F416730
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 346 | 251 | 692 | 222 |
Family's Representative Sequence
| Representative Sequence | 3300006946|Ga0079104_1025026|Ga0079104_10250262 |
| Length | 274 |
| Sequence | MNKDHHGDTVTRYCKPPSDPTCHAAAPTDASPLRASTLTIPEWPPDQRPRERLIRLGPAALSDAELLAIFLRMGVPGKTAVDLARDTLDRFGSLEALFGASLAQFSQAYGLGPAKYAQLQAVFELARRVIGEAFKGGIELSASGAVSQYLQLCFAGKTYESFLVLFLDVGNRLLCAEELFRGTLTRATVHPREVVKAALAHNAAGVILAHNHPSGDPTPSAADMALTQTLKAALDLVEVRVLDHFVVAGTGCYSFAEHGYLQCSAAEHQIVKCR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 2 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 3 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 4 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 5 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 6 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 7 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 8 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 51 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 52 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 53 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 54 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 55 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 56 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 57 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 58 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 59 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 60 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 61 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 62 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 63 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 64 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 65 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 66 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 68 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 78 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 89 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 94 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 95 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 99 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 100 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 101 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 138 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 141 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 142 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 143 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 144 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 145 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 146 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 147 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 148 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 149 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 150 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 151 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 152 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 153 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 154 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 155 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 156 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 157 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 158 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 159 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 160 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 161 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 162 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 163 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 164 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 165 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 166 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 197 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 198 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 199 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 200 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 201 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 202 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 203 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 204 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 205 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 206 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 208 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 209 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 210 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 211 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 212 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 213 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 214 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 215 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 216 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 217 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 218 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 220 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 221 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 222 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 223 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 224 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 225 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 226 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 227 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 228 | 3300053722 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere | Metagenome | Endosphere |
