F416565

General Info

Members Datasets Scaffolds Average Seq Length
345 198 690 280

Family's Representative Sequence

Representative Sequence 3300050493|nmdc:mga0k408_289828_c1|nmdc:mga0k408_289828_c1_125_952
Length 263
Sequence MKKAKRPVDPLHAPHETWHTALTCIEPNKILVRGYPLDEIMGRLTFGEAIYLLLMGEVPSPGIGSLMEAILVSFIDHGVTPPSTQAARHTATTGAPLRACVAAGVLGFGRYHGGDIESCMQFLDQGLELVRKGVSYREHEPVPGFGHRFHTRDPRAARLFQMALELEIDGSHIQMIRAVEYVMADRPDGQALPVNIDGAIAAVCGDIGIPPEIANALFIISRVPGIAAQAQEERARQQPMRPIDPKDSVYDGATQRRLPGKRR

Samples

Sample ID Description Type Environment
1 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
121 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
122 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
123 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
124 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
125 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
126 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
127 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
128 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
129 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
130 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
131 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
132 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
133 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
134 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
136 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
137 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
138 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
139 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
140 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
141 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
142 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
143 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
144 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
145 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
146 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
147 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
148 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
149 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
150 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
151 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
152 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
153 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
154 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
155 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
156 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
157 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
158 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
159 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
160 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
161 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
162 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
163 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
164 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
171 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
172 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
173 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
174 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
175 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
176 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
177 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
178 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
179 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
180 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
181 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
182 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
183 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
184 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
185 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
