022235 Ga0070710_100222353 183
205 3300005437 Ga0070710_10483141 Ga0070710_104831411 183
206 3300005439 Ga0070711_100052092 Ga0070711_1000520923 183
207 3300005439 Ga0070711_100097438 Ga0070711_1000974383 183
208 3300005444 Ga0070694_100030156 Ga0070694_1000301564 183
209 3300005467 Ga0070706_100276890 Ga0070706_1002768902 183
210 3300005545 Ga0070695_100139882 Ga0070695_1001398824 183
211 3300006028 Ga0070717_10127529 Ga0070717_101275292 183
212 3300006163 Ga0070715_10239125 Ga0070715_102391252 183
213 3300006173 Ga0070716_100622723 Ga0070716_1006227231 183
214 3300006175 Ga0070712_100038183 Ga0070712_1000381832 183
215 3300006175 Ga0070712_100057890 Ga0070712_1000578903 183
216 3300007788 Ga0099795_10214437 Ga0099795_102144372 183
217 3300010159 Ga0099796_10149630 Ga0099796_101496302 183
218 3300017792 Ga0163161_10227657 Ga0163161_102276572 183
219 3300025898 Ga0207692_10014353 Ga0207692_100143532 183
220 3300025906 Ga0207699_10006446 Ga0207699_100064465 183
221 3300025906 Ga0207699_10167548 Ga0207699_101675482 183
222 3300025915 Ga0207693_10030625 Ga0207693_100306252 183
223 3300025915 Ga0207693_10041041 Ga0207693_100410413 183
224 3300025928 Ga0207700_10455211 Ga0207700_104552112 183
225 3300025929 Ga0207664_10056506 Ga0207664_100565064 183
226 3300025929 Ga0207664_10340820 Ga0207664_103408202 183
227 3300026075 Ga0207708_10044428 Ga0207708_100444282 183
228 3300053136 Ga0500559_0019848 Ga0500559_0019848_1288_1875 183
229 3300005331 Ga0070670_100062744 Ga0070670_1000627441 184
230 3300005337 Ga0070682_100626999 Ga0070682_1006269991 184
231 3300005338 Ga0068868_100011880 Ga0068868_1000118801 184
232 3300005344 Ga0070661_100399279 Ga0070661_1003992791 184
233 3300005353 Ga0070669_100156752 Ga0070669_1001567521 184
234 3300005354 Ga0070675_100030007 Ga0070675_1000300074 184
235 3300005356 Ga0070674_100898129 Ga0070674_1008981291 184
236 3300005365 Ga0070688_100192513 Ga0070688_1001925131 184
237 3300005366 Ga0070659_100093687 Ga0070659_1000936872 184
238 3300005367 Ga0070667_100909030 Ga0070667_1009090302 184
239 3300005436 Ga0070713_100748839 Ga0070713_1007488391 184
240 3300005455 Ga0070663_100007487 Ga0070663_1000074875 184
241 3300005456 Ga0070678_100301568 Ga0070678_1003015682 184
242 3300005466 Ga0070685_10079109 Ga0070685_100791092 184
243 3300005471 Ga0070698_100288384 Ga0070698_1002883842 184
244 3300005544 Ga0070686_100162290 Ga0070686_1001622901 184
245 3300005548 Ga0070665_100246144 Ga0070665_1002461442 184
246 3300005564 Ga0070664_100112495 Ga0070664_1001124951 184
247 3300005615 Ga0070702_100046861 Ga0070702_1000468612 184
248 3300005616 Ga0068852_100699455 Ga0068852_1006994551 184
249 3300005618 Ga0068864_100018789 Ga0068864_1000187892 184
250 3300005718 Ga0068866_10217050 Ga0068866_102170501 184
251 3300005719 Ga0068861_100255169 Ga0068861_1002551692 184
252 3300005834 Ga0068851_10214274 Ga0068851_102142742 184
253 3300005840 Ga0068870_10003235 Ga0068870_100032355 184
254 3300005842 Ga0068858_100277824 Ga0068858_1002778241 184
255 3300006028 Ga0070717_10032259 Ga0070717_100322594 184
256 3300006358 Ga0068871_100899053 Ga0068871_1008990532 184
257 3300009098 Ga0105245_10218988 Ga0105245_102189882 184
258 3300009176 Ga0105242_10535879 Ga0105242_105358792 184
259 3300009177 Ga0105248_10544629 Ga0105248_105446291 184