| 229 | 2511231026 | Herbaspirillum sp. YR522 | Isolate | Rhizosphere |
| 230 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 231 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 232 | 2600255389 | Pseudomonas sp. NFPP33 | Isolate | Rhizoplane |
| 233 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 234 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 235 | 2808606386 | Herbaspirillum sp. SJZ099 | Isolate | Rhizosphere |
| 236 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 237 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 238 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 239 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 240 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 241 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 242 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 243 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 244 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 245 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 246 | 2919493220 | Aeromonas salmonicida salmonicida 3466 | Isolate | Unclassified |
| 247 | 2919543075 | Aeromonas salmonicida masoucida 4076 | Isolate | Unclassified |
| 248 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 249 | 3007252601 | Pseudomonas punonensis D1-6 | Isolate | Unclassified |
| 250 | 3007315729 | Pseudomonas argentinensis SA190 | Isolate | Unclassified |
| 251 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.35 |
| Metatranscriptomes | 0 |
| Isolates | 6.65 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.54 |
| Nodule | 1.73 |
| Rhizoplane | 2.6 |
| Rhizosphere | 76.59 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.89 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0079104_1025026 | 3300006946 | Bacteria | 1564 |
| 2 | JGI24749J21850_1014459 | 3300002076 | Bacteria | 1106 |
| 3 | JGI25155J39150_1000956 | 3300002704 | Bacteria | 3549 |
| 4 | JGI25156J39149_1005912 | 3300002705 | Bacteria | 3433 |
| 5 | JGI25162J39368_1005040 | 3300002737 | Bacteria | 2766 |
| 6 | JGI25154J39366_1003345 | 3300002738 | Bacteria | 3433 |
| 7 | JGI25157J39369_1000773 | 3300002741 | Bacteria | 16575 |
| 8 | Ga0055532_1000005 | 3300003758 | Bacteria | 458107 |
| 9 | Ga0070658_10103010 | 3300005327 | Bacteria | 2360 |
| 10 | Ga0070676_10440132 | 3300005328 | Bacteria | 914 |
| 11 | Ga0070683_100150491 | 3300005329 | Bacteria | 2206 |
| 12 | Ga0070690_100069132 | 3300005330 | Bacteria | 2291 |
| 13 | Ga0070670_100016361 | 3300005331 | Bacteria | 6370 |
| 14 | Ga0070670_100437757 | 3300005331 | Bacteria | 1157 |
| 15 | Ga0070677_10010700 | 3300005333 | Bacteria | 3144 |
| 16 | Ga0070677_10065994 | 3300005333 | Bacteria | 1508 |
| 17 | Ga0070666_10144342 | 3300005335 | Bacteria | 1658 |
| 18 | Ga0070666_10457688 | 3300005335 | Unclassified | 922 |
| 19 | Ga0070682_100027836 | 3300005337 | Bacteria | 3395 |
| 20 | Ga0068868_100004436 | 3300005338 | Bacteria | 9841 |
| 21 | Ga0068868_100342321 | 3300005338 | Bacteria | 1279 |
| 22 | Ga0068868_100436393 | 3300005338 | Bacteria | 1136 |
| 23 | Ga0070687_100024647 | 3300005343 | Bacteria | 2875 |
| 24 | Ga0070661_100116834 | 3300005344 | Bacteria | 1995 |
| 25 | Ga0070661_100130912 | 3300005344 | Bacteria | 1884 |
| 26 | Ga0070668_100198194 | 3300005347 | Bacteria | 1648 |
| 27 | Ga0070669_100459579 | 3300005353 | Bacteria | 1050 |
| 28 | Ga0070675_100015141 | 3300005354 | Bacteria | 6090 |
| 29 | Ga0070675_100598423 | 3300005354 | Unclassified | 1000 |
| 30 | Ga0070671_100108254 | 3300005355 | Bacteria | 2334 |
| 31 | Ga0070671_100150318 | 3300005355 | Bacteria | 1966 |
| 32 | Ga0070671_100564073 | 3300005355 | Bacteria | 982 |
| 33 | Ga0070674_100067029 | 3300005356 | Bacteria | 2524 |
| 34 | Ga0070674_100168822 | 3300005356 | Bacteria | 1666 |
| 35 | Ga0070673_100919850 | 3300005364 | Bacteria | 812 |
| 36 | Ga0070688_100121502 | 3300005365 | Bacteria | 1750 |
| 37 | Ga0070659_100251727 | 3300005366 | Bacteria | 1464 |
| 38 | Ga0070667_100116012 | 3300005367 | Bacteria | 2326 |
| 39 | Ga0070667_100170205 | 3300005367 | Bacteria | 1923 |
| 40 | Ga0070667_100842537 | 3300005367 | Bacteria | 852 |
| 41 | Ga0070701_10124602 | 3300005438 | Bacteria | 1456 |
| 42 | Ga0070700_100673121 | 3300005441 | Bacteria | 819 |
| 43 | Ga0070694_100059287 | 3300005444 | Bacteria | 2606 |
| 44 | Ga0070708_100079093 | 3300005445 | Bacteria | 2974 |
| 45 | Ga0070662_100114594 | 3300005457 | Bacteria | 2058 |
| 46 | Ga0070681_10047428 | 3300005458 | Bacteria | 4294 |
| 47 | Ga0068867_100278030 | 3300005459 | Bacteria | 1372 |
| 48 | Ga0070685_10116658 | 3300005466 | Bacteria | 1652 |