186 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
187 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
188 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
189 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
190 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
191 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
192 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
193 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
194 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
195 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
196 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
197 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
198 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.51
Nodule 0
Rhizoplane 5.8
Rhizosphere 88.7
Stem 0
Stem Tuber 0
Unclassified 7.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0k408_289828_c1 3300050493 Bacteria 977
2 JGI24743J22301_10016073 3300001991 Bacteria 1393
3 Ga0065712_10075330 3300005290 Bacteria 3873
4 Ga0065712_10096120 3300005290 Bacteria 2194
5 Ga0065712_10117795 3300005290 Unclassified 1715
6 Ga0065712_10155593 3300005290 Bacteria 1337
7 Ga0065715_10104105 3300005293 Bacteria 2986
8 Ga0065715_10207235 3300005293 Bacteria 1331
9 Ga0065707_10110343 3300005295 Bacteria 2434
10 Ga0070676_10008683 3300005328 Bacteria 5480
11 Ga0070683_100001984 3300005329 Bacteria 16033
12 Ga0070683_100189831 3300005329 Bacteria 1951
13 Ga0070670_100037269 3300005331 Bacteria 4184
14 Ga0070670_100353942 3300005331 Bacteria 1290
15 Ga0070666_10090874 3300005335 Bacteria 2097
16 Ga0070666_10172119 3300005335 Bacteria 1516
17 Ga0070680_100096656 3300005336 Bacteria 2449
18 Ga0070682_100038422 3300005337 Bacteria 2936
19 Ga0070687_100001846 3300005343 Bacteria 7671
20 Ga0070661_100100961 3300005344 Bacteria 2146
21 Ga0070661_100258296 3300005344 Bacteria 1346
22 Ga0070661_100284247 3300005344 Unclassified 1284
23 Ga0070668_100034159 3300005347 Bacteria 3875
24 Ga0070668_100196849 3300005347 Bacteria 1653
25 Ga0070669_100001909 3300005353 Bacteria 15042
26 Ga0070669_100172174 3300005353 Bacteria 1688
27 Ga0070675_100363599 3300005354 Bacteria 1285
28 Ga0070671_100051290 3300005355 Bacteria 3431
29 Ga0070671_100066206 3300005355 Bacteria 3011
30 Ga0070674_100038507 3300005356 Bacteria 3222
31 Ga0070674_100039796 3300005356 Bacteria 3177
32 Ga0070674_100079852 3300005356 Bacteria 2335
33 Ga0070674_100109693 3300005356 Bacteria 2024
34 Ga0070673_100013830 3300005364 Bacteria 5600
35 Ga0070673_100067122 3300005364 Bacteria 2867
36 Ga0070688_100085116 3300005365 Bacteria 2054
37 Ga0070709_10039051 3300005434 Bacteria 2911
38 Ga0070713_100026532 3300005436 Bacteria 4550
39 Ga0070711_100369626 3300005439 Bacteria 1157
40 Ga0070705_100013044 3300005440 Bacteria 4241
41 Ga0070700_100102213 3300005441 Bacteria 1890
42 Ga0070663_100051605 3300005455 Bacteria 2931
43 Ga0070678_100072163 3300005456 Bacteria 2587
44 Ga0070678_100308159 3300005456 Bacteria 1348
45 Ga0070662_100225177 3300005457 Bacteria 1498
46 Ga0068867_100127039 3300005459 Unclassified 1977
47 Ga0070699_100094154 3300005518 Bacteria 2622
48 Ga0070679_100314698 3300005530 Bacteria 1515
49 Ga0070684_100008525 3300005535 Bacteria 8021
50 Ga0070684_100043925 3300005535 Bacteria 3862
51 Ga0070672_100033262 3300005543 Bacteria 3903
52 Ga0070695_100046217 3300005545 Bacteria 2778
53 Ga0070693_100020238 3300005547 Bacteria 3505
54 Ga0070693_100041743 3300005547 Bacteria 2582
55 Ga0070704_100258210 3300005549 Bacteria 1434
56 Ga0070704_100310379 3300005549 Bacteria 1318
57 Ga0070664_100000331 3300005564 Bacteria 34351
58 Ga0070664_100095526 3300005564 Bacteria 2578
59 Ga0068857_100017602 3300005577 Bacteria 6266
60 Ga0068854_100015445 3300005578 Bacteria 5057
61 Ga0068856_100520125 3300005614 Bacteria 1211
62 Ga0070702_100020705 3300005615 Bacteria 3449
63 Ga0068852_100075227 3300005616 Bacteria 2978
64 Ga0068852_100189198 3300005616 Bacteria 1941
65 Ga0068852_100245127 3300005616 Bacteria 1714
