F416730

General Info

Members Datasets Scaffolds Average Seq Length
346 251 692 222

Family's Representative Sequence

Representative Sequence 3300006946|Ga0079104_1025026|Ga0079104_10250262
Length 274
Sequence MNKDHHGDTVTRYCKPPSDPTCHAAAPTDASPLRASTLTIPEWPPDQRPRERLIRLGPAALSDAELLAIFLRMGVPGKTAVDLARDTLDRFGSLEALFGASLAQFSQAYGLGPAKYAQLQAVFELARRVIGEAFKGGIELSASGAVSQYLQLCFAGKTYESFLVLFLDVGNRLLCAEELFRGTLTRATVHPREVVKAALAHNAAGVILAHNHPSGDPTPSAADMALTQTLKAALDLVEVRVLDHFVVAGTGCYSFAEHGYLQCSAAEHQIVKCR

Samples

Sample ID Description Type Environment
1 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
2 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
61 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
62 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
94 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
95 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
97 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
99 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
100 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
101 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
138 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
141 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
142 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
143 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
144 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
145 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
146 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
147 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
148 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
149 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
150 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
151 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
152 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
153 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
154 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
155 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
156 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
157 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
158 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
159 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
160 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
161 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
162 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
163 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
164 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
165 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
166 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
167 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
168 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
169 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
170 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
171 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
172 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
173 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
174 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
175 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
176 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
177 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
178 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
179 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
180 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
181 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
182 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
183 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
184 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
185 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
186 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
187 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
188 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
189 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
190 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
191 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
192 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
193 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
194 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
195 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
196 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
197 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
198 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
199 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