| 49 | Ga0070706_100485159 | 3300005467 | Bacteria | 1150 |
| 50 | Ga0070707_100011178 | 3300005468 | Bacteria | 8366 |
| 51 | Ga0070679_100618491 | 3300005530 | Bacteria | 1026 |
| 52 | Ga0070684_100315205 | 3300005535 | Bacteria | 1436 |
| 53 | Ga0070697_100112135 | 3300005536 | Bacteria | 2274 |
| 54 | Ga0070672_100211459 | 3300005543 | Bacteria | 1624 |
| 55 | Ga0070686_100004546 | 3300005544 | Bacteria | 7653 |
| 56 | Ga0070695_100105688 | 3300005545 | Bacteria | 1903 |
| 57 | Ga0070665_100069559 | 3300005548 | Bacteria | 3528 |
| 58 | Ga0070665_100357272 | 3300005548 | Bacteria | 1467 |
| 59 | Ga0070704_100279717 | 3300005549 | Bacteria | 1382 |
| 60 | Ga0068855_100091896 | 3300005563 | Bacteria | 3500 |
| 61 | Ga0070664_100026075 | 3300005564 | Bacteria | 4846 |
| 62 | Ga0070702_100014574 | 3300005615 | Bacteria | 3990 |
| 63 | Ga0068852_100002785 | 3300005616 | Bacteria | 12109 |
| 64 | Ga0068852_100063695 | 3300005616 | Bacteria | 3211 |
| 65 | Ga0068852_100070944 | 3300005616 | Bacteria | 3058 |
| 66 | Ga0068852_100166187 | 3300005616 | Bacteria | 2065 |
| 67 | Ga0068859_100064835 | 3300005617 | Bacteria | 3686 |
| 68 | Ga0068864_100306057 | 3300005618 | Bacteria | 1489 |
| 69 | Ga0068864_100540185 | 3300005618 | Bacteria | 1125 |
| 70 | Ga0068864_100542020 | 3300005618 | Bacteria | 1124 |
| 71 | Ga0068864_101059652 | 3300005618 | Bacteria | 806 |
| 72 | Ga0068866_10069613 | 3300005718 | Bacteria | 1854 |
| 73 | Ga0068851_10041346 | 3300005834 | Bacteria | 2317 |
| 74 | Ga0068870_10410866 | 3300005840 | Bacteria | 883 |
| 75 | Ga0068863_100510250 | 3300005841 | Bacteria | 1185 |
| 76 | Ga0068858_100442177 | 3300005842 | Unclassified | 1252 |
| 77 | Ga0068860_100109236 | 3300005843 | Bacteria | 2643 |
| 78 | Ga0075365_10026177 | 3300006038 | Bacteria | 3700 |
| 79 | Ga0075368_10003236 | 3300006042 | Bacteria | 5419 |
| 80 | Ga0075363_100008627 | 3300006048 | Bacteria | 4756 |
| 81 | Ga0075362_10001349 | 3300006177 | Bacteria | 7765 |
| 82 | Ga0075367_10087013 | 3300006178 | Bacteria | 1897 |
| 83 | Ga0075369_10000773 | 3300006186 | Bacteria | 10452 |
| 84 | Ga0075366_10073850 | 3300006195 | Bacteria | 2033 |
| 85 | Ga0075366_10359663 | 3300006195 | Bacteria | 894 |
| 86 | Ga0097621_100050324 | 3300006237 | Bacteria | 3388 |
| 87 | Ga0075370_10119998 | 3300006353 | Bacteria | 1530 |
| 88 | Ga0097620_100064828 | 3300006931 | Bacteria | 3686 |
| 89 | Ga0105240_10098135 | 3300009093 | Bacteria | 3568 |
| 90 | Ga0111539_10403722 | 3300009094 | Bacteria | 1592 |
| 91 | Ga0111539_10536369 | 3300009094 | Bacteria | 1363 |
| 92 | Ga0105243_10041599 | 3300009148 | Bacteria | 3594 |
| 93 | Ga0105242_10056763 | 3300009176 | Bacteria | 3204 |
| 94 | Ga0105248_10245734 | 3300009177 | Bacteria | 2014 |
| 95 | Ga0105248_10762221 | 3300009177 | Bacteria | 1092 |
| 96 | Ga0105237_10087656 | 3300009545 | Bacteria | 3102 |
| 97 | Ga0105249_10174348 | 3300009553 | Bacteria | 2088 |
| 98 | Ga0105249_10488584 | 3300009553 | Unclassified | 1275 |
| 99 | Ga0105239_10626093 | 3300010375 | Bacteria | 1228 |
| 100 | Ga0157345_1000456 | 3300012498 | Bacteria | 3930 |
| 101 | Ga0157373_10077509 | 3300013100 | Bacteria | 2345 |
| 102 | Ga0157371_10031653 | 3300013102 | Bacteria | 3811 |
| 103 | Ga0157369_11229067 | 3300013105 | Bacteria | 764 |
| 104 | Ga0157374_10141370 | 3300013296 | Bacteria | 2337 |
| 105 | Ga0157374_10382538 | 3300013296 | Bacteria | 1402 |
| 106 | Ga0157378_10004527 | 3300013297 | Bacteria | 12196 |
| 107 | Ga0157378_10085490 | 3300013297 | Bacteria | 2857 |
| 108 | Ga0157378_10454081 | 3300013297 | Unclassified | 1272 |
| 109 | Ga0157378_10671795 | 3300013297 | Bacteria | 1053 |
| 110 | Ga0163162_10018052 | 3300013306 | Bacteria | 6903 |
| 111 | Ga0157372_10186196 | 3300013307 | Bacteria | 2404 |
| 112 | Ga0157375_10012004 | 3300013308 | Bacteria | 7670 |
| 113 | Ga0157375_10196720 | 3300013308 | Bacteria | 2171 |
| 114 | Ga0157375_10284930 | 3300013308 | Unclassified | 1815 |
| 115 | Ga0157375_10547779 | 3300013308 | Bacteria | 1319 |
| 116 | Ga0163163_10562131 | 3300014325 | Unclassified | 1203 |
| 117 | Ga0157380_10045214 | 3300014326 | Bacteria | 3454 |
| 118 | Ga0182008_10078162 | 3300014497 | Bacteria | 1628 |
| 119 | Ga0157377_10047887 | 3300014745 | Bacteria | 2396 |
| 120 | Ga0157377_10342075 | 3300014745 | Bacteria | 1001 |
| 121 | Ga0157379_10448524 | 3300014968 | Bacteria | 1191 |
| 122 | Ga0157379_10900074 | 3300014968 | Bacteria | 839 |
| 123 | Ga0157376_10174901 | 3300014969 | Bacteria | 1958 |
| 124 | Ga0163161_10028980 | 3300017792 | Bacteria | 3934 |
| 125 | Ga0163161_10032386 | 3300017792 | Bacteria | 3731 |
| 126 | Ga0213872_10069145 | 3300021361 | Bacteria | 1593 |
| 127 | Ga0209435_100160 | 3300025206 | Bacteria | 21645 |
| 128 | Ga0209147_100011 | 3300025229 | Bacteria | 702140 |
| 129 | Ga0209437_100259 | 3300025233 | Bacteria | 82489 |
| 130 | Ga0209258_101903 | 3300025242 | Bacteria | 6210 |
| 131 | Ga0209646_1002991 | 3300025246 | Bacteria | 3489 |
| 132 | Ga0209026_1005337 | 3300025250 | Bacteria | 3485 |
| 133 | Ga0209759_1007531 | 3300025256 | Bacteria | 3489 |
| 134 | Ga0209455_1002443 | 3300025272 | Bacteria | 7199 |