66 Ga0068864_100051315 3300005618 Bacteria 3553
67 Ga0068864_100434442 3300005618 Bacteria 1253
68 Ga0068866_10030071 3300005718 Bacteria 2603
69 Ga0068861_100067983 3300005719 Bacteria 2752
70 Ga0068870_10009671 3300005840 Bacteria 4395
71 Ga0068863_100147426 3300005841 Bacteria 2251
72 Ga0068862_100185246 3300005844 Bacteria 1870
73 Ga0068862_100299437 3300005844 Bacteria 1479
74 Ga0075365_10040666 3300006038 Bacteria 3033
75 Ga0075368_10018705 3300006042 Bacteria 2607
76 Ga0075364_10000556 3300006051 Bacteria 19124
77 Ga0075364_10043123 3300006051 Bacteria 2932
78 Ga0075364_10061456 3300006051 Unclassified 2464
79 Ga0075362_10002939 3300006177 Bacteria 5848
80 Ga0075367_10012934 3300006178 Bacteria 4470
81 Ga0075366_10005102 3300006195 Bacteria 7099
82 Ga0075366_10016428 3300006195 Bacteria 4254
83 Ga0075366_10201337 3300006195 Bacteria 1211
84 Ga0075370_10010449 3300006353 Bacteria 4855
85 Ga0075428_100004081 3300006844 Bacteria 16059
86 Ga0075428_100005960 3300006844 Bacteria 13542
87 Ga0075428_100009372 3300006844 Bacteria 10860
88 Ga0075430_100014526 3300006846 Bacteria 6708
89 Ga0075430_100018817 3300006846 Bacteria 5875
90 Ga0075430_100030705 3300006846 Bacteria 4564
91 Ga0075430_100033577 3300006846 Bacteria 4355
92 Ga0075430_100407679 3300006846 Bacteria 1122
93 Ga0075431_100042835 3300006847 Bacteria 4670
94 Ga0075431_100059749 3300006847 Bacteria 3934
95 Ga0075431_100126825 3300006847 Bacteria 2633
96 Ga0075431_100306929 3300006847 Bacteria 1602
97 Ga0075433_10169425 3300006852 Bacteria 1943
98 Ga0075434_100029438 3300006871 Bacteria 5404
99 Ga0075434_100561872 3300006871 Bacteria 1160
100 Ga0075429_100015451 3300006880 Bacteria 6616
101 Ga0075429_100033307 3300006880 Bacteria 4477
102 Ga0075429_100102388 3300006880 Bacteria 2500
103 Ga0075429_100212255 3300006880 Bacteria 1696
104 Ga0068865_100215342 3300006881 Bacteria 1499
105 Ga0075435_100107678 3300007076 Bacteria 2315
106 Ga0075435_100464635 3300007076 Bacteria 1092
107 Ga0105240_10019207 3300009093 Bacteria 9135
108 Ga0105240_10395935 3300009093 Bacteria 1557
109 Ga0111539_10000245 3300009094 Bacteria 65047
110 Ga0111539_10000335 3300009094 Bacteria 57807
111 Ga0111539_10113096 3300009094 Bacteria 3184
112 Ga0111539_10288943 3300009094 Bacteria 1908
113 Ga0111539_10678054 3300009094 Bacteria 1200
114 Ga0111539_10716705 3300009094 Unclassified 1164
115 Ga0111539_10770292 3300009094 Bacteria 1120
116 Ga0111539_10924028 3300009094 Unclassified 1015
117 Ga0114129_10001599 3300009147 Bacteria 30786
118 Ga0114129_10001743 3300009147 Bacteria 29593
119 Ga0114129_10003587 3300009147 Bacteria 21849
120 Ga0114129_10004642 3300009147 Bacteria 19389
121 Ga0114129_10004905 3300009147 Bacteria 18881
122 Ga0114129_10089988 3300009147 Bacteria 4254
123 Ga0105243_10018248 3300009148 Bacteria 5312
124 Ga0105241_10089086 3300009174 Bacteria 2431
125 Ga0105242_10053131 3300009176 Bacteria 3307
126 Ga0105248_10069651 3300009177 Bacteria 3949
127 Ga0105249_10000497 3300009553 Bacteria 36352
128 Ga0157370_10174642 3300013104 Unclassified 1997
129 Ga0157378_10206331 3300013297 Bacteria 1861
130 Ga0157378_10587717 3300013297 Bacteria 1123
131 Ga0157372_10103127 3300013307 Bacteria 3259
132 Ga0157372_10439120 3300013307 Bacteria 1521
133 Ga0157375_10157949 3300013308 Unclassified 2408
134 Ga0163163_10266343 3300014325 Bacteria 1765
135 Ga0207697_10001000 3300025315 Bacteria 15835
136 Ga0207697_10017612 3300025315 Bacteria 2935
137 Ga0207642_10076516 3300025899 Bacteria 1611
138 Ga0207642_10085373 3300025899 Bacteria 1545
139 Ga0207680_10098427 3300025903 Bacteria 1875
140 Ga0207647_10149931 3300025904 Bacteria 1363
141 Ga0207699_10048358 3300025906 Bacteria 2498
142 Ga0207645_10022660 3300025907 Bacteria 4083
143 Ga0207695_10054575 3300025913 Bacteria 4171
144 Ga0207660_10047045 3300025917 Bacteria 3048
145 Ga0207662_10066134 3300025918 Bacteria 2178
146 Ga0207649_10318011 3300025920 Unclassified 1143
147 Ga0207652_10040505 3300025921 Bacteria 3957
148 Ga0207652_10127791 3300025921 Bacteria 2265