200 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
201 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
202 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
203 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
204 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
205 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
206 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
207 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
208 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
209 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
210 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
211 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
212 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
213 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
214 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
215 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
216 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
217 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
218 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
219 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
220 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
221 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
222 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
223 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
224 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
225 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
226 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
227 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
228 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
229 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
230 2511231031 Pseudomonas sp. GM16 Isolate Nodule
231 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
232 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
233 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
234 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
235 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
236 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
237 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
238 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
239 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
240 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
241 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
242 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
243 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
244 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
245 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
246 2919493220 Aeromonas salmonicida salmonicida 3466 Isolate Unclassified
247 2919543075 Aeromonas salmonicida masoucida 4076 Isolate Unclassified
248 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
249 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
250 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
251 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.35
Metatranscriptomes 0
Isolates 6.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.54
Nodule 1.73
Rhizoplane 2.6
Rhizosphere 76.59
Stem 0
Stem Tuber 0
Unclassified 2.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0079104_1025026 3300006946 Bacteria 1564
2 JGI24749J21850_1014459 3300002076 Bacteria 1106
3 JGI25155J39150_1000956 3300002704 Bacteria 3549
4 JGI25156J39149_1005912 3300002705 Bacteria 3433
5 JGI25162J39368_1005040 3300002737 Bacteria 2766
6 JGI25154J39366_1003345 3300002738 Bacteria 3433
7 JGI25157J39369_1000773 3300002741 Bacteria 16575
8 Ga0055532_1000005 3300003758 Bacteria 458107
9 Ga0070658_10103010 3300005327 Bacteria 2360
10 Ga0070676_10440132 3300005328 Bacteria 914
11 Ga0070683_100150491 3300005329 Bacteria 2206
12 Ga0070690_100069132 3300005330 Bacteria 2291
13 Ga0070670_100016361 3300005331 Bacteria 6370
14 Ga0070670_100437757 3300005331 Bacteria 1157
15 Ga0070677_10010700 3300005333 Bacteria 3144
16 Ga0070677_10065994 3300005333 Bacteria 1508
17 Ga0070666_10144342 3300005335 Bacteria 1658
18 Ga0070666_10457688 3300005335 Unclassified 922
19 Ga0070682_100027836 3300005337 Bacteria 3395
20 Ga0068868_100004436 3300005338 Bacteria 9841
21 Ga0068868_100342321 3300005338 Bacteria 1279
22 Ga0068868_100436393 3300005338 Bacteria 1136
23 Ga0070687_100024647 3300005343 Bacteria 2875
24 Ga0070661_100116834 3300005344 Bacteria 1995
25 Ga0070661_100130912 3300005344 Bacteria 1884
26 Ga0070668_100198194 3300005347 Bacteria 1648
27 Ga0070669_100459579 3300005353 Bacteria 1050