| 135 | Ga0207697_10003227 | 3300025315 | Bacteria | 8108 |
| 136 | Ga0207656_10060067 | 3300025321 | Bacteria | 1666 |
| 137 | Ga0207682_10009273 | 3300025893 | Bacteria | 3888 |
| 138 | Ga0207682_10133256 | 3300025893 | Bacteria | 1110 |
| 139 | Ga0207682_10154622 | 3300025893 | Bacteria | 1036 |
| 140 | Ga0207642_10032754 | 3300025899 | Bacteria | 2192 |
| 141 | Ga0207680_10079752 | 3300025903 | Bacteria | 2054 |
| 142 | Ga0207705_10593739 | 3300025909 | Bacteria | 861 |
| 143 | Ga0207707_10016640 | 3300025912 | Bacteria | 6411 |
| 144 | Ga0207695_10001884 | 3300025913 | Bacteria | 32805 |
| 145 | Ga0207662_10002504 | 3300025918 | Bacteria | 9235 |
| 146 | Ga0207649_10085624 | 3300025920 | Bacteria | 2051 |
| 147 | Ga0207649_10268058 | 3300025920 | Bacteria | 1236 |
| 148 | Ga0207652_10530672 | 3300025921 | Bacteria | 1059 |
| 149 | Ga0207646_10043357 | 3300025922 | Bacteria | 4041 |
| 150 | Ga0207650_10002879 | 3300025925 | Bacteria | 11883 |
| 151 | Ga0207650_10055669 | 3300025925 | Bacteria | 2937 |
| 152 | Ga0207650_10076751 | 3300025925 | Bacteria | 2525 |
| 153 | Ga0207650_10372561 | 3300025925 | Bacteria | 1178 |
| 154 | Ga0207659_10002570 | 3300025926 | Bacteria | 10805 |
| 155 | Ga0207659_10340976 | 3300025926 | Bacteria | 1241 |
| 156 | Ga0207644_10042555 | 3300025931 | Bacteria | 3219 |
| 157 | Ga0207644_10068748 | 3300025931 | Bacteria | 2585 |
| 158 | Ga0207644_10244348 | 3300025931 | Bacteria | 1430 |
| 159 | Ga0207706_10055564 | 3300025933 | Bacteria | 3491 |
| 160 | Ga0207686_10080202 | 3300025934 | Bacteria | 2127 |
| 161 | Ga0207669_10005675 | 3300025937 | Bacteria | 5629 |
| 162 | Ga0207669_10133833 | 3300025937 | Bacteria | 1708 |
| 163 | Ga0207691_10044423 | 3300025940 | Bacteria | 4091 |
| 164 | Ga0207691_10098517 | 3300025940 | Bacteria | 2611 |
| 165 | Ga0207691_10108892 | 3300025940 | Unclassified | 2465 |
| 166 | Ga0207711_10167604 | 3300025941 | Bacteria | 1991 |
| 167 | Ga0207711_10208877 | 3300025941 | Bacteria | 1783 |
| 168 | Ga0207661_10015877 | 3300025944 | Bacteria | 5548 |
| 169 | Ga0207679_10000906 | 3300025945 | Bacteria | 18937 |
| 170 | Ga0207667_10071536 | 3300025949 | Bacteria | 3606 |
| 171 | Ga0207651_10010483 | 3300025960 | Bacteria | 5139 |
| 172 | Ga0207668_10025697 | 3300025972 | Bacteria | 3814 |
| 173 | Ga0207658_10259472 | 3300025986 | Bacteria | 1480 |
| 174 | Ga0207677_10012546 | 3300026023 | Bacteria | 4876 |
| 175 | Ga0207677_10089030 | 3300026023 | Bacteria | 2240 |
| 176 | Ga0207703_10133386 | 3300026035 | Bacteria | 2147 |
| 177 | Ga0207703_10264715 | 3300026035 | Bacteria | 1555 |
| 178 | Ga0207708_10064335 | 3300026075 | Bacteria | 2801 |
| 179 | Ga0207641_10004369 | 3300026088 | Bacteria | 12248 |
| 180 | Ga0207641_10595869 | 3300026088 | Bacteria | 1081 |
| 181 | Ga0207648_10074047 | 3300026089 | Bacteria | 2967 |
| 182 | Ga0207648_10301541 | 3300026089 | Bacteria | 1437 |
| 183 | Ga0207676_10002385 | 3300026095 | Bacteria | 13410 |
| 184 | Ga0207676_10175356 | 3300026095 | Bacteria | 1872 |
| 185 | Ga0207675_100034206 | 3300026118 | Bacteria | 4737 |
| 186 | Ga0207683_10149905 | 3300026121 | Bacteria | 2105 |
| 187 | Ga0207683_10337895 | 3300026121 | Bacteria | 1381 |
| 188 | Ga0207698_10010035 | 3300026142 | Bacteria | 6064 |
| 189 | Ga0207698_10121495 | 3300026142 | Bacteria | 2212 |
| 190 | Ga0209281_1019032 | 3300027111 | Bacteria | 1361 |
| 191 | Ga0209371_1000066 | 3300027312 | Bacteria | 212660 |
| 192 | Ga0268266_10037803 | 3300028379 | Bacteria | 4109 |
| 193 | Ga0268266_10223907 | 3300028379 | Bacteria | 1730 |
| 194 | Ga0265324_10011371 | 3300029957 | Bacteria | 3392 |
| 195 | Ga0268256_1000063 | 3300030500 | Bacteria | 212660 |
| 196 | Ga0265328_10004697 | 3300031239 | Bacteria | 5903 |
| 197 | Ga0265328_10025654 | 3300031239 | Bacteria | 2219 |
| 198 | Ga0265320_10101058 | 3300031240 | Bacteria | 1328 |
| 199 | Ga0265331_10008733 | 3300031250 | Bacteria | 5742 |
| 200 | Ga0265331_10016655 | 3300031250 | Bacteria | 3852 |
| 201 | Ga0265331_10062481 | 3300031250 | Bacteria | 1756 |
| 202 | Ga0265327_10000103 | 3300031251 | Bacteria | 185405 |
| 203 | Ga0265327_10000218 | 3300031251 | Bacteria | 116690 |
| 204 | Ga0265327_10001058 | 3300031251 | Bacteria | 38434 |
| 205 | Ga0265327_10016413 | 3300031251 | Bacteria | 4705 |
| 206 | Ga0265327_10038442 | 3300031251 | Bacteria | 2611 |
| 207 | Ga0265314_10000660 | 3300031711 | Bacteria | 42242 |
| 208 | Ga0316578_10022600 | 3300031728 | Bacteria | 3509 |
| 209 | Ga0307516_10363166 | 3300031730 | Unclassified | 1112 |
| 210 | Ga0316580_10028953 | 3300032139 | Bacteria | 1713 |
| 211 | Ga0316574_0122626 | 3300035398 | Bacteria | 1669 |
| 212 | Ga0395899_0001064 | 3300037312 | Bacteria | 24780 |
| 213 | Ga0395899_0002813 | 3300037312 | Bacteria | 14019 |
| 214 | Ga0395900_0015619 | 3300037418 | Bacteria | 7739 |
| 215 | Ga0395900_0461326 | 3300037418 | Bacteria | 1225 |
| 216 | Ga0395898_0028883 | 3300037466 | Bacteria | 5558 |
| 217 | Ga0395905_0000750 | 3300037471 | Bacteria | 42802 |
| 218 | Ga0395905_0892579 | 3300037471 | Bacteria | 792 |
| 219 | Ga0316581_0002910 | 3300037588 | Bacteria | 4192 |