149 Ga0207681_10015283 3300025923 Bacteria 4786
150 Ga0207681_10109904 3300025923 Bacteria 2003
151 Ga0207681_10183924 3300025923 Bacteria 1594
152 Ga0207681_10196056 3300025923 Bacteria 1548
153 Ga0207694_10206082 3300025924 Bacteria 1601
154 Ga0207650_10007409 3300025925 Bacteria 7475
155 Ga0207650_10053711 3300025925 Bacteria 2987
156 Ga0207650_10159431 3300025925 Bacteria 1786
157 Ga0207659_10520573 3300025926 Bacteria 1008
158 Ga0207700_10017755 3300025928 Bacteria 4760
159 Ga0207644_10027744 3300025931 Bacteria 3913
160 Ga0207644_10111894 3300025931 Bacteria 2066
161 Ga0207690_10192835 3300025932 Bacteria 1542
162 Ga0207706_10160951 3300025933 Bacteria 1973
163 Ga0207709_10122423 3300025935 Bacteria 1759
164 Ga0207669_10030777 3300025937 Bacteria 2988
165 Ga0207669_10144578 3300025937 Bacteria 1656
166 Ga0207669_10316470 3300025937 Unclassified 1192
167 Ga0207691_10022101 3300025940 Bacteria 6002
168 Ga0207711_10042251 3300025941 Bacteria 3884
169 Ga0207711_10281601 3300025941 Bacteria 1531
170 Ga0207711_10553417 3300025941 Unclassified 1073
171 Ga0207689_10261003 3300025942 Bacteria 1433
172 Ga0207661_10310073 3300025944 Bacteria 1416
173 Ga0207679_10001280 3300025945 Bacteria 15885
174 Ga0207679_10162281 3300025945 Bacteria 1831
175 Ga0207679_10195671 3300025945 Bacteria 1685
176 Ga0207651_10007840 3300025960 Bacteria 5715
177 Ga0207651_10458047 3300025960 Bacteria 1095
178 Ga0207712_10009554 3300025961 Bacteria 6139
179 Ga0207640_10063006 3300025981 Bacteria 2462
180 Ga0207703_10035580 3300026035 Bacteria 3957
181 Ga0207678_10071836 3300026067 Bacteria 2967
182 Ga0207678_10583775 3300026067 Bacteria 979
183 Ga0207708_10082420 3300026075 Bacteria 2473
184 Ga0207702_10181219 3300026078 Bacteria 1940
185 Ga0207641_10349377 3300026088 Bacteria 1409
186 Ga0207641_10357320 3300026088 Bacteria 1394
187 Ga0207648_10068352 3300026089 Unclassified 3095
188 Ga0207676_10101711 3300026095 Bacteria 2384
189 Ga0207674_10026474 3300026116 Bacteria 6157
190 Ga0207675_100048478 3300026118 Bacteria 3965
191 Ga0207675_100094050 3300026118 Bacteria 2819
192 Ga0207683_10018664 3300026121 Bacteria 5919
193 Ga0207683_10350608 3300026121 Bacteria 1355
194 Ga0207683_10378227 3300026121 Bacteria 1301
195 Ga0207698_10204806 3300026142 Unclassified 1770
196 Ga0207428_10004422 3300027907 Bacteria 13377
197 Ga0207428_10005394 3300027907 Bacteria 11926
198 Ga0207428_10048187 3300027907 Bacteria 3419
199 Ga0268265_10018574 3300028380 Bacteria 4821
200 Ga0268265_10847518 3300028380 Unclassified 894
201 Ga0268264_10054732 3300028381 Bacteria 3332
202 Ga0268264_10893103 3300028381 Bacteria 892
203 Ga0307408_100006970 3300031548 Bacteria 7479
204 Ga0307408_100017954 3300031548 Bacteria 4744
205 Ga0307408_100064110 3300031548 Bacteria 2690
206 Ga0307408_100078266 3300031548 Bacteria 2464
207 Ga0307408_100399900 3300031548 Bacteria 1179
208 Ga0307405_10156710 3300031731 Bacteria 1608
209 Ga0307405_10295505 3300031731 Bacteria 1226
210 Ga0307413_10044217 3300031824 Bacteria 2631
211 Ga0307413_10073075 3300031824 Unclassified 2167
212 Ga0307410_10035172 3300031852 Bacteria 3251
213 Ga0307410_10230079 3300031852 Bacteria 1431
214 Ga0307406_10161216 3300031901 Bacteria 1612
215 Ga0307406_10365000 3300031901 Bacteria 1133
216 Ga0307407_10307034 3300031903 Unclassified 1108
217 Ga0307412_10049468 3300031911 Bacteria 2770
218 Ga0307412_10142531 3300031911 Bacteria 1757
219 Ga0307409_100043612 3300031995 Bacteria 3370
220 Ga0307409_100488018 3300031995 Bacteria 1197
221 Ga0307416_100016171 3300032002 Bacteria 5176
222 Ga0307416_100028914 3300032002 Bacteria 4131
223 Ga0307416_100042450 3300032002 Bacteria 3550
224 Ga0307416_100085686 3300032002 Unclassified 2682
225 Ga0307416_100209411 3300032002 Bacteria 1858
226 Ga0307416_100947004 3300032002 Bacteria 963
227 Ga0307415_100135646 3300032126 Bacteria 1871
228 Ga0307415_100307831 3300032126 Bacteria 1315
229 Ga0373936_0140083 3300035113 Bacteria 1044
230 Ga0373955_0117686 3300035172 Bacteria 1542