28 Ga0070675_100015141 3300005354 Bacteria 6090
29 Ga0070675_100598423 3300005354 Unclassified 1000
30 Ga0070671_100108254 3300005355 Bacteria 2334
31 Ga0070671_100150318 3300005355 Bacteria 1966
32 Ga0070671_100564073 3300005355 Bacteria 982
33 Ga0070674_100067029 3300005356 Bacteria 2524
34 Ga0070674_100168822 3300005356 Bacteria 1666
35 Ga0070673_100919850 3300005364 Bacteria 812
36 Ga0070688_100121502 3300005365 Bacteria 1750
37 Ga0070659_100251727 3300005366 Bacteria 1464
38 Ga0070667_100116012 3300005367 Bacteria 2326
39 Ga0070667_100170205 3300005367 Bacteria 1923
40 Ga0070667_100842537 3300005367 Bacteria 852
41 Ga0070701_10124602 3300005438 Bacteria 1456
42 Ga0070700_100673121 3300005441 Bacteria 819
43 Ga0070694_100059287 3300005444 Bacteria 2606
44 Ga0070708_100079093 3300005445 Bacteria 2974
45 Ga0070662_100114594 3300005457 Bacteria 2058
46 Ga0070681_10047428 3300005458 Bacteria 4294
47 Ga0068867_100278030 3300005459 Bacteria 1372
48 Ga0070685_10116658 3300005466 Bacteria 1652
49 Ga0070706_100485159 3300005467 Bacteria 1150
50 Ga0070707_100011178 3300005468 Bacteria 8366
51 Ga0070679_100618491 3300005530 Bacteria 1026
52 Ga0070684_100315205 3300005535 Bacteria 1436
53 Ga0070697_100112135 3300005536 Bacteria 2274
54 Ga0070672_100211459 3300005543 Bacteria 1624
55 Ga0070686_100004546 3300005544 Bacteria 7653
56 Ga0070695_100105688 3300005545 Bacteria 1903
57 Ga0070665_100069559 3300005548 Bacteria 3528
58 Ga0070665_100357272 3300005548 Bacteria 1467
59 Ga0070704_100279717 3300005549 Bacteria 1382
60 Ga0068855_100091896 3300005563 Bacteria 3500
61 Ga0070664_100026075 3300005564 Bacteria 4846
62 Ga0070702_100014574 3300005615 Bacteria 3990
63 Ga0068852_100002785 3300005616 Bacteria 12109
64 Ga0068852_100063695 3300005616 Bacteria 3211
65 Ga0068852_100070944 3300005616 Bacteria 3058
66 Ga0068852_100166187 3300005616 Bacteria 2065
67 Ga0068859_100064835 3300005617 Bacteria 3686
68 Ga0068864_100306057 3300005618 Bacteria 1489
69 Ga0068864_100540185 3300005618 Bacteria 1125
70 Ga0068864_100542020 3300005618 Bacteria 1124
71 Ga0068864_101059652 3300005618 Bacteria 806
72 Ga0068866_10069613 3300005718 Bacteria 1854
73 Ga0068851_10041346 3300005834 Bacteria 2317
74 Ga0068870_10410866 3300005840 Bacteria 883
75 Ga0068863_100510250 3300005841 Bacteria 1185
76 Ga0068858_100442177 3300005842 Unclassified 1252
77 Ga0068860_100109236 3300005843 Bacteria 2643
78 Ga0075365_10026177 3300006038 Bacteria 3700
79 Ga0075368_10003236 3300006042 Bacteria 5419
80 Ga0075363_100008627 3300006048 Bacteria 4756
81 Ga0075362_10001349 3300006177 Bacteria 7765
82 Ga0075367_10087013 3300006178 Bacteria 1897
83 Ga0075369_10000773 3300006186 Bacteria 10452
84 Ga0075366_10073850 3300006195 Bacteria 2033
85 Ga0075366_10359663 3300006195 Bacteria 894
86 Ga0097621_100050324 3300006237 Bacteria 3388
87 Ga0075370_10119998 3300006353 Bacteria 1530
88 Ga0097620_100064828 3300006931 Bacteria 3686
89 Ga0105240_10098135 3300009093 Bacteria 3568
90 Ga0111539_10403722 3300009094 Bacteria 1592
91 Ga0111539_10536369 3300009094 Bacteria 1363
92 Ga0105243_10041599 3300009148 Bacteria 3594
93 Ga0105242_10056763 3300009176 Bacteria 3204
94 Ga0105248_10245734 3300009177 Bacteria 2014
95 Ga0105248_10762221 3300009177 Bacteria 1092
96 Ga0105237_10087656 3300009545 Bacteria 3102
97 Ga0105249_10174348 3300009553 Bacteria 2088
98 Ga0105249_10488584 3300009553 Unclassified 1275
99 Ga0105239_10626093 3300010375 Bacteria 1228
100 Ga0157345_1000456 3300012498 Bacteria 3930
101 Ga0157373_10077509 3300013100 Bacteria 2345
102 Ga0157371_10031653 3300013102 Bacteria 3811
103 Ga0157369_11229067 3300013105 Bacteria 764
104 Ga0157374_10141370 3300013296 Bacteria 2337
105 Ga0157374_10382538 3300013296 Bacteria 1402
106 Ga0157378_10004527 3300013297 Bacteria 12196
107 Ga0157378_10085490 3300013297 Bacteria 2857
108 Ga0157378_10454081 3300013297 Unclassified 1272
109 Ga0157378_10671795 3300013297 Bacteria 1053
110 Ga0163162_10018052 3300013306 Bacteria 6903
111 Ga0157372_10186196 3300013307 Bacteria 2404
112 Ga0157375_10012004 3300013308 Bacteria 7670
113 Ga0157375_10196720 3300013308 Bacteria 2171
114 Ga0157375_10284930 3300013308 Unclassified 1815
115 Ga0157375_10547779 3300013308 Bacteria 1319
116 Ga0163163_10562131 3300014325 Unclassified 1203
117 Ga0157380_10045214 3300014326 Bacteria 3454
118 Ga0182008_10078162 3300014497 Bacteria 1628
119 Ga0157377_10047887 3300014745 Bacteria 2396
120 Ga0157377_10342075 3300014745 Bacteria 1001
121 Ga0157379_10448524 3300014968 Bacteria 1191
122 Ga0157379_10900074 3300014968 Bacteria 839
123 Ga0157376_10174901 3300014969 Bacteria 1958