| 220 | Ga0395901_0001718 | 3300038443 | Bacteria | 22613 |
| 221 | Ga0395901_0004958 | 3300038443 | Bacteria | 13431 |
| 222 | Ga0400488_15891 | 3300038741 | Bacteria | 1234 |
| 223 | Ga0400483_214450 | 3300039062 | Bacteria | 1411 |
| 224 | Ga0400483_226661 | 3300039062 | Bacteria | 2883 |
| 225 | Ga0436361_0670593 | 3300039447 | Bacteria | 2843 |
| 226 | Ga0436361_1015159 | 3300039447 | Bacteria | 1954 |
| 227 | Ga0439466_0008447 | 3300041411 | Bacteria | 3883 |
| 228 | Ga0439446_0019148 | 3300042156 | Bacteria | 1922 |
| 229 | Ga0439464_0007227 | 3300042439 | Bacteria | 2902 |
| 230 | Ga0451577_0002441 | 3300042876 | Bacteria | 22169 |
| 231 | Ga0451577_0127201 | 3300042876 | Bacteria | 2284 |
| 232 | Ga0453684_0391191 | 3300044712 | Bacteria | 1559 |
| 233 | Ga0451576_0002261 | 3300045051 | Bacteria | 29427 |
| 234 | Ga0451576_0002688 | 3300045051 | Bacteria | 25898 |
| 235 | Ga0451576_0012479 | 3300045051 | Bacteria | 9541 |
| 236 | Ga0451576_0013409 | 3300045051 | Bacteria | 9170 |
| 237 | Ga0451576_0013632 | 3300045051 | Bacteria | 9086 |
| 238 | Ga0451576_0632452 | 3300045051 | Bacteria | 1124 |
| 239 | Ga0495592_0018613 | 3300046454 | Bacteria | 5286 |
| 240 | Ga0495651_0367503 | 3300046462 | Bacteria | 946 |
| 241 | Ga0495653_0040723 | 3300046463 | Bacteria | 3629 |
| 242 | Ga0495653_0197764 | 3300046463 | Bacteria | 1366 |
| 243 | Ga0495653_0475243 | 3300046463 | Bacteria | 782 |
| 244 | Ga0495585_0006926 | 3300046492 | Bacteria | 6986 |
| 245 | Ga0495585_0087055 | 3300046492 | Bacteria | 1686 |
| 246 | Ga0495607_0004336 | 3300046501 | Bacteria | 10464 |
| 247 | Ga0495607_0027136 | 3300046501 | Bacteria | 3545 |
| 248 | Ga0495607_0031232 | 3300046501 | Bacteria | 3261 |
| 249 | Ga0495606_0000204 | 3300046507 | Bacteria | 103880 |
| 250 | Ga0495606_0081636 | 3300046507 | Bacteria | 2009 |
| 251 | Ga0495608_0001364 | 3300046511 | Bacteria | 17414 |
| 252 | Ga0495618_0084893 | 3300046514 | Bacteria | 2023 |
| 253 | Ga0495643_0030142 | 3300046522 | Bacteria | 3031 |
| 254 | Ga0495644_0095374 | 3300046523 | Bacteria | 1124 |
| 255 | Ga0495648_0208922 | 3300046524 | Bacteria | 971 |
| 256 | Ga0495642_0002416 | 3300046528 | Bacteria | 7612 |
| 257 | Ga0495652_0017149 | 3300046529 | Bacteria | 6466 |
| 258 | Ga0495652_0019609 | 3300046529 | Bacteria | 6021 |
| 259 | Ga0495609_0124872 | 3300046538 | Bacteria | 1105 |
| 260 | Ga0495621_0054443 | 3300046539 | Bacteria | 1438 |
| 261 | Ga0495597_0228108 | 3300046542 | Bacteria | 737 |
| 262 | Ga0495645_0070447 | 3300046543 | Bacteria | 2523 |
| 263 | Ga0495625_0004306 | 3300046660 | Bacteria | 13526 |
| 264 | Ga0495625_0153214 | 3300046660 | Bacteria | 1548 |
| 265 | Ga0495661_0006342 | 3300046665 | Bacteria | 8318 |
| 266 | Ga0495661_0055298 | 3300046665 | Bacteria | 2379 |
| 267 | Ga0495661_0072648 | 3300046665 | Bacteria | 2006 |
| 268 | Ga0495657_0152118 | 3300046675 | Bacteria | 1436 |
| 269 | Ga0495599_0005011 | 3300046678 | Bacteria | 7880 |
| 270 | Ga0495658_0014941 | 3300046683 | Bacteria | 3978 |
| 271 | Ga0495649_0004109 | 3300046694 | Bacteria | 9562 |
| 272 | Ga0495589_0018679 | 3300046794 | Bacteria | 3554 |
| 273 | Ga0495600_0000474 | 3300046809 | Bacteria | 20802 |
| 274 | Ga0495660_0041464 | 3300046810 | Bacteria | 2548 |
| 275 | Ga0495660_0085039 | 3300046810 | Bacteria | 1653 |
| 276 | Ga0495604_0026874 | 3300047317 | Bacteria | 4580 |
| 277 | Ga0495676_0046533 | 3300047321 | Bacteria | 3519 |
| 278 | Ga0495687_001161 | 3300047443 | Bacteria | 25444 |
| 279 | Ga0495679_031216 | 3300047446 | Bacteria | 1720 |
| 280 | Ga0496108_0013170 | 3300048911 | Bacteria | 6741 |
| 281 | Ga0496109_0072012 | 3300048912 | Bacteria | 3174 |
| 282 | Ga0496110_0043222 | 3300048913 | Bacteria | 3934 |
| 283 | Ga0496110_0171279 | 3300048913 | Bacteria | 1970 |
| 284 | Ga0496110_0369626 | 3300048913 | Bacteria | 1307 |
| 285 | Ga0496114_0031822 | 3300048917 | Bacteria | 4339 |
| 286 | Ga0496114_0053862 | 3300048917 | Bacteria | 3354 |
| 287 | Ga0496114_0067401 | 3300048917 | Bacteria | 3003 |
| 288 | Ga0496116_0038021 | 3300048919 | Bacteria | 3348 |
| 289 | Ga0496116_0039765 | 3300048919 | Bacteria | 3246 |
| 290 | Ga0496118_0045940 | 3300048921 | Bacteria | 3402 |
| 291 | Ga0496118_0104700 | 3300048921 | Bacteria | 1898 |
| 292 | Ga0496121_0036776 | 3300048924 | Bacteria | 4358 |
| 293 | Ga0496121_0072747 | 3300048924 | Bacteria | 2759 |
| 294 | Ga0496121_0123094 | 3300048924 | Bacteria | 1955 |
| 295 | Ga0496122_0000261 | 3300048925 | Bacteria | 118793 |
| 296 | Ga0496123_0000218 | 3300048926 | Bacteria | 116615 |
| 297 | Ga0496125_0055026 | 3300048928 | Bacteria | 3246 |
| 298 | Ga0496125_0173102 | 3300048928 | Bacteria | 1448 |
| 299 | Ga0495682_0000573 | 3300049460 | Bacteria | 24941 |
| 300 | Ga0501269_009813 | 3300049766 | Unclassified | 1160 |
| 301 | Ga0501044_0109603 | 3300049823 | Bacteria | 2770 |
| 302 | Ga0501044_0782455 | 3300049823 | Bacteria | 834 |
| 303 | nmdc:mga03683_3943_c1 | 3300050489 | Bacteria | 4857 |
| 304 | nmdc:mga03n38_13668_c1 | 3300050490 | Bacteria | 3091 |
| 305 | nmdc:mga00v17_6216_c1 | 3300050491 | Bacteria | 6334 |
| 306 | nmdc:mga0k408_14025_c1 | 3300050493 | Bacteria | 4406 |