231 Ga0373961_0033869 3300035241 Bacteria 1441
232 Ga0373947_0020222 3300035725 Bacteria 3843
233 Ga0373947_0105462 3300035725 Bacteria 1775
234 Ga0373937_0004240 3300036401 Bacteria 12157
235 Ga0373937_0714968 3300036401 Bacteria 949
236 Ga0373925_0007232 3300037068 Bacteria 8116
237 Ga0439453_0008840 3300041408 Bacteria 1628
238 Ga0439445_0017863 3300042004 Unclassified 1756
239 Ga0439462_0033269 3300042015 Unclassified 1367
240 Ga0450923_004608 3300042125 Bacteria 2170
241 Ga0450896_000914 3300042133 Bacteria 3406
242 Ga0450908_005580 3300042184 Bacteria 2410
243 Ga0439434_0086196 3300042435 Bacteria 1001
244 Ga0439435_0032487 3300042436 Bacteria 1424
245 Ga0439435_0039101 3300042436 Bacteria 1321
246 Ga0439435_0061969 3300042436 Bacteria 1091
247 Ga0439435_0076329 3300042436 Bacteria 999
248 Ga0439435_0110279 3300042436 Bacteria 853
249 Ga0439444_0032434 3300042437 Unclassified 988
250 Ga0439464_0010630 3300042439 Bacteria 2430
251 Ga0439464_0067231 3300042439 Bacteria 1056
252 Ga0439460_0059749 3300042461 Bacteria 1161
253 Ga0450918_007444 3300042531 Bacteria 1936
254 Ga0439440_0005637 3300042993 Bacteria 2490
255 Ga0453684_0268493 3300044712 Unclassified 1951
256 Ga0495594_0288607 3300046499 Bacteria 935
257 Ga0495613_0130744 3300046689 Bacteria 1798
258 Ga0496101_0090840 3300048904 Bacteria 2272
259 Ga0496101_0556415 3300048904 Unclassified 907
260 Ga0496102_0004092 3300048905 Bacteria 12360
261 Ga0496104_0021633 3300048907 Bacteria 5906
262 Ga0496105_0245792 3300048908 Bacteria 1451
263 Ga0496106_0130434 3300048909 Bacteria 1971
264 Ga0496108_0000781 3300048911 Bacteria 24858
265 Ga0496108_0079878 3300048911 Bacteria 2770
266 Ga0496109_0001270 3300048912 Bacteria 20925
267 Ga0496110_0002509 3300048913 Bacteria 13783
268 Ga0496110_0054356 3300048913 Bacteria 3522
269 Ga0496111_0019566 3300048914 Bacteria 4706
270 Ga0496111_0179643 3300048914 Bacteria 1573
271 Ga0496112_0000228 3300048915 Bacteria 36314
272 Ga0496112_0023336 3300048915 Bacteria 5910
273 Ga0496112_0099371 3300048915 Bacteria 2879
274 Ga0496112_0100494 3300048915 Bacteria 2862
275 Ga0496113_0061406 3300048916 Bacteria 2836
276 Ga0496113_0073067 3300048916 Unclassified 2612
277 Ga0496114_0331285 3300048917 Bacteria 1346
278 Ga0501034_0038308 3300049571 Bacteria 4855
279 Ga0501034_0099369 3300049571 Bacteria 2905
280 Ga0501036_0095663 3300049572 Bacteria 2511
281 Ga0501036_0397723 3300049572 Bacteria 1149
282 Ga0501039_0166410 3300049575 Bacteria 1733
283 Ga0501040_0313605 3300049576 Bacteria 1121
284 Ga0501042_0084851 3300049578 Bacteria 2271
285 Ga0501042_0495440 3300049578 Bacteria 887
286 Ga0501048_0052691 3300049582 Unclassified 2896
287 Ga0501067_0217713 3300049583 Bacteria 1063
288 Ga0501068_0256001 3300049584 Bacteria 1116
289 Ga0501069_0030859 3300049585 Bacteria 2945
290 Ga0501071_0027413 3300049587 Bacteria 4007
291 Ga0501072_0060189 3300049588 Bacteria 2995
292 Ga0501074_0262388 3300049590 Bacteria 1228
293 Ga0501075_0018230 3300049591 Bacteria 5077
294 Ga0501075_0166393 3300049591 Unclassified 1682
295 Ga0501075_0194980 3300049591 Bacteria 1545
296 Ga0501076_0003930 3300049592 Bacteria 10485
297 Ga0501076_0057936 3300049592 Bacteria 3077
298 Ga0501081_0051696 3300049743 Bacteria 2834
299 Ga0501045_0270321 3300049824 Bacteria 1265
300 nmdc:mga00v17_14123_c1 3300050491 Bacteria 4452
301 nmdc:mga00v17_45004_c1 3300050491 Bacteria 2664
302 nmdc:mga0yw44_63738_c1 3300050492 Bacteria 2267
303 nmdc:mga0k408_4398_c1 3300050493 Bacteria 7484
304 nmdc:mga06z11_35695_c1 3300050494 Bacteria 2449
305 nmdc:mga06z11_39411_c1 3300050494 Bacteria 2351
306 nmdc:mga05p37_23529_c2 3300050507 Bacteria 5575
307 nmdc:mga05p37_27033_c1 3300050507 Bacteria 6983
308 nmdc:mga05p37_29440_c1 3300050507 Bacteria 6701
309 nmdc:mga05p37_7067_c1 3300050507 Bacteria 13232
310 nmdc:mga05p37_8284_c1 3300050507 Bacteria 12290
311 nmdc:mga05p37_84981_c1 3300050507 Bacteria 3899
312 nmdc:mga09592_27178_c1 3300050508 Bacteria 4748
313 nmdc:mga09592_30981_c1 3300050508 Bacteria 4454