124 Ga0163161_10028980 3300017792 Bacteria 3934
125 Ga0163161_10032386 3300017792 Bacteria 3731
126 Ga0213872_10069145 3300021361 Bacteria 1593
127 Ga0209435_100160 3300025206 Bacteria 21645
128 Ga0209147_100011 3300025229 Bacteria 702140
129 Ga0209437_100259 3300025233 Bacteria 82489
130 Ga0209258_101903 3300025242 Bacteria 6210
131 Ga0209646_1002991 3300025246 Bacteria 3489
132 Ga0209026_1005337 3300025250 Bacteria 3485
133 Ga0209759_1007531 3300025256 Bacteria 3489
134 Ga0209455_1002443 3300025272 Bacteria 7199
135 Ga0207697_10003227 3300025315 Bacteria 8108
136 Ga0207656_10060067 3300025321 Bacteria 1666
137 Ga0207682_10009273 3300025893 Bacteria 3888
138 Ga0207682_10133256 3300025893 Bacteria 1110
139 Ga0207682_10154622 3300025893 Bacteria 1036
140 Ga0207642_10032754 3300025899 Bacteria 2192
141 Ga0207680_10079752 3300025903 Bacteria 2054
142 Ga0207705_10593739 3300025909 Bacteria 861
143 Ga0207707_10016640 3300025912 Bacteria 6411
144 Ga0207695_10001884 3300025913 Bacteria 32805
145 Ga0207662_10002504 3300025918 Bacteria 9235
146 Ga0207649_10085624 3300025920 Bacteria 2051
147 Ga0207649_10268058 3300025920 Bacteria 1236
148 Ga0207652_10530672 3300025921 Bacteria 1059
149 Ga0207646_10043357 3300025922 Bacteria 4041
150 Ga0207650_10002879 3300025925 Bacteria 11883
151 Ga0207650_10055669 3300025925 Bacteria 2937
152 Ga0207650_10076751 3300025925 Bacteria 2525
153 Ga0207650_10372561 3300025925 Bacteria 1178
154 Ga0207659_10002570 3300025926 Bacteria 10805
155 Ga0207659_10340976 3300025926 Bacteria 1241
156 Ga0207644_10042555 3300025931 Bacteria 3219
157 Ga0207644_10068748 3300025931 Bacteria 2585
158 Ga0207644_10244348 3300025931 Bacteria 1430
159 Ga0207706_10055564 3300025933 Bacteria 3491
160 Ga0207686_10080202 3300025934 Bacteria 2127
161 Ga0207669_10005675 3300025937 Bacteria 5629
162 Ga0207669_10133833 3300025937 Bacteria 1708
163 Ga0207691_10044423 3300025940 Bacteria 4091
164 Ga0207691_10098517 3300025940 Bacteria 2611
165 Ga0207691_10108892 3300025940 Unclassified 2465
166 Ga0207711_10167604 3300025941 Bacteria 1991
167 Ga0207711_10208877 3300025941 Bacteria 1783
168 Ga0207661_10015877 3300025944 Bacteria 5548
169 Ga0207679_10000906 3300025945 Bacteria 18937
170 Ga0207667_10071536 3300025949 Bacteria 3606
171 Ga0207651_10010483 3300025960 Bacteria 5139
172 Ga0207668_10025697 3300025972 Bacteria 3814
173 Ga0207658_10259472 3300025986 Bacteria 1480
174 Ga0207677_10012546 3300026023 Bacteria 4876
175 Ga0207677_10089030 3300026023 Bacteria 2240
176 Ga0207703_10133386 3300026035 Bacteria 2147
177 Ga0207703_10264715 3300026035 Bacteria 1555
178 Ga0207708_10064335 3300026075 Bacteria 2801
179 Ga0207641_10004369 3300026088 Bacteria 12248
180 Ga0207641_10595869 3300026088 Bacteria 1081
181 Ga0207648_10074047 3300026089 Bacteria 2967
182 Ga0207648_10301541 3300026089 Bacteria 1437
183 Ga0207676_10002385 3300026095 Bacteria 13410
184 Ga0207676_10175356 3300026095 Bacteria 1872
185 Ga0207675_100034206 3300026118 Bacteria 4737
186 Ga0207683_10149905 3300026121 Bacteria 2105
187 Ga0207683_10337895 3300026121 Bacteria 1381
188 Ga0207698_10010035 3300026142 Bacteria 6064
189 Ga0207698_10121495 3300026142 Bacteria 2212
190 Ga0209281_1019032 3300027111 Bacteria 1361
191 Ga0209371_1000066 3300027312 Bacteria 212660
192 Ga0268266_10037803 3300028379 Bacteria 4109
193 Ga0268266_10223907 3300028379 Bacteria 1730
194 Ga0265324_10011371 3300029957 Bacteria 3392
195 Ga0268256_1000063 3300030500 Bacteria 212660
196 Ga0265328_10004697 3300031239 Bacteria 5903
197 Ga0265328_10025654 3300031239 Bacteria 2219
198 Ga0265320_10101058 3300031240 Bacteria 1328
199 Ga0265331_10008733 3300031250 Bacteria 5742
200 Ga0265331_10016655 3300031250 Bacteria 3852
201 Ga0265331_10062481 3300031250 Bacteria 1756
202 Ga0265327_10000103 3300031251 Bacteria 185405
203 Ga0265327_10000218 3300031251 Bacteria 116690
204 Ga0265327_10001058 3300031251 Bacteria 38434
205 Ga0265327_10016413 3300031251 Bacteria 4705
206 Ga0265327_10038442 3300031251 Bacteria 2611
207 Ga0265314_10000660 3300031711 Bacteria 42242
208 Ga0316578_10022600 3300031728 Bacteria 3509
209 Ga0307516_10363166 3300031730 Unclassified 1112
210 Ga0316580_10028953 3300032139 Bacteria 1713
211 Ga0316574_0122626 3300035398 Bacteria 1669
212 Ga0395899_0001064 3300037312 Bacteria 24780
213 Ga0395899_0002813 3300037312 Bacteria 14019
214 Ga0395900_0015619 3300037418 Bacteria 7739
215 Ga0395900_0461326 3300037418 Bacteria 1225
216 Ga0395898_0028883 3300037466 Bacteria 5558
217 Ga0395905_0000750 3300037471 Bacteria 42802
218 Ga0395905_0892579 3300037471 Bacteria 792