260 3300009545 Ga0105237_11049136 Ga0105237_110491361 184
261 3300009551 Ga0105238_10245403 Ga0105238_102454032 184
262 3300013105 Ga0157369_11157115 Ga0157369_111571151 184
263 3300013296 Ga0157374_10085143 Ga0157374_100851432 184
264 3300013297 Ga0157378_10169362 Ga0157378_101693622 184
265 3300013306 Ga0163162_10849168 Ga0163162_108491682 184
266 3300013308 Ga0157375_10065877 Ga0157375_100658771 184
267 3300014325 Ga0163163_10051329 Ga0163163_100513293 184
268 3300014968 Ga0157379_10884794 Ga0157379_108847942 184
269 3300014969 Ga0157376_10529062 Ga0157376_105290621 184
270 3300017792 Ga0163161_10049794 Ga0163161_100497943 184
271 3300025321 Ga0207656_10011784 Ga0207656_100117844 184
272 3300025899 Ga0207642_10072315 Ga0207642_100723151 184
273 3300025900 Ga0207710_10019340 Ga0207710_100193401 184
274 3300025904 Ga0207647_10022423 Ga0207647_100224232 184
275 3300025908 Ga0207643_10002749 Ga0207643_100027498 184
276 3300025918 Ga0207662_10125594 Ga0207662_101255942 184
277 3300025919 Ga0207657_10484506 Ga0207657_104845061 184
278 3300025923 Ga0207681_10042080 Ga0207681_100420802 184
279 3300025925 Ga0207650_10046190 Ga0207650_100461904 184
280 3300025926 Ga0207659_10011421 Ga0207659_100114212 184
281 3300025931 Ga0207644_10197452 Ga0207644_101974522 184
282 3300025933 Ga0207706_10074587 Ga0207706_100745871 184
283 3300025934 Ga0207686_10313025 Ga0207686_103130252 184
284 3300025937 Ga0207669_10376021 Ga0207669_103760211 184
285 3300025941 Ga0207711_10558057 Ga0207711_105580572 184
286 3300025945 Ga0207679_10088871 Ga0207679_100888713 184
287 3300025961 Ga0207712_10221201 Ga0207712_102212012 184
288 3300025981 Ga0207640_10218866 Ga0207640_102188661 184
289 3300026035 Ga0207703_10015337 Ga0207703_100153373 184
290 3300026041 Ga0207639_10067489 Ga0207639_100674893 184
291 3300026088 Ga0207641_10011199 Ga0207641_100111993 184
292 3300026089 Ga0207648_10060226 Ga0207648_100602263 184
293 3300026121 Ga0207683_10008847 Ga0207683_100088476 184
294 3300028379 Ga0268266_10469276 Ga0268266_104692762 184
295 3300028381 Ga0268264_10257548 Ga0268264_102575482 184
296 3300035691 Ga0373931_0142496 Ga0373931_0142496_422_1045 184
297 3300041452 Ga0451793_1583517 Ga0451793_1583517_386_1009 184
298 3300046457 Ga0495590_0060649 Ga0495590_0060649_122_739 184
299 3300046515 Ga0495620_0092773 Ga0495620_0092773_77_694 184
300 3300046529 Ga0495652_0524884 Ga0495652_0524884_177_797 184
301 3300046794 Ga0495589_0068591 Ga0495589_0068591_433_1056 184
302 3300047321 Ga0495676_0417435 Ga0495676_0417435_13_636 184
303 3300048903 Ga0496100_0002800 Ga0496100_0002800_267_887 184
304 3300048904 Ga0496101_0235315 Ga0496101_0235315_135_755 184
305 3300048905 Ga0496102_0013944 Ga0496102_0013944_89_709 184
306 3300048907 Ga0496104_0024210 Ga0496104_0024210_440_1060 184
307 3300048908 Ga0496105_0007684 Ga0496105_0007684_7236_7856 184
308 3300048909 Ga0496106_0003706 Ga0496106_0003706_5338_5958 184
309 3300048910 Ga0496107_0041231 Ga0496107_0041231_2640_3260 184
310 3300048910 Ga0496107_0299740 Ga0496107_0299740_140_763 184
311 3300048912 Ga0496109_0014145 Ga0496109_0014145_1901_2521 184
312 3300048913 Ga0496110_0015056 Ga0496110_0015056_5729_6349 184
313 3300048914 Ga0496111_0391546 Ga0496111_0391546_362_976 184
314 3300048915 Ga0496112_0015894 Ga0496112_0015894_4781_5401 184