314 nmdc:mga09592_3626_c1 3300050508 Bacteria 12461
315 nmdc:mga09592_48144_c1 3300050508 Bacteria 3593
316 nmdc:mga0qj67_16822_c1 3300050509 Bacteria 5553
317 nmdc:mga0qj67_30270_c1 3300050509 Bacteria 4211
318 nmdc:mga0qj67_352667_c1 3300050509 Bacteria 1189
319 nmdc:mga0qj67_9068_c1 3300050509 Bacteria 7384
320 nmdc:mga06r32_39190_c1 3300050510 Bacteria 4495
321 nmdc:mga06r32_47796_c1 3300050510 Bacteria 4089
322 nmdc:mga06r32_555232_c1 3300050510 Bacteria 1122
323 nmdc:mga08y16_1582_c1 3300050511 Bacteria 22965
324 nmdc:mga08y16_58452_c1 3300050511 Bacteria 4029
325 nmdc:mga08y16_65658_c1 3300050511 Bacteria 3788
326 nmdc:mga08y16_8682_c1 3300050511 Bacteria 10660
327 nmdc:mga0n895_14444_c1 3300050512 Bacteria 7172
328 nmdc:mga0n895_525946_c1 3300050512 Bacteria 1190
329 nmdc:mga0rr50_15044_c1 3300050513 Bacteria 5098
330 nmdc:mga0rr50_48364_c1 3300050513 Bacteria 3143
331 nmdc:mga0rr50_554022_c1 3300050513 Unclassified 979
332 nmdc:mga0a205_229426_c1 3300050515 Bacteria 1740
333 nmdc:mga0a205_2481_c1 3300050515 Bacteria 16269
334 Ga0500628_006903 3300053129 Bacteria 1932
335 Ga0501084_0206777 3300054114 Bacteria 1656
336 Ga0501084_0278914 3300054114 Bacteria 1411
337 Ga0590071_001744 3300059421 Bacteria 5616
338 Ga0590071_003421 3300059421 Bacteria 3901
339 Ga0590074_000695 3300059423 Bacteria 5121
340 Ga0590075_000199 3300059424 Bacteria 16690
341 Ga0590077_000064 3300059426 Bacteria 26586
342 Ga0590077_003126 3300059426 Bacteria 3465
343 Ga0501082_0012157 3300060353 Bacteria 7396
344 Ga0530510_0234063 3300061734 Bacteria 1367
345 Ga0530510_0432145 3300061734 Bacteria 994
346 nmdc:mga0k408_289828_c1
347 JGI24743J22301_10016073
348 Ga0065712_10075330
349 Ga0065712_10096120
350 Ga0065712_10117795
351 Ga0065712_10155593
352 Ga0065715_10104105
353 Ga0065715_10207235
354 Ga0065707_10110343
355 Ga0070676_10008683
356 Ga0070683_100001984
357 Ga0070683_100189831
358 Ga0070670_100037269
359 Ga0070670_100353942
360 Ga0070666_10090874
361 Ga0070666_10172119
362 Ga0070680_100096656
363 Ga0070682_100038422
364 Ga0070687_100001846
365 Ga0070661_100100961
366 Ga0070661_100258296
367 Ga0070661_100284247
368 Ga0070668_100034159
369 Ga0070668_100196849
370 Ga0070669_100001909
371 Ga0070669_100172174
372 Ga0070675_100363599
373 Ga0070671_100051290
374 Ga0070671_100066206
375 Ga0070674_100038507
376 Ga0070674_100039796
377 Ga0070674_100079852
378 Ga0070674_100109693
379 Ga0070673_100013830
380 Ga0070673_100067122
381 Ga0070688_100085116
382 Ga0070709_10039051
383 Ga0070713_100026532
384 Ga0070711_100369626
385 Ga0070705_100013044
386 Ga0070700_100102213
387 Ga0070663_100051605
388 Ga0070678_100072163
389 Ga0070678_100308159
390 Ga0070662_100225177
391 Ga0068867_100127039
392 Ga0070699_100094154
393 Ga0070679_100314698
394 Ga0070684_100008525
395 Ga0070684_100043925
396 Ga0070672_100033262
397 Ga0070695_100046217
398 Ga0070693_100020238
399 Ga0070693_100041743
400 Ga0070704_100258210
401 Ga0070704_100310379
402 Ga0070664_100000331
403 Ga0070664_100095526
404 Ga0068857_100017602
405 Ga0068854_100015445
406 Ga0068856_100520125
407 Ga0070702_100020705
408 Ga0068852_100075227
409 Ga0068852_100189198
410 Ga0068852_100245127
411 Ga0068864_100051315
412 Ga0068864_100434442
413 Ga0068866_10030071
414 Ga0068861_100067983
415 Ga0068870_10009671
416 Ga0068863_100147426
417 Ga0068862_100185246
418 Ga0068862_100299437
419 Ga0075365_10040666
420 Ga0075368_10018705
421 Ga0075364_10000556
422 Ga0075364_10043123
423 Ga0075364_10061456
424 Ga0075362_10002939
425 Ga0075367_10012934
426 Ga0075366_10005102
427 Ga0075366_10016428
428 Ga0075366_10201337
429 Ga0075370_10010449
430 Ga0075428_100004081
431 Ga0075428_100005960
432 Ga0075428_100009372
433 Ga0075430_100014526
434 Ga0075430_100018817
435 Ga0075430_100030705
436 Ga0075430_100033577
437 Ga0075430_100407679
438 Ga0075431_100042835
439 Ga0075431_100059749
440 Ga0075431_100126825
441 Ga0075431_100306929
442 Ga0075433_10169425
443 Ga0075434_100029438
444 Ga0075434_100561872
445 Ga0075429_100015451