219 Ga0316581_0002910 3300037588 Bacteria 4192
220 Ga0395901_0001718 3300038443 Bacteria 22613
221 Ga0395901_0004958 3300038443 Bacteria 13431
222 Ga0400488_15891 3300038741 Bacteria 1234
223 Ga0400483_214450 3300039062 Bacteria 1411
224 Ga0400483_226661 3300039062 Bacteria 2883
225 Ga0436361_0670593 3300039447 Bacteria 2843
226 Ga0436361_1015159 3300039447 Bacteria 1954
227 Ga0439466_0008447 3300041411 Bacteria 3883
228 Ga0439446_0019148 3300042156 Bacteria 1922
229 Ga0439464_0007227 3300042439 Bacteria 2902
230 Ga0451577_0002441 3300042876 Bacteria 22169
231 Ga0451577_0127201 3300042876 Bacteria 2284
232 Ga0453684_0391191 3300044712 Bacteria 1559
233 Ga0451576_0002261 3300045051 Bacteria 29427
234 Ga0451576_0002688 3300045051 Bacteria 25898
235 Ga0451576_0012479 3300045051 Bacteria 9541
236 Ga0451576_0013409 3300045051 Bacteria 9170
237 Ga0451576_0013632 3300045051 Bacteria 9086
238 Ga0451576_0632452 3300045051 Bacteria 1124
239 Ga0495592_0018613 3300046454 Bacteria 5286
240 Ga0495651_0367503 3300046462 Bacteria 946
241 Ga0495653_0040723 3300046463 Bacteria 3629
242 Ga0495653_0197764 3300046463 Bacteria 1366
243 Ga0495653_0475243 3300046463 Bacteria 782
244 Ga0495585_0006926 3300046492 Bacteria 6986
245 Ga0495585_0087055 3300046492 Bacteria 1686
246 Ga0495607_0004336 3300046501 Bacteria 10464
247 Ga0495607_0027136 3300046501 Bacteria 3545
248 Ga0495607_0031232 3300046501 Bacteria 3261
249 Ga0495606_0000204 3300046507 Bacteria 103880
250 Ga0495606_0081636 3300046507 Bacteria 2009
251 Ga0495608_0001364 3300046511 Bacteria 17414
252 Ga0495618_0084893 3300046514 Bacteria 2023
253 Ga0495643_0030142 3300046522 Bacteria 3031
254 Ga0495644_0095374 3300046523 Bacteria 1124
255 Ga0495648_0208922 3300046524 Bacteria 971
256 Ga0495642_0002416 3300046528 Bacteria 7612
257 Ga0495652_0017149 3300046529 Bacteria 6466
258 Ga0495652_0019609 3300046529 Bacteria 6021
259 Ga0495609_0124872 3300046538 Bacteria 1105
260 Ga0495621_0054443 3300046539 Bacteria 1438
261 Ga0495597_0228108 3300046542 Bacteria 737
262 Ga0495645_0070447 3300046543 Bacteria 2523
263 Ga0495625_0004306 3300046660 Bacteria 13526
264 Ga0495625_0153214 3300046660 Bacteria 1548
265 Ga0495661_0006342 3300046665 Bacteria 8318
266 Ga0495661_0055298 3300046665 Bacteria 2379
267 Ga0495661_0072648 3300046665 Bacteria 2006
268 Ga0495657_0152118 3300046675 Bacteria 1436
269 Ga0495599_0005011 3300046678 Bacteria 7880
270 Ga0495658_0014941 3300046683 Bacteria 3978
271 Ga0495649_0004109 3300046694 Bacteria 9562
272 Ga0495589_0018679 3300046794 Bacteria 3554
273 Ga0495600_0000474 3300046809 Bacteria 20802
274 Ga0495660_0041464 3300046810 Bacteria 2548
275 Ga0495660_0085039 3300046810 Bacteria 1653
276 Ga0495604_0026874 3300047317 Bacteria 4580
277 Ga0495676_0046533 3300047321 Bacteria 3519
278 Ga0495687_001161 3300047443 Bacteria 25444
279 Ga0495679_031216 3300047446 Bacteria 1720
280 Ga0496108_0013170 3300048911 Bacteria 6741
281 Ga0496109_0072012 3300048912 Bacteria 3174
282 Ga0496110_0043222 3300048913 Bacteria 3934
283 Ga0496110_0171279 3300048913 Bacteria 1970
284 Ga0496110_0369626 3300048913 Bacteria 1307
285 Ga0496114_0031822 3300048917 Bacteria 4339
286 Ga0496114_0053862 3300048917 Bacteria 3354
287 Ga0496114_0067401 3300048917 Bacteria 3003
288 Ga0496116_0038021 3300048919 Bacteria 3348
289 Ga0496116_0039765 3300048919 Bacteria 3246
290 Ga0496118_0045940 3300048921 Bacteria 3402
291 Ga0496118_0104700 3300048921 Bacteria 1898
292 Ga0496121_0036776 3300048924 Bacteria 4358
293 Ga0496121_0072747 3300048924 Bacteria 2759
294 Ga0496121_0123094 3300048924 Bacteria 1955
295 Ga0496122_0000261 3300048925 Bacteria 118793
296 Ga0496123_0000218 3300048926 Bacteria 116615
297 Ga0496125_0055026 3300048928 Bacteria 3246
298 Ga0496125_0173102 3300048928 Bacteria 1448
299 Ga0495682_0000573 3300049460 Bacteria 24941
300 Ga0501269_009813 3300049766 Unclassified 1160
301 Ga0501044_0109603 3300049823 Bacteria 2770
302 Ga0501044_0782455 3300049823 Bacteria 834
303 nmdc:mga03683_3943_c1 3300050489 Bacteria 4857
304 nmdc:mga03n38_13668_c1 3300050490 Bacteria 3091
305 nmdc:mga00v17_6216_c1 3300050491 Bacteria 6334
306 nmdc:mga0k408_14025_c1 3300050493 Bacteria 4406
307 nmdc:mga04h51_29164_c1 3300050495 Bacteria 1727
308 nmdc:mga07m45_178267_c1 3300050496 Bacteria 1236
309 nmdc:mga05p37_801504_c1 3300050507 Bacteria 1030
310 nmdc:mga08y16_368019_c1 3300050511 Bacteria 1475
311 nmdc:mga0sz30_17570_c1 3300050516 Bacteria 2854
312 nmdc:mga0sz30_63175_c1 3300050516 Bacteria 1584
313 Ga0495601_0007943 3300053077 Bacteria 6247
314 Ga0500647_0243136 3300053091 Bacteria 795