| 307 | nmdc:mga04h51_29164_c1 | 3300050495 | Bacteria | 1727 |
| 308 | nmdc:mga07m45_178267_c1 | 3300050496 | Bacteria | 1236 |
| 309 | nmdc:mga05p37_801504_c1 | 3300050507 | Bacteria | 1030 |
| 310 | nmdc:mga08y16_368019_c1 | 3300050511 | Bacteria | 1475 |
| 311 | nmdc:mga0sz30_17570_c1 | 3300050516 | Bacteria | 2854 |
| 312 | nmdc:mga0sz30_63175_c1 | 3300050516 | Bacteria | 1584 |
| 313 | Ga0495601_0007943 | 3300053077 | Bacteria | 6247 |
| 314 | Ga0500647_0243136 | 3300053091 | Bacteria | 795 |
| 315 | Ga0500641_0044799 | 3300053096 | Bacteria | 1800 |
| 316 | Ga0500572_102940 | 3300053111 | Bacteria | 914 |
| 317 | Ga0500594_0038811 | 3300053118 | Bacteria | 1292 |
| 318 | Ga0500595_003047 | 3300053119 | Bacteria | 7965 |
| 319 | Ga0500618_004443 | 3300053125 | Bacteria | 4484 |
| 320 | Ga0500574_007252 | 3300053141 | Bacteria | 2287 |
| 321 | Ga0500619_000463 | 3300053154 | Bacteria | 7148 |
| 322 | Ga0500634_0064560 | 3300053161 | Bacteria | 1933 |
| 323 | Ga0500649_171071 | 3300053722 | Bacteria | 749 |
| 324 | 2511384997 | 2511231026 | Bacteria | 5225445 |
| 325 | 2511416521 | 2511231031 | Bacteria | 6558529 |
| 326 | 2550693527 | 2548876994 | Bacteria | 4904866 |
| 327 | 2602011022 | 2600255389 | Bacteria | 5275336 |
| 328 | 2644030400 | 2643221603 | Bacteria | 6147767 |
| 329 | 2765568231 | 2765235838 | Bacteria | 5445269 |
| 330 | 2808983550 | 2808606386 | Bacteria | 4471946 |
| 331 | 2809129214 | 2808606415 | Bacteria | 4576710 |
| 332 | 2809149731 | 2808606419 | Bacteria | 4576925 |
| 333 | 2819594522 | 2818991445 | Bacteria | 4955017 |
| 334 | 2839097464 | 2839094727 | Bacteria | 5534556 |
| 335 | 2852619885 | 2852618963 | Bacteria | 4577824 |
| 336 | 2884812433 | 2884811622 | Bacteria | 5552861 |
| 337 | 2884839266 | 2884836552 | Bacteria | 5219991 |
| 338 | 2884855557 | 2884852848 | Bacteria | 5221161 |
| 339 | 2896158936 | 2896154374 | Bacteria | 5221518 |
| 340 | 2912968998 | 2912963787 | Bacteria | 5646108 |
| 341 | 2919497317 | 2919493220 | Bacteria | 4598500 |
| 342 | 2919547462 | 2919543075 | Bacteria | 4728703 |
| 343 | 2969310323 | 2969304461 | Bacteria | 6601805 |
| 344 | 3007255115 | 3007252601 | Bacteria | 4559114 |
| 345 | 3007316434 | 3007315729 | Bacteria | 5076637 |
| 346 | 8056131725 | 8056131705 | Bacteria | 6107031 |
| 347 | Ga0079104_1025026 | |||
| 348 | JGI24749J21850_1014459 | |||
| 349 | JGI25155J39150_1000956 | |||
| 350 | JGI25156J39149_1005912 | |||
| 351 | JGI25162J39368_1005040 | |||
| 352 | JGI25154J39366_1003345 | |||
| 353 | JGI25157J39369_1000773 | |||
| 354 | Ga0055532_1000005 | |||
| 355 | Ga0070658_10103010 | |||
| 356 | Ga0070676_10440132 | |||
| 357 | Ga0070683_100150491 | |||
| 358 | Ga0070690_100069132 | |||
| 359 | Ga0070670_100016361 | |||
| 360 | Ga0070670_100437757 | |||
| 361 | Ga0070677_10010700 | |||
| 362 | Ga0070677_10065994 | |||
| 363 | Ga0070666_10144342 | |||
| 364 | Ga0070666_10457688 | |||
| 365 | Ga0070682_100027836 | |||
| 366 | Ga0068868_100004436 | |||
| 367 | Ga0068868_100342321 | |||
| 368 | Ga0068868_100436393 | |||
| 369 | Ga0070687_100024647 | |||
| 370 | Ga0070661_100116834 | |||
| 371 | Ga0070661_100130912 | |||
| 372 | Ga0070668_100198194 | |||
| 373 | Ga0070669_100459579 | |||
| 374 | Ga0070675_100015141 | |||
| 375 | Ga0070675_100598423 | |||
| 376 | Ga0070671_100108254 | |||
| 377 | Ga0070671_100150318 | |||
| 378 | Ga0070671_100564073 | |||
| 379 | Ga0070674_100067029 | |||
| 380 | Ga0070674_100168822 | |||
| 381 | Ga0070673_100919850 | |||
| 382 | Ga0070688_100121502 | |||
| 383 | Ga0070659_100251727 | |||
| 384 | Ga0070667_100116012 | |||
| 385 | Ga0070667_100170205 | |||
| 386 | Ga0070667_100842537 | |||
| 387 | Ga0070701_10124602 | |||
| 388 | Ga0070700_100673121 | |||
| 389 | Ga0070694_100059287 | |||
| 390 | Ga0070708_100079093 | |||
| 391 | Ga0070662_100114594 | |||
| 392 | Ga0070681_10047428 | |||
| 393 | Ga0068867_100278030 | |||
| 394 | Ga0070685_10116658 | |||
| 395 | Ga0070706_100485159 | |||
| 396 | Ga0070707_100011178 | |||
| 397 | Ga0070679_100618491 | |||
| 398 | Ga0070684_100315205 | |||
| 399 | Ga0070697_100112135 | |||
| 400 | Ga0070672_100211459 | |||
| 401 | Ga0070686_100004546 | |||
| 402 | Ga0070695_100105688 | |||
| 403 | Ga0070665_100069559 | |||
| 404 | Ga0070665_100357272 | |||
| 405 | Ga0070704_100279717 | |||
| 406 | Ga0068855_100091896 | |||
| 407 | Ga0070664_100026075 | |||
| 408 | Ga0070702_100014574 | |||
| 409 | Ga0068852_100002785 | |||
| 410 | Ga0068852_100063695 | |||
| 411 | Ga0068852_100070944 | |||
| 412 | Ga0068852_100166187 | |||
| 413 | Ga0068859_100064835 | |||
| 414 | Ga0068864_100306057 | |||
| 415 | Ga0068864_100540185 | |||
| 416 | Ga0068864_100542020 | |||
| 417 | Ga0068864_101059652 | |||
| 418 | Ga0068866_10069613 | |||
| 419 | Ga0068851_10041346 | |||
| 420 | Ga0068870_10410866 | |||
| 421 | Ga0068863_100510250 | |||
| 422 | Ga0068858_100442177 | |||
| 423 | Ga0068860_100109236 | |||
| 424 | Ga0075365_10026177 | |||
| 425 | Ga0075368_10003236 | |||
| 426 | Ga0075363_100008627 | |||
| 427 | Ga0075362_10001349 | |||
| 428 | Ga0075367_10087013 | |||
| 429 | Ga0075369_10000773 | |||
| 430 | Ga0075366_10073850 | |||