446 Ga0075429_100033307
447 Ga0075429_100102388
448 Ga0075429_100212255
449 Ga0068865_100215342
450 Ga0075435_100107678
451 Ga0075435_100464635
452 Ga0105240_10019207
453 Ga0105240_10395935
454 Ga0111539_10000245
455 Ga0111539_10000335
456 Ga0111539_10113096
457 Ga0111539_10288943
458 Ga0111539_10678054
459 Ga0111539_10716705
460 Ga0111539_10770292
461 Ga0111539_10924028
462 Ga0114129_10001599
463 Ga0114129_10001743
464 Ga0114129_10003587
465 Ga0114129_10004642
466 Ga0114129_10004905
467 Ga0114129_10089988
468 Ga0105243_10018248
469 Ga0105241_10089086
470 Ga0105242_10053131
471 Ga0105248_10069651
472 Ga0105249_10000497
473 Ga0157370_10174642
474 Ga0157378_10206331
475 Ga0157378_10587717
476 Ga0157372_10103127
477 Ga0157372_10439120
478 Ga0157375_10157949
479 Ga0163163_10266343
480 Ga0207697_10001000
481 Ga0207697_10017612
482 Ga0207642_10076516
483 Ga0207642_10085373
484 Ga0207680_10098427
485 Ga0207647_10149931
486 Ga0207699_10048358
487 Ga0207645_10022660
488 Ga0207695_10054575
489 Ga0207660_10047045
490 Ga0207662_10066134
491 Ga0207649_10318011
492 Ga0207652_10040505
493 Ga0207652_10127791
494 Ga0207681_10015283
495 Ga0207681_10109904
496 Ga0207681_10183924
497 Ga0207681_10196056
498 Ga0207694_10206082
499 Ga0207650_10007409
500 Ga0207650_10053711
501 Ga0207650_10159431
502 Ga0207659_10520573
503 Ga0207700_10017755
504 Ga0207644_10027744
505 Ga0207644_10111894
506 Ga0207690_10192835
507 Ga0207706_10160951
508 Ga0207709_10122423
509 Ga0207669_10030777
510 Ga0207669_10144578
511 Ga0207669_10316470
512 Ga0207691_10022101
513 Ga0207711_10042251
514 Ga0207711_10281601
515 Ga0207711_10553417
516 Ga0207689_10261003
517 Ga0207661_10310073
518 Ga0207679_10001280
519 Ga0207679_10162281
520 Ga0207679_10195671
521 Ga0207651_10007840
522 Ga0207651_10458047
523 Ga0207712_10009554
524 Ga0207640_10063006
525 Ga0207703_10035580
526 Ga0207678_10071836
527 Ga0207678_10583775
528 Ga0207708_10082420
529 Ga0207702_10181219
530 Ga0207641_10349377
531 Ga0207641_10357320
532 Ga0207648_10068352
533 Ga0207676_10101711
534 Ga0207674_10026474
535 Ga0207675_100048478
536 Ga0207675_100094050
537 Ga0207683_10018664
538 Ga0207683_10350608
539 Ga0207683_10378227
540 Ga0207698_10204806
541 Ga0207428_10004422
542 Ga0207428_10005394
543 Ga0207428_10048187
544 Ga0268265_10018574
545 Ga0268265_10847518
546 Ga0268264_10054732
547 Ga0268264_10893103
548 Ga0307408_100006970
549 Ga0307408_100017954
550 Ga0307408_100064110
551 Ga0307408_100078266
552 Ga0307408_100399900
553 Ga0307405_10156710
554 Ga0307405_10295505
555 Ga0307413_10044217
556 Ga0307413_10073075
557 Ga0307410_10035172
558 Ga0307410_10230079
559 Ga0307406_10161216
560 Ga0307406_10365000
561 Ga0307407_10307034
562 Ga0307412_10049468
563 Ga0307412_10142531
564 Ga0307409_100043612
565 Ga0307409_100488018
566 Ga0307416_100016171
567 Ga0307416_100028914
568 Ga0307416_100042450
569 Ga0307416_100085686
570 Ga0307416_100209411
571 Ga0307416_100947004
572 Ga0307415_100135646
573 Ga0307415_100307831
574 Ga0373936_0140083
575 Ga0373955_0117686
576 Ga0373961_0033869
577 Ga0373947_0020222
578 Ga0373947_0105462
579 Ga0373937_0004240
580 Ga0373937_0714968
581 Ga0373925_0007232
582 Ga0439453_0008840
583 Ga0439445_0017863
584 Ga0439462_0033269
585 Ga0450923_004608
586 Ga0450896_000914
587 Ga0450908_005580
588 Ga0439434_0086196
589 Ga0439435_0032487
590 Ga0439435_0039101
591 Ga0439435_0061969
592 Ga0439435_0076329
593 Ga0439435_0110279
594 Ga0439444_0032434
595 Ga0439464_0010630
596 Ga0439464_0067231
597 Ga0439460_0059749
598 Ga0450918_007444
599 Ga0439440_0005637
600 Ga0453684_0268493
601 Ga0495594_0288607
602 Ga0495613_0130744
603 Ga0496101_0090840
604 Ga0496101_0556415
605 Ga0496102_0004092
606 Ga0496104_0021633
607 Ga0496105_0245792
608 Ga0496106_0130434
609 Ga0496108_0000781
610 Ga0496108_0079878
611 Ga0496109_0001270
612 Ga0496110_0002509
613 Ga0496110_0054356
614 Ga0496111_0019566
615 Ga0496111_0179643
616 Ga0496112_0000228
617 Ga0496112_0023336
618 Ga0496112_0099371
619 Ga0496112_0100494
620 Ga0496113_0061406