315 Ga0500641_0044799 3300053096 Bacteria 1800
316 Ga0500572_102940 3300053111 Bacteria 914
317 Ga0500594_0038811 3300053118 Bacteria 1292
318 Ga0500595_003047 3300053119 Bacteria 7965
319 Ga0500618_004443 3300053125 Bacteria 4484
320 Ga0500574_007252 3300053141 Bacteria 2287
321 Ga0500619_000463 3300053154 Bacteria 7148
322 Ga0500634_0064560 3300053161 Bacteria 1933
323 Ga0500649_171071 3300053722 Bacteria 749
324 2511384997 2511231026 Bacteria 5225445
325 2511416521 2511231031 Bacteria 6558529
326 2550693527 2548876994 Bacteria 4904866
327 2602011022 2600255389 Bacteria 5275336
328 2644030400 2643221603 Bacteria 6147767
329 2765568231 2765235838 Bacteria 5445269
330 2808983550 2808606386 Bacteria 4471946
331 2809129214 2808606415 Bacteria 4576710
332 2809149731 2808606419 Bacteria 4576925
333 2819594522 2818991445 Bacteria 4955017
334 2839097464 2839094727 Bacteria 5534556
335 2852619885 2852618963 Bacteria 4577824
336 2884812433 2884811622 Bacteria 5552861
337 2884839266 2884836552 Bacteria 5219991
338 2884855557 2884852848 Bacteria 5221161
339 2896158936 2896154374 Bacteria 5221518
340 2912968998 2912963787 Bacteria 5646108
341 2919497317 2919493220 Bacteria 4598500
342 2919547462 2919543075 Bacteria 4728703
343 2969310323 2969304461 Bacteria 6601805
344 3007255115 3007252601 Bacteria 4559114
345 3007316434 3007315729 Bacteria 5076637
346 8056131725 8056131705 Bacteria 6107031
347 Ga0079104_1025026
348 JGI24749J21850_1014459
349 JGI25155J39150_1000956
350 JGI25156J39149_1005912
351 JGI25162J39368_1005040
352 JGI25154J39366_1003345
353 JGI25157J39369_1000773
354 Ga0055532_1000005
355 Ga0070658_10103010
356 Ga0070676_10440132
357 Ga0070683_100150491
358 Ga0070690_100069132
359 Ga0070670_100016361
360 Ga0070670_100437757
361 Ga0070677_10010700
362 Ga0070677_10065994
363 Ga0070666_10144342
364 Ga0070666_10457688
365 Ga0070682_100027836
366 Ga0068868_100004436
367 Ga0068868_100342321
368 Ga0068868_100436393
369 Ga0070687_100024647
370 Ga0070661_100116834
371 Ga0070661_100130912
372 Ga0070668_100198194
373 Ga0070669_100459579
374 Ga0070675_100015141
375 Ga0070675_100598423
376 Ga0070671_100108254
377 Ga0070671_100150318
378 Ga0070671_100564073
379 Ga0070674_100067029
380 Ga0070674_100168822
381 Ga0070673_100919850
382 Ga0070688_100121502
383 Ga0070659_100251727
384 Ga0070667_100116012
385 Ga0070667_100170205
386 Ga0070667_100842537
387 Ga0070701_10124602
388 Ga0070700_100673121
389 Ga0070694_100059287
390 Ga0070708_100079093
391 Ga0070662_100114594
392 Ga0070681_10047428
393 Ga0068867_100278030
394 Ga0070685_10116658
395 Ga0070706_100485159
396 Ga0070707_100011178
397 Ga0070679_100618491
398 Ga0070684_100315205
399 Ga0070697_100112135
400 Ga0070672_100211459
401 Ga0070686_100004546
402 Ga0070695_100105688
403 Ga0070665_100069559
404 Ga0070665_100357272
405 Ga0070704_100279717
406 Ga0068855_100091896
407 Ga0070664_100026075
408 Ga0070702_100014574
409 Ga0068852_100002785
410 Ga0068852_100063695
411 Ga0068852_100070944
412 Ga0068852_100166187
413 Ga0068859_100064835
414 Ga0068864_100306057
415 Ga0068864_100540185
416 Ga0068864_100542020
417 Ga0068864_101059652
418 Ga0068866_10069613
419 Ga0068851_10041346
420 Ga0068870_10410866
421 Ga0068863_100510250
422 Ga0068858_100442177
423 Ga0068860_100109236
424 Ga0075365_10026177
425 Ga0075368_10003236
426 Ga0075363_100008627
427 Ga0075362_10001349
428 Ga0075367_10087013
429 Ga0075369_10000773
430 Ga0075366_10073850
431 Ga0075366_10359663
432 Ga0097621_100050324
433 Ga0075370_10119998
434 Ga0097620_100064828
435 Ga0105240_10098135
436 Ga0111539_10403722
437 Ga0111539_10536369
438 Ga0105243_10041599
439 Ga0105242_10056763
440 Ga0105248_10245734
441 Ga0105248_10762221
442 Ga0105237_10087656
443 Ga0105249_10174348
444 Ga0105249_10488584
445 Ga0105239_10626093
446 Ga0157345_1000456
447 Ga0157373_10077509
448 Ga0157371_10031653
449 Ga0157369_11229067
450 Ga0157374_10141370
451 Ga0157374_10382538
452 Ga0157378_10004527
453 Ga0157378_10085490
454 Ga0157378_10454081
455 Ga0157378_10671795
456 Ga0163162_10018052
457 Ga0157372_10186196
458 Ga0157375_10012004
459 Ga0157375_10196720
460 Ga0157375_10284930
461 Ga0157375_10547779
462 Ga0163163_10562131
463 Ga0157380_10045214
464 Ga0182008_10078162
465 Ga0157377_10047887
466 Ga0157377_10342075
467 Ga0157379_10448524
468 Ga0157379_10900074
469 Ga0157376_10174901
470 Ga0163161_10028980
471 Ga0163161_10032386
472 Ga0213872_10069145
473 Ga0209435_100160
474 Ga0209147_100011
475 Ga0209437_100259
476 Ga0209258_101903
477 Ga0209646_1002991
478 Ga0209026_1005337
479 Ga0209759_1007531
480 Ga0209455_1002443
481 Ga0207697_10003227
482 Ga0207656_10060067