| 431 | Ga0075366_10359663 | |||
| 432 | Ga0097621_100050324 | |||
| 433 | Ga0075370_10119998 | |||
| 434 | Ga0097620_100064828 | |||
| 435 | Ga0105240_10098135 | |||
| 436 | Ga0111539_10403722 | |||
| 437 | Ga0111539_10536369 | |||
| 438 | Ga0105243_10041599 | |||
| 439 | Ga0105242_10056763 | |||
| 440 | Ga0105248_10245734 | |||
| 441 | Ga0105248_10762221 | |||
| 442 | Ga0105237_10087656 | |||
| 443 | Ga0105249_10174348 | |||
| 444 | Ga0105249_10488584 | |||
| 445 | Ga0105239_10626093 | |||
| 446 | Ga0157345_1000456 | |||
| 447 | Ga0157373_10077509 | |||
| 448 | Ga0157371_10031653 | |||
| 449 | Ga0157369_11229067 | |||
| 450 | Ga0157374_10141370 | |||
| 451 | Ga0157374_10382538 | |||
| 452 | Ga0157378_10004527 | |||
| 453 | Ga0157378_10085490 | |||
| 454 | Ga0157378_10454081 | |||
| 455 | Ga0157378_10671795 | |||
| 456 | Ga0163162_10018052 | |||
| 457 | Ga0157372_10186196 | |||
| 458 | Ga0157375_10012004 | |||
| 459 | Ga0157375_10196720 | |||
| 460 | Ga0157375_10284930 | |||
| 461 | Ga0157375_10547779 | |||
| 462 | Ga0163163_10562131 | |||
| 463 | Ga0157380_10045214 | |||
| 464 | Ga0182008_10078162 | |||
| 465 | Ga0157377_10047887 | |||
| 466 | Ga0157377_10342075 | |||
| 467 | Ga0157379_10448524 | |||
| 468 | Ga0157379_10900074 | |||
| 469 | Ga0157376_10174901 | |||
| 470 | Ga0163161_10028980 | |||
| 471 | Ga0163161_10032386 | |||
| 472 | Ga0213872_10069145 | |||
| 473 | Ga0209435_100160 | |||
| 474 | Ga0209147_100011 | |||
| 475 | Ga0209437_100259 | |||
| 476 | Ga0209258_101903 | |||
| 477 | Ga0209646_1002991 | |||
| 478 | Ga0209026_1005337 | |||
| 479 | Ga0209759_1007531 | |||
| 480 | Ga0209455_1002443 | |||
| 481 | Ga0207697_10003227 | |||
| 482 | Ga0207656_10060067 | |||
| 483 | Ga0207682_10009273 | |||
| 484 | Ga0207682_10133256 | |||
| 485 | Ga0207682_10154622 | |||
| 486 | Ga0207642_10032754 | |||
| 487 | Ga0207680_10079752 | |||
| 488 | Ga0207705_10593739 | |||
| 489 | Ga0207707_10016640 | |||
| 490 | Ga0207695_10001884 | |||
| 491 | Ga0207662_10002504 | |||
| 492 | Ga0207649_10085624 | |||
| 493 | Ga0207649_10268058 | |||
| 494 | Ga0207652_10530672 | |||
| 495 | Ga0207646_10043357 | |||
| 496 | Ga0207650_10002879 | |||
| 497 | Ga0207650_10055669 | |||
| 498 | Ga0207650_10076751 | |||
| 499 | Ga0207650_10372561 | |||
| 500 | Ga0207659_10002570 | |||
| 501 | Ga0207659_10340976 | |||
| 502 | Ga0207644_10042555 | |||
| 503 | Ga0207644_10068748 | |||
| 504 | Ga0207644_10244348 | |||
| 505 | Ga0207706_10055564 | |||
| 506 | Ga0207686_10080202 | |||
| 507 | Ga0207669_10005675 | |||
| 508 | Ga0207669_10133833 | |||
| 509 | Ga0207691_10044423 | |||
| 510 | Ga0207691_10098517 | |||
| 511 | Ga0207691_10108892 | |||
| 512 | Ga0207711_10167604 | |||
| 513 | Ga0207711_10208877 | |||
| 514 | Ga0207661_10015877 | |||
| 515 | Ga0207679_10000906 | |||
| 516 | Ga0207667_10071536 | |||
| 517 | Ga0207651_10010483 | |||
| 518 | Ga0207668_10025697 | |||
| 519 | Ga0207658_10259472 | |||
| 520 | Ga0207677_10012546 | |||
| 521 | Ga0207677_10089030 | |||
| 522 | Ga0207703_10133386 | |||
| 523 | Ga0207703_10264715 | |||
| 524 | Ga0207708_10064335 | |||
| 525 | Ga0207641_10004369 | |||
| 526 | Ga0207641_10595869 | |||
| 527 | Ga0207648_10074047 | |||
| 528 | Ga0207648_10301541 | |||
| 529 | Ga0207676_10002385 | |||
| 530 | Ga0207676_10175356 | |||
| 531 | Ga0207675_100034206 | |||
| 532 | Ga0207683_10149905 | |||
| 533 | Ga0207683_10337895 | |||
| 534 | Ga0207698_10010035 | |||
| 535 | Ga0207698_10121495 | |||
| 536 | Ga0209281_1019032 | |||
| 537 | Ga0209371_1000066 | |||
| 538 | Ga0268266_10037803 | |||
| 539 | Ga0268266_10223907 | |||
| 540 | Ga0265324_10011371 | |||
| 541 | Ga0268256_1000063 | |||
| 542 | Ga0265328_10004697 | |||
| 543 | Ga0265328_10025654 | |||
| 544 | Ga0265320_10101058 | |||
| 545 | Ga0265331_10008733 | |||
| 546 | Ga0265331_10016655 | |||
| 547 | Ga0265331_10062481 | |||
| 548 | Ga0265327_10000103 | |||
| 549 | Ga0265327_10000218 | |||
| 550 | Ga0265327_10001058 | |||
| 551 | Ga0265327_10016413 | |||
| 552 | Ga0265327_10038442 | |||
| 553 | Ga0265314_10000660 | |||
| 554 | Ga0316578_10022600 | |||
| 555 | Ga0307516_10363166 | |||
| 556 | Ga0316580_10028953 | |||
| 557 | Ga0316574_0122626 | |||
| 558 | Ga0395899_0001064 | |||
| 559 | Ga0395899_0002813 | |||
| 560 | Ga0395900_0015619 | |||
| 561 | Ga0395900_0461326 | |||
| 562 | Ga0395898_0028883 | |||
| 563 | Ga0395905_0000750 | |||
| 564 | Ga0395905_0892579 | |||
| 565 | Ga0316581_0002910 | |||
| 566 | Ga0395901_0001718 | |||
| 567 | Ga0395901_0004958 | |||
| 568 | Ga0400488_15891 | |||
| 569 | Ga0400483_214450 | |||
| 570 | Ga0400483_226661 | |||
| 571 | Ga0436361_0670593 | |||
| 572 | Ga0436361_1015159 | |||
| 573 | Ga0439466_0008447 | |||
| 574 | Ga0439446_0019148 | |||
| 575 | Ga0439464_0007227 | |||
| 576 | Ga0451577_0002441 | |||
| 577 | Ga0451577_0127201 | |||
| 578 | Ga0453684_0391191 | |||
| 579 | Ga0451576_0002261 | |||
| 580 | Ga0451576_0002688 | |||
| 581 | Ga0451576_0012479 | |||
| 582 | Ga0451576_0013409 | |||
| 583 | Ga0451576_0013632 | |||
| 584 | Ga0451576_0632452 | |||
| 585 | Ga0495592_0018613 | |||
| 586 | Ga0495651_0367503 | |||
| 587 | Ga0495653_0040723 | |||
| 588 | Ga0495653_0197764 | |||