315 3300048916 Ga0496113_0005852 Ga0496113_0005852_290_910 184
316 3300048917 Ga0496114_0050710 Ga0496114_0050710_801_1424 184
317 3300048917 Ga0496114_0780946 Ga0496114_0780946_129_743 184
318 3300048918 Ga0496115_0003546 Ga0496115_0003546_4801_5421 184
319 3300048918 Ga0496115_0306254 Ga0496115_0306254_430_1053 184
320 3300053085 Ga0495619_0015654 Ga0495619_0015654_2435_3055 184
321 3300006038 Ga0075365_10110528 Ga0075365_101105282 186
322 3300050492 nmdc:mga0yw44_67852_c2 nmdc:mga0yw44_67852_c2_347_967 186
323 3300002773 JGI25152J39213_1000162 JGI25152J39213_100016225 187
324 3300003771 Ga0055526_1035625 Ga0055526_10356251 187
325 3300003775 Ga0055524_1005831 Ga0055524_10058314 187
326 3300003790 Ga0055528_1000295 Ga0055528_10002952 187
327 3300005406 Ga0070703_10143993 Ga0070703_101439931 187
328 3300005440 Ga0070705_100005821 Ga0070705_1000058215 187
329 3300005455 Ga0070663_100264080 Ga0070663_1002640801 187
330 3300005518 Ga0070699_100032421 Ga0070699_1000324214 187
331 3300005546 Ga0070696_100046693 Ga0070696_1000466933 187
332 3300011119 Ga0105246_10190534 Ga0105246_101905342 187
333 3300025258 Ga0209129_1000214 Ga0209129_100021462 187
334 3300025273 Ga0209673_1000317 Ga0209673_100031737 187
335 3300025294 Ga0209025_1026658 Ga0209025_10266581 187
336 3300025295 Ga0209564_1001398 Ga0209564_100139815 187
337 3300025299 Ga0209256_1000624 Ga0209256_10006245 187
338 3300025885 Ga0207653_10122281 Ga0207653_101222812 187
339 3300025913 Ga0207695_10181341 Ga0207695_101813413 187
340 3300026067 Ga0207678_10288177 Ga0207678_102881772 187
341 3300047320 Ga0495672_0352786 Ga0495672_0352786_11_643 187
342 3300048905 Ga0496102_0336710 Ga0496102_0336710_389_982 187
343 3300048919 Ga0496116_0041908 Ga0496116_0041908_1091_1654 187
344 3300048922 Ga0496119_0138868 Ga0496119_0138868_376_939 187
345 3300048928 Ga0496125_0104130 Ga0496125_0104130_1456_2019 187
346 3300050507 nmdc:mga05p37_158631_c1 nmdc:mga05p37_158631_c1_1215_1835 187

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01292

Ni_hydr_CYTB

Prokaryotic cytochrome b561

10

179

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5oc0-assembly1.cif.gz_A structure of e. coli superoxide oxidase 0.842 9 172
5oc0-assembly1.cif.gz_A structure of e. coli superoxide oxidase 0.794 9 172
6g94-assembly1.cif.gz_A structure of e. coli hydrogenase-1 c19g variant in complex with cytochrome b 0.6887 12 158
4gd3-assembly1.cif.gz_A structure of e. coli hydrogenase-1 in complex with cytochrome b 0.686 10 158
6g94-assembly1.cif.gz_B structure of e. coli hydrogenase-1 c19g variant in complex with cytochrome b 0.6654 12 156
ID Description Score Start End Superfamily
af_P76345_3_174_1.20.950.20 Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C 0.8558 11 172 1.20.950.20
af_P0ABE5_4_173_1.20.950.20 Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C 0.8376 11 172 1.20.950.20
af_P76345_3_174_1.20.950.20 Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C 0.8059 11 172 1.20.950.20
af_P0ABE5_4_173_1.20.950.20 Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C 0.7976 11 172 1.20.950.20
4gd3B00 Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C 0.6861 10 158 1.20.950.20

Feature Viewer

pLDDT pTM Quality
85.13 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map