483 Ga0207682_10009273
484 Ga0207682_10133256
485 Ga0207682_10154622
486 Ga0207642_10032754
487 Ga0207680_10079752
488 Ga0207705_10593739
489 Ga0207707_10016640
490 Ga0207695_10001884
491 Ga0207662_10002504
492 Ga0207649_10085624
493 Ga0207649_10268058
494 Ga0207652_10530672
495 Ga0207646_10043357
496 Ga0207650_10002879
497 Ga0207650_10055669
498 Ga0207650_10076751
499 Ga0207650_10372561
500 Ga0207659_10002570
501 Ga0207659_10340976
502 Ga0207644_10042555
503 Ga0207644_10068748
504 Ga0207644_10244348
505 Ga0207706_10055564
506 Ga0207686_10080202
507 Ga0207669_10005675
508 Ga0207669_10133833
509 Ga0207691_10044423
510 Ga0207691_10098517
511 Ga0207691_10108892
512 Ga0207711_10167604
513 Ga0207711_10208877
514 Ga0207661_10015877
515 Ga0207679_10000906
516 Ga0207667_10071536
517 Ga0207651_10010483
518 Ga0207668_10025697
519 Ga0207658_10259472
520 Ga0207677_10012546
521 Ga0207677_10089030
522 Ga0207703_10133386
523 Ga0207703_10264715
524 Ga0207708_10064335
525 Ga0207641_10004369
526 Ga0207641_10595869
527 Ga0207648_10074047
528 Ga0207648_10301541
529 Ga0207676_10002385
530 Ga0207676_10175356
531 Ga0207675_100034206
532 Ga0207683_10149905
533 Ga0207683_10337895
534 Ga0207698_10010035
535 Ga0207698_10121495
536 Ga0209281_1019032
537 Ga0209371_1000066
538 Ga0268266_10037803
539 Ga0268266_10223907
540 Ga0265324_10011371
541 Ga0268256_1000063
542 Ga0265328_10004697
543 Ga0265328_10025654
544 Ga0265320_10101058
545 Ga0265331_10008733
546 Ga0265331_10016655
547 Ga0265331_10062481
548 Ga0265327_10000103
549 Ga0265327_10000218
550 Ga0265327_10001058
551 Ga0265327_10016413
552 Ga0265327_10038442
553 Ga0265314_10000660
554 Ga0316578_10022600
555 Ga0307516_10363166
556 Ga0316580_10028953
557 Ga0316574_0122626
558 Ga0395899_0001064
559 Ga0395899_0002813
560 Ga0395900_0015619
561 Ga0395900_0461326
562 Ga0395898_0028883
563 Ga0395905_0000750
564 Ga0395905_0892579
565 Ga0316581_0002910
566 Ga0395901_0001718
567 Ga0395901_0004958
568 Ga0400488_15891
569 Ga0400483_214450
570 Ga0400483_226661
571 Ga0436361_0670593
572 Ga0436361_1015159
573 Ga0439466_0008447
574 Ga0439446_0019148
575 Ga0439464_0007227
576 Ga0451577_0002441
577 Ga0451577_0127201
578 Ga0453684_0391191
579 Ga0451576_0002261
580 Ga0451576_0002688
581 Ga0451576_0012479
582 Ga0451576_0013409
583 Ga0451576_0013632
584 Ga0451576_0632452
585 Ga0495592_0018613
586 Ga0495651_0367503
587 Ga0495653_0040723
588 Ga0495653_0197764
589 Ga0495653_0475243
590 Ga0495585_0006926
591 Ga0495585_0087055
592 Ga0495607_0004336
593 Ga0495607_0027136
594 Ga0495607_0031232
595 Ga0495606_0000204
596 Ga0495606_0081636
597 Ga0495608_0001364
598 Ga0495618_0084893
599 Ga0495643_0030142
600 Ga0495644_0095374
601 Ga0495648_0208922
602 Ga0495642_0002416
603 Ga0495652_0017149
604 Ga0495652_0019609
605 Ga0495609_0124872
606 Ga0495621_0054443
607 Ga0495597_0228108
608 Ga0495645_0070447
609 Ga0495625_0004306
610 Ga0495625_0153214
611 Ga0495661_0006342
612 Ga0495661_0055298
613 Ga0495661_0072648
614 Ga0495657_0152118
615 Ga0495599_0005011
616 Ga0495658_0014941
617 Ga0495649_0004109
618 Ga0495589_0018679
619 Ga0495600_0000474
620 Ga0495660_0041464
621 Ga0495660_0085039
622 Ga0495604_0026874
623 Ga0495676_0046533
624 Ga0495687_001161
625 Ga0495679_031216
626 Ga0496108_0013170
627 Ga0496109_0072012
628 Ga0496110_0043222
629 Ga0496110_0171279
630 Ga0496110_0369626
631 Ga0496114_0031822
632 Ga0496114_0053862
633 Ga0496114_0067401
634 Ga0496116_0038021
635 Ga0496116_0039765
636 Ga0496118_0045940
637 Ga0496118_0104700
638 Ga0496121_0036776
639 Ga0496121_0072747
640 Ga0496121_0123094
641 Ga0496122_0000261
642 Ga0496123_0000218
643 Ga0496125_0055026
644 Ga0496125_0173102
645 Ga0495682_0000573
646 Ga0501269_009813
647 Ga0501044_0109603
648 Ga0501044_0782455
649 nmdc:mga03683_3943_c1
650 nmdc:mga03n38_13668_c1
651 nmdc:mga00v17_6216_c1
652 nmdc:mga0k408_14025_c1
653 nmdc:mga04h51_29164_c1
654 nmdc:mga07m45_178267_c1
655 nmdc:mga05p37_801504_c1
656 nmdc:mga08y16_368019_c1
657 nmdc:mga0sz30_17570_c1
658 nmdc:mga0sz30_63175_c1
659 Ga0495601_0007943
660 Ga0500647_0243136
661 Ga0500641_0044799
662 Ga0500572_102940
663 Ga0500594_0038811
664 Ga0500595_003047
665 Ga0500618_004443
666 Ga0500574_007252
667 Ga0500619_000463
668 Ga0500634_0064560
669 Ga0500649_171071
670 2511384997
671 2511416521
672 2550693527
673 2602011022
674 2644030400
675 2765568231
676 2808983550
677 2809129214
678 2809149731
679 2819594522
680 2839097464
681 2852619885
682 2884812433
683 2884839266
684 2884855557
685 2896158936
686 2912968998
687 2919497317
688 2919547462
689 2969310323
690 3007255115
691 3007316434
692 8056131725