| 589 | Ga0495653_0475243 | |||
| 590 | Ga0495585_0006926 | |||
| 591 | Ga0495585_0087055 | |||
| 592 | Ga0495607_0004336 | |||
| 593 | Ga0495607_0027136 | |||
| 594 | Ga0495607_0031232 | |||
| 595 | Ga0495606_0000204 | |||
| 596 | Ga0495606_0081636 | |||
| 597 | Ga0495608_0001364 | |||
| 598 | Ga0495618_0084893 | |||
| 599 | Ga0495643_0030142 | |||
| 600 | Ga0495644_0095374 | |||
| 601 | Ga0495648_0208922 | |||
| 602 | Ga0495642_0002416 | |||
| 603 | Ga0495652_0017149 | |||
| 604 | Ga0495652_0019609 | |||
| 605 | Ga0495609_0124872 | |||
| 606 | Ga0495621_0054443 | |||
| 607 | Ga0495597_0228108 | |||
| 608 | Ga0495645_0070447 | |||
| 609 | Ga0495625_0004306 | |||
| 610 | Ga0495625_0153214 | |||
| 611 | Ga0495661_0006342 | |||
| 612 | Ga0495661_0055298 | |||
| 613 | Ga0495661_0072648 | |||
| 614 | Ga0495657_0152118 | |||
| 615 | Ga0495599_0005011 | |||
| 616 | Ga0495658_0014941 | |||
| 617 | Ga0495649_0004109 | |||
| 618 | Ga0495589_0018679 | |||
| 619 | Ga0495600_0000474 | |||
| 620 | Ga0495660_0041464 | |||
| 621 | Ga0495660_0085039 | |||
| 622 | Ga0495604_0026874 | |||
| 623 | Ga0495676_0046533 | |||
| 624 | Ga0495687_001161 | |||
| 625 | Ga0495679_031216 | |||
| 626 | Ga0496108_0013170 | |||
| 627 | Ga0496109_0072012 | |||
| 628 | Ga0496110_0043222 | |||
| 629 | Ga0496110_0171279 | |||
| 630 | Ga0496110_0369626 | |||
| 631 | Ga0496114_0031822 | |||
| 632 | Ga0496114_0053862 | |||
| 633 | Ga0496114_0067401 | |||
| 634 | Ga0496116_0038021 | |||
| 635 | Ga0496116_0039765 | |||
| 636 | Ga0496118_0045940 | |||
| 637 | Ga0496118_0104700 | |||
| 638 | Ga0496121_0036776 | |||
| 639 | Ga0496121_0072747 | |||
| 640 | Ga0496121_0123094 | |||
| 641 | Ga0496122_0000261 | |||
| 642 | Ga0496123_0000218 | |||
| 643 | Ga0496125_0055026 | |||
| 644 | Ga0496125_0173102 | |||
| 645 | Ga0495682_0000573 | |||
| 646 | Ga0501269_009813 | |||
| 647 | Ga0501044_0109603 | |||
| 648 | Ga0501044_0782455 | |||
| 649 | nmdc:mga03683_3943_c1 | |||
| 650 | nmdc:mga03n38_13668_c1 | |||
| 651 | nmdc:mga00v17_6216_c1 | |||
| 652 | nmdc:mga0k408_14025_c1 | |||
| 653 | nmdc:mga04h51_29164_c1 | |||
| 654 | nmdc:mga07m45_178267_c1 | |||
| 655 | nmdc:mga05p37_801504_c1 | |||
| 656 | nmdc:mga08y16_368019_c1 | |||
| 657 | nmdc:mga0sz30_17570_c1 | |||
| 658 | nmdc:mga0sz30_63175_c1 | |||
| 659 | Ga0495601_0007943 | |||
| 660 | Ga0500647_0243136 | |||
| 661 | Ga0500641_0044799 | |||
| 662 | Ga0500572_102940 | |||
| 663 | Ga0500594_0038811 | |||
| 664 | Ga0500595_003047 | |||
| 665 | Ga0500618_004443 | |||
| 666 | Ga0500574_007252 | |||
| 667 | Ga0500619_000463 | |||
| 668 | Ga0500634_0064560 | |||
| 669 | Ga0500649_171071 | |||
| 670 | 2511384997 | |||
| 671 | 2511416521 | |||
| 672 | 2550693527 | |||
| 673 | 2602011022 | |||
| 674 | 2644030400 | |||
| 675 | 2765568231 | |||
| 676 | 2808983550 | |||
| 677 | 2809129214 | |||
| 678 | 2809149731 | |||
| 679 | 2819594522 | |||
| 680 | 2839097464 | |||
| 681 | 2852619885 | |||
| 682 | 2884812433 | |||
| 683 | 2884839266 | |||
| 684 | 2884855557 | |||
| 685 | 2896158936 | |||
| 686 | 2912968998 | |||
| 687 | 2919497317 | |||
| 688 | 2919547462 | |||
| 689 | 2969310323 | |||
| 690 | 3007255115 | |||
| 691 | 3007316434 | |||
| 692 | 8056131725 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2qlc-assembly5.cif.gz_E | the crystal structure of dna repair protein radc from chlorobium tepidum tls | 0.9019 | 109 | 224 |
| 2qlc-assembly5.cif.gz_E | the crystal structure of dna repair protein radc from chlorobium tepidum tls | 0.8411 | 109 | 224 |
| 6ui4-assembly1.cif.gz_A | crystal structure of phenamacril-bound f. graminearum myosin i | 0.8333 | 121 | 142 |
| 1w7j-assembly1.cif.gz_A | crystal structure of myosin v motor with essential light chain + adp-befx - near rigor | 0.7935 | 121 | 142 |
| 7dhw-assembly1.cif.gz_A | crystal structure of myosin-xi motor domain in complex with adp-alf4 | 0.7737 | 121 | 142 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P25531_100_221_3.40.140.10 | Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 | 0.9808 | 105 | 222 | 3.40.140.10 |
| af_Q47685_35_158_3.40.140.10 | Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 | 0.9707 | 102 | 224 | 3.40.140.10 |
| af_Q47685_35_158_3.40.140.10 | Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 | 0.9554 | 102 | 224 | 3.40.140.10 |
| af_P31337_89_213_3.40.140.10 | Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 | 0.9492 | 106 | 222 | 3.40.140.10 |
| af_P25531_100_221_3.40.140.10 | Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 | 0.9414 | 105 | 222 | 3.40.140.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3B8P1I9-F1-model_v4 | UPF0758 domain-containing protein | 0.9894 | 1 | 87 |
|
| AF-A0A315EF61-F1-model_v4 | MPN domain-containing protein | 0.9891 | 85 | 224 |
GO:0006508
GO:0008237 GO:0046872 |
| AF-A0A522VXK9-F1-model_v4 | DNA repair protein RadC | 0.9873 | 70 | 224 |
GO:0006508
GO:0008237 GO:0046872 |
| AF-A0A645FQ93-F1-model_v4 | MPN domain-containing protein | 0.9873 | 151 | 224 |
GO:0006508
GO:0008237 GO:0046872 |
| AF-A0A0C5GSX6-F1-model_v4 | Uncharacterized protein | 0.9871 | 120 | 224 |
GO:0006508
GO:0008237 GO:0046872 |