621 Ga0496113_0073067
622 Ga0496114_0331285
623 Ga0501034_0038308
624 Ga0501034_0099369
625 Ga0501036_0095663
626 Ga0501036_0397723
627 Ga0501039_0166410
628 Ga0501040_0313605
629 Ga0501042_0084851
630 Ga0501042_0495440
631 Ga0501048_0052691
632 Ga0501067_0217713
633 Ga0501068_0256001
634 Ga0501069_0030859
635 Ga0501071_0027413
636 Ga0501072_0060189
637 Ga0501074_0262388
638 Ga0501075_0018230
639 Ga0501075_0166393
640 Ga0501075_0194980
641 Ga0501076_0003930
642 Ga0501076_0057936
643 Ga0501081_0051696
644 Ga0501045_0270321
645 nmdc:mga00v17_14123_c1
646 nmdc:mga00v17_45004_c1
647 nmdc:mga0yw44_63738_c1
648 nmdc:mga0k408_4398_c1
649 nmdc:mga06z11_35695_c1
650 nmdc:mga06z11_39411_c1
651 nmdc:mga05p37_23529_c2
652 nmdc:mga05p37_27033_c1
653 nmdc:mga05p37_29440_c1
654 nmdc:mga05p37_7067_c1
655 nmdc:mga05p37_8284_c1
656 nmdc:mga05p37_84981_c1
657 nmdc:mga09592_27178_c1
658 nmdc:mga09592_30981_c1
659 nmdc:mga09592_3626_c1
660 nmdc:mga09592_48144_c1
661 nmdc:mga0qj67_16822_c1
662 nmdc:mga0qj67_30270_c1
663 nmdc:mga0qj67_352667_c1
664 nmdc:mga0qj67_9068_c1
665 nmdc:mga06r32_39190_c1
666 nmdc:mga06r32_47796_c1
667 nmdc:mga06r32_555232_c1
668 nmdc:mga08y16_1582_c1
669 nmdc:mga08y16_58452_c1
670 nmdc:mga08y16_65658_c1
671 nmdc:mga08y16_8682_c1
672 nmdc:mga0n895_14444_c1
673 nmdc:mga0n895_525946_c1
674 nmdc:mga0rr50_15044_c1
675 nmdc:mga0rr50_48364_c1
676 nmdc:mga0rr50_554022_c1
677 nmdc:mga0a205_229426_c1
678 nmdc:mga0a205_2481_c1
679 Ga0500628_006903
680 Ga0501084_0206777
681 Ga0501084_0278914
682 Ga0590071_001744
683 Ga0590071_003421
684 Ga0590074_000695
685 Ga0590075_000199
686 Ga0590077_000064
687 Ga0590077_003126
688 Ga0501082_0012157
689 Ga0530510_0234063
690 Ga0530510_0432145

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00285

Citrate_synt

Citrate synthase, C-terminal domain

60

243

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6bol-assembly1.cif.gz_A crystal structure of mutant 2-methylcitrate synthase mcsag419a from aspergillus fumigatus. 0.8304 49 261
3tqg-assembly1.cif.gz_A structure of the 2-methylcitrate synthase (prpc) from coxiella burnetii 0.8236 50 270
2cts-assembly1.cif.gz_A-2 crystallographic refinement and atomic models of two different forms of citrate synthase at 2.7 and 1.7 angstroms resolution 0.8143 46 261
6csc-assembly1.cif.gz_A chicken citrate synthase complex with trifluoroacetonyl-coa and citrate 0.8141 36 261
1csc-assembly1.cif.gz_A structure of ternary complexes of citrate synthase with d-and l-malate: mechanistic implications 0.8102 46 261
ID Description Score Start End Superfamily
2p2wA02 Mainly Alpha;Orthogonal Bundle;Cytochrome p450-Terp; domain 2;Cytochrome P450-Terp, domain 2 0.8319 117 218 1.10.230.10
af_Q8I6U7_394_509_1.10.580.10 Mainly Alpha;Orthogonal Bundle;Citrate Synthase; domain 1;Citrate Synthase, domain 1 0.7877 119 225 1.10.580.10
2p2wA02 Mainly Alpha;Orthogonal Bundle;Cytochrome p450-Terp; domain 2;Cytochrome P450-Terp, domain 2 0.7804 117 218 1.10.230.10
1aj8B02 Mainly Alpha;Orthogonal Bundle;Cytochrome p450-Terp; domain 2;Cytochrome P450-Terp, domain 2 0.7678 117 223 1.10.230.10
1aj8B02 Mainly Alpha;Orthogonal Bundle;Cytochrome p450-Terp; domain 2;Cytochrome P450-Terp, domain 2 0.755 117 223 1.10.230.10
ID Description Score Start End GO Terms
AF-A0A101EP86-F1-model_v4 citrate synthase (unknown stereospecificity) (EC 2.3.3.16) 0.9179 25 250 GO:0004108
GO:0005829
GO:0005975
GO:0006099
AF-A0A1Q7UXZ0-F1-model_v4 CoA-binding domain-containing protein 0.9174 21 254 GO:0004775
GO:0004776
GO:0005524
GO:0006099
GO:0006629
GO:0009361
GO:0036440
AF-X0YKB1-F1-model_v4 Citrate synthase (unknown stereospecificity) 0.913 55 226 GO:0004108
GO:0005829
GO:0005975
GO:0006099
AF-A0A7V1N7P7-F1-model_v4 citrate synthase (unknown stereospecificity) (EC 2.3.3.16) 0.9009 22 262 GO:0004108
GO:0005829
GO:0005975
GO:0006099
GO:0008816
AF-A1Y9I6-F1-model_v4 citrate synthase (unknown stereospecificity) (EC 2.3.3.16) 0.898 40 254 GO:0004108
GO:0005829
GO:0005975
GO:0006099
GO:0016829

Map