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20582

UPF0758_N

UPF0758 N-terminal

40

117

0.97

PF04002

RadC

RadC-like JAB domain

140

260

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qlc-assembly5.cif.gz_E the crystal structure of dna repair protein radc from chlorobium tepidum tls 0.9019 109 224
2qlc-assembly5.cif.gz_E the crystal structure of dna repair protein radc from chlorobium tepidum tls 0.8411 109 224
6ui4-assembly1.cif.gz_A crystal structure of phenamacril-bound f. graminearum myosin i 0.8333 121 142
1w7j-assembly1.cif.gz_A crystal structure of myosin v motor with essential light chain + adp-befx - near rigor 0.7935 121 142
7dhw-assembly1.cif.gz_A crystal structure of myosin-xi motor domain in complex with adp-alf4 0.7737 121 142
ID Description Score Start End Superfamily
af_P25531_100_221_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9808 105 222 3.40.140.10
af_Q47685_35_158_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9707 102 224 3.40.140.10
af_Q47685_35_158_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9554 102 224 3.40.140.10
af_P31337_89_213_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9492 106 222 3.40.140.10
af_P25531_100_221_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9414 105 222 3.40.140.10
ID Description Score Start End GO Terms
AF-A0A3B8P1I9-F1-model_v4 UPF0758 domain-containing protein 0.9894 1 87
AF-A0A315EF61-F1-model_v4 MPN domain-containing protein 0.9891 85 224 GO:0006508
GO:0008237
GO:0046872
AF-A0A522VXK9-F1-model_v4 DNA repair protein RadC 0.9873 70 224 GO:0006508
GO:0008237
GO:0046872
AF-A0A645FQ93-F1-model_v4 MPN domain-containing protein 0.9873 151 224 GO:0006508
GO:0008237
GO:0046872
AF-A0A0C5GSX6-F1-model_v4 Uncharacterized protein 0.9871 120 224 GO:0006508
GO:0008237
GO:0046872